LIVE THEATRE, WORKSHOPS AT NORDEN FARM AND VENUE HIRE IMPORTANT
HELLO
I am Kayleigh, the Education Officer here at Norden Farm Centre for the Arts, Maidenhead, running the department with Jess. I have enjoyed working with Maidenhead schools for the last 5 years. I’m more than happy to answer any queries and book in your workshops, just drop me a message!
The Farm Out programme for the 2024 - 2025 academic year includes workshops that have been handpicked for you, giving your students the chance to work on large 3D visual arts projects, learn new techniques, use new equipment or instruments and work collaboratively in the classroom.
All of the workshops we offer are led by professional, experienced arts practitioners. They are all experienced in working with school children and are DBS checked.
Don’t miss our special projects which run throughout the year including Lantern Making for the Lantern Parade, the Quest Family Fest Schools Project and Kite Making for the Summer Kite Festival.
I hope that there is something in this brochure which your students and team will enjoy. Seen something you fancy and want to tailor it to your current teaching? Let me know and I can speak to our artists to help make the perfect workshop for you and your students.
If you have any questions about the Farm Out programme, or about what Norden Farm can offer, please get in touch.
ABOUT US Norden Farm Centre for the Arts
Norden Farm is an arts centre, run by the Norden Farm Centre Trust, a registered charity. We’re built on the site of an ancient farm on the outskirts of Maidenhead, near Altwood School. We are a thriving arts centre, averaging 150 events a term, and open 5 days a week
We are passionate about what we do and know that the arts have the power to change lives. We believe that everyone should have the chance to experience and participate in high quality, transformative and life enhancing arts events.
Through our education, participation and outreach programme, we provide a range of opportunities for the whole community We deliver a regular programme of classes and activities for children, young people and adults, produce special projects and support artists and the local creative community to create and present work.
FARM OUT
What is our Farm Out Programme?
The Farm Out Programme is supported by the Norden Farm Centre Trust and the Spoore, Merry and Rixman Foundation. The programme provides schools with access to professional artists, through workshops and performances.
Secondary schools within the Old Borough of Maidenhead are allocated up to a value of £400 to spend on performances, event cinema and workshops at Norden Farm at any point during the 2024/2025 academic year. To participate, schools pay a £60 (inc VAT) administration fee upon completion of their first booking.
If you are unsure whether your school is eligible for the Farm Out allocation, please get in touch
For all bookings, final numbers must be confirmed, and full payment made at least two weeks before the date of the performance/ workshop. No cancellations or amendments may be made after this time.
All times and prices are correct at the time of issuing this document and are subject to change
Organise a School Trip to see a Live Theatre Event at Norden Farm
You can also use your Farm Out Funding to come and see a show at Norden Farm! We are very happy to help you organise a school trip to our venue to see some of the wonderful performances we have on offer across the school year
Our Education Team sends out Newsletters regularly that detail performances that link to the curriculum across various topics, including:
Drama | English | History | Music | Dance | Art and Design | Media Studies | Culture and Heritage | Religious Studies
If this is something you would be interested in, please contact our Education Team to find out more and get the list of upcoming performances!
If you are interested in staying for a short Q&A session after watching a live show, please let us know and we can enquire to book this in for you! Often the creative team and actors are happy to talk to students after the show, which is a wonderful opportunity to gain a deeper understanding of the production, text and acting process.
The majority of shows available take place in the evenings after school hours and tend to be suitable for KS3 and KS4. Please take this into consideration when planning your trip.
You can check out our latest events, shows and cinema screenings by scanning the QR code. You can also get in touch with the Education Team via email at education@nordenfarm.org
WORKSHOPS AT NORDEN FARM
Theatre Company Workshops
Coming to see a show at Norden Farm?
Some Theatre Companies offer wrap around drama, dance or writing workshops, themed around their performance If you would like to talk about the options available for your visit please get in touch!
Introduction to Technical Theatre
Led by Norden Farm Technicians
KS3 I KS4
Price available on request
A hands-on opportunity for students to gain an overview of technical theatre at Norden Farm. Learn about the basic principles of lighting and sound. Activities include working on the tension wire grid above the stage, using the lighting and sound desk and creating lighting effects.
VENUE HIRE
Venue Hire
Why not hire the Courtyard Theatre for your school’s summer production or hire our Studio Theatre for a professional venue for your Drama and Theatre Studies exams? For enquiries and bookings, please contact the Venue Hire Team.
Tel / 01628 682555
Email / venuehire@nordenfarm org
SCHOOLS EXHIBITION
Maidenhead Schools Art Exhibition
Norden Farm presents the fifth Maidenhead Schools: Art, Design and Photography Exhibition Tuesday 22 October - Friday 9 November 2024
‘What a great space to showcase some wonderfully talented young artists. Very impressed with the amazing standard’ Guestbook
This is an opportunity to showcase your school and the best work from your students in a professional Art Gallery at Norden Farm Centre for the Arts.
Following the success of our art competition last year, it returns for 2024! Taking on board feedback from participants and judges we will have the following four categories for artwork.
Photography and Design
Including but not limited to; photography, illustration and graphic design.
Drawing and Painting
Including but not limited to; pencil and pen drawings and painting in oils and watercolours.
Textiles and Mixed-Media
Including but not limited to; textiles, printing and multi texture pieces.
Digital Art
Including but not limited to; digital art, stop motion animation, videos and digital drawings.
Please specify the category upon submission.
Important information SCHOOLS EXHIBITION
Please share photos / videos of the artwork you plan to exhibit as soon as you can. This is so we can plan the Gallery space. Please specify which competition category the artwork belongs to.
The artwork will need to be at Norden Farm between Tues 15 Oct and Fri 18 Oct 2024. Please let us know which day works best for you that week so we can meet you in the foyer to take the work. Videos will need to be sent by end of day on Thurs 17 Oct 2024.
We will need the names of all students to go with their work. If possible, we would love to have a small description of their work alongside a title and date. These will be made into plaques to go next to their pieces. Please email a PDF or Word Document with this list.
An evening of celebration will be held in the Gallery for students, parents, teachers and press to attend. The results of the competition will given by the judges and prizes awarded to winning students. This date is to be confirmed.
Each participating school must host at least one private viewing during the exhibition and promotes the show to its community on condition of entering. If you haven't already booked this in, please get in touch so we can make the arrangements for you.
All work must be wall mounted and will be hung in the professional double height Gallery at Norden Farm Centre for the Arts. If you are unsure about whether the work is suitable please have a chat with me and we will see if we can make it work!
Work submitted can be 2D or digital and work within the following categories; Painting and Drawing, Textiles and Mixed Media, Photography and Design or Digital Art, including video, animation and digital drawing. Small sculptures may be able to enter if supplied with appropriate wall mounts.
HOLOCAUST MEMORIAL
Holocaust Memorial Day School’s Event
Tuesday 28 January 2025 I 10am - 12.30pm
Student Tickets £5. For large school bookings, you receive a complimentary ticket for staff use, for every 10 tickets bought.
Your tickets can be subsidised by your Farm Out funding if you are eligible.
To mark Holocaust Memorial Day, Norden Farm is showing a screening of the film Nicky's Family. Followed by a presentation hosted by Nick Winton, son of Sir Nicholas 'Nicky' Winton.
Hero of the Holocaust and former Maidenhead resident Sir Nicholas Winton rescued hundreds of Jewish children from Czechoslovakia just before the outbreak of World War II.
This docudrama tells the remarkable true story of how he organised train transport for the 669 children and arranged foster families for them in Britain.
To reserve your seats for this event, please get in touch with Kayleigh Robinson.
01628 682563
kayleigh.robinson@nordenfarm.org
Meet our wonderful team of creative professionals! In the mix we have award winning poets, fine artists, professional dancers and renowned theatre makers. We pride ourselves on offering you and your students the opportunity to engage with, and learn from, artists and practitioners with not only a vast range of skills but a fun and creative approach to learning.
Our brochure is split into the following categories:
Visual and Digital Arts | VDA
Poetry and Spoken Word | PSW
Music | MU
Drama | DR
Dance | DA
Culture and Heritage | CH
Mindfulness | MI
Our team are happy to tailor workshops for you - so if you can’t find what you want, just ask!
You can learn more about each practitioner over the next few pages.
How to Book:
Contact me at kayleigh.robinson@nordenfarm.org or call 01628 682563 and let me know the following:
Your Chosen Workshop Suggested Dates Year Group and Number of Classes / Students Page 10
Nisha Anil | VDA | DR
Nisha has worked on stage, in film and as a presenter on television She is trained in Mime / physical theatre and studied at Darlington College of the Arts.
CultureMix Arts is a steel pan music and carnival arts specialist providing workshops, tasters, demonstrations, talks and performances featuring the steel pan, how it is made, the history and origins and how it relates to British music culture. RASPO - Reading All Steel Percussion Orchestra is the cornerstone of CultureMix Art’s work enabling people of all ages and abilities to experience playing music in an accessible orchestra with a focus on young people who would not normally access music lessons.
Desree is a dynamic children's workshop facilitator with a background in drama studies and a passion for empowering individuals through creative expression. She has extensive experience working with diverse groups in schools, corporate settings, and theatres across the UK, delivering workshops that build confidence, enhance literacy, and inspire a love for the arts
Desree has developed wellbeing programs and has led creative writing and drama workshops in schools across the country.
Shannel Joseph | VDA
Shannel Joseph, is the founder of Animation Expressions. She has 10 years experience in running workshops for children and has an Animation BA. Animation is a great way to combine creative skills with digital learning. It is also a good way of expressing thoughts and ideas in an audio-visual format, ‘taking ART & ICT to infinity and beyond’
Little Tanks | DR
The Little Tanks ethos is ‘building confidence through drama’. They aim to develop a child’s confidence by using drama skills and nurturing them to feel more comfortable when performing as well as in everyday life
Mandinka Roots | VDA | MU | DA | CH
Mandinka Roots have been teaching children and adults about West African culture, both in the UK and abroad, since 2005 Oumar Alex Sagna is originally from Senegal where he worked as an artiste for many years Since coming to the UK in 2005, Oumar Alex has passed on his love of West African culture in a fun and exciting way.
James Parsons is a bestselling, internationally published cartoonist and the only full-time comic art teacher in the UK Since 2005 he has delivered thousands of high energy comic art workshops in hundreds of schools around the country, as well as at museums, galleries, libraries and festivals. A dynamic, totally unique, and unforgettable creative experience is guaranteed every time!
Marta Mathea Radwan | MU
Dr Marta Mathea Radwan is a conductor, vocalist, composer, arranger, music director, and workshop leader Marta has a wide education both as a conductor and a singer and holds a doctor of music. She has led over a dozen choirs, of up to 100 singers, and also led big band and orchestra. She is also a dedicated educator with experience in teaching music from primary school to university. Her main passion is jazz and vocal improvisation. She led Circle Songs and Vocal Improvisation workshops around Europe and worldwide (online)
Readipop | VDA
Readipop is a music charity based in Reading offer a variety of engaging, creative workshops run by their experienced music leaders. Readipop enable children to learn new instruments, rhythms and how to work as a group.
Award winning poet Coral has published five collections of children’s poetry and a picture book. Coral has contributed to around 200 anthologies, and her work for younger children has been featured many times on CBeebies TV and Radio. Michael Rosen has said ‘Rumble has a dash and delight about her work’.
Design and create amazing characters! Learn the secret storytelling and cartooning tricks used by professionals. Discover how to tell a brilliant story using a sequence of words and pictures. These fast-moving workshops cover all the essentials of creating an effective comic strip, including character creation, setting, plot, expression, sound effects, movement, speech and thought.
WHAT DID OTHER SCHOOLS THINK?
‘As usual, the children had an amazing time with Amanda. She is so calm and patient as well as inspiring the children's creativity. They were fascinated to watch videos of the Dale Chihuly creating his glass sculpture's and then to be part of a collaboration to make their own display’
Wessex Primary School
Block Printing
Led by Amanda Schenk
KS3 | SEN
Half Day £180 | Whole Day £280 (plus materials)
Students will create block printing during an exciting session. Block prints can form a gigantic posters a treasured class book or be printed on fabric depending on your class needs.
Roly teaches magic to children of all ages. He has taught magic in schools, holiday clubs and for many foreign exchange students.
He provides all the props and guidance needed to allow youngsters a peep into the art of magic and conjuring.
WHAT DID OTHER SCHOOLS THINK?
‘Our boys and girls in Year 1 thoroughly enjoyed their Magic workshop this morning. The children were amazed by the tricks. There was evening disappearing paint’
Boyne Hill CE infant and Nursery School
VISUAL AND DIGITAL ART WORKSHOPS
Paper Puppetry- Intro to Puppetry
Led by Nisha Anil
KS3
Half Day: £275 | Whole Day: £550
Learn the basics of puppetry (Bunraku-style paper-puppets) in solo and group-work focusing on transitional skills (collaboration, team-work, listening and presentation).
WHAT DID OTHER SCHOOLS THINK?
‘This workshop helped to fulfil computing curriculum with excellent resources and expert Thank you, we loved creating our own animations and using exciting technology!’
Riverside Primary School
Digital Animation
Led by Shannel Joseph
KS3 | KS4
Half Day: £300 | Whole Day: £450
Using tablets to create their designs, all children play a special role in the making process to bring the animation to life. After each exciting workshop, their wonderful animations will be presented to the school and uploaded to Norden Farm’s social media. A fantastic memory to be shared with the family and friends to watch over and over again.
All equipment is provided, only require a standard sized classroom and creative class.
VISUAL AND DIGITAL ART WORKSHOPS
‘Bag for Life’ Printing
Led by Berkshire Printmakers
KS3 I SEN
Whole Day (For up to 30 students. Please note, larger groups may need to be split into smaller groups) £500 + £2 per student for organic cotton bags. Slogan and/or school name can be printed on the bags at an additional cost.
Design a bag for life. Printing on 100% organic cotton tote bags, the students will create and print their own designs using water based inks. By the end of the day, they will have a unique bag they have hand-printed to take home and reuse time and time again. As well as learning about the silkscreen printing process, we will cover environmental issues of the fashion industry and the importance of reuse and recycling.
Silkscreen Printing
Led by Berkshire Printmakers
KS3 I SEN
Whole Day (For up to 30 students. Please note, larger groups may need to be split into smaller groups) £500
Learn the art of silkscreen printing. This workshop can be tailored to your classroom topic whether it is The Vikings, Pop Art, Diwali or wildlife and nature. Printing on A3 paper the students will create paper stencils to reflect the chosen theme. They will then use these to create their print using one of our plain or patterned screens. The students will learn about foreground and background, complimentary, hot and cold colours, as well as how to use a squeegee!
VISUAL AND DIGITAL ART WORKSHOPS
T-Shirt Printing
Led by Berkshire Printmakers
KS3 I SEN
Whole Day £500 + £5 per student for an organic cotton t-shirt. Alternatively, students can bring in a preloved t-shirt from home or source their own plain t-shirt.
Be a fashion designer for the day. This is a fun workshop using paper stencils and a library of plain and patterned screens to produce a unique t-shirt print. The students take part in the whole design process. They will learn about colours, templates, positive and negative and colour mixing, as well as learning how to silkscreen.
This workshop is a full day workshop for up to 30 students. Please note, larger groups may need to be split into smaller groups.
Screen Print with Artist
Led by Berkshire Printmakers
KS4 I KS5
Whole Day (For up to 30 students. Please note, larger groups may need to be split into smaller groups)
£Price upon request
A workshop for GCSE and A level students giving them the chance to work alongside two art practitioners. The day starts with a demonstration and discussion around their creative practice, and the different ways they use printmaking. The indepth workshop gives students the opportunity to engage with the printmaking process using both photo-screens and stencils to create their own artwork. They will experiment with colour/luminosity, techniques, composition and develop and refine their work throughout the day.
VISUAL AND DIGITAL ART WORKSHOPS
Clay Monsters / Animals
Led by Helen D Evans
KS3 | SEN
Half Day £175 I Whole Day £275 (plus materials use of tools and firing)
Let your fictional characters come to life! Children can choose to make a specific character from their favourite book. Clay monsters/animals can be based on fictional characters or created from their own imagination. The choices are limitless! You will be given the opportunity to draw and make your character out of clay. Work will be fired and then returned to the school ready to be painted.
WHAT DID OTHER SCHOOLS THINK?
‘Agreatexperiencetotrysomethingnew,manyofourstudentshadneverusedclay before Ourstudentsreallyenjoyedthisandwouldlovetobeabletodoitmoreoften They can'twaittogettheircreationbackandafewhavealreadyaskedifwecoulddoitagain’
Ancient Coil Pots
Led by Helen D Evans
KS3
Half Day £175 I Whole Day £275 (plus materials use of tools and firing)
Students will look into the age-old art of making coil pots and apply decoration inspired by specific countries such as Egypt, Greece, Roman, West Africa or China to suit your curriculum needs. Work will be fired and then returned to the school.
After a whistle-stop tour through 400 years of this tiny but mighty poetic form, professional poet Simon Mole will equip your class with all they need to write their own miniature master-pieces in a haiku style!
As well as creating a collection of poems to publish or display, this session builds some important writing skills that can be applied across the curriculum – such as creating vivid imagery, and editing your ideas.
WHAT DID OTHER SCHOOLS THINK?
‘A really positive day where the children in year 5 left with great feeling of success which was shared with the whole school. It was a fantastic experience and one that we can't wait to have again in the not too distant future’
Readipop are here to show you how this little instrument is accessible to all involved! With a bit of guidance, your class will soon be playing along and composing their own songs.
DJ Workshop
Led by Tons
of Sound
KS2 I KS3
2 hours £150 I Additional hours £75 per hour
Additional DJ stations £50 (Plus travel and setup costs)
Sessions are tailored to all skill levels from beginners right through to advanced students who are interested in trying something new or want to pursue DJing as a full time career. The session covers everything from switching, mixing and even trying some cool effects.
WHAT DID OTHER SCHOOLS THINK?
‘The workshops gave children an incredible view across a variety of arts and creative topics, it inspired them to have a go and try again, and gave them a wider experience than we would be able to on our own. The children left the majority of workshops beaming from ear to ear, and were so excited to share everything they have learned!’
A Maidenhead Primary School
MUSIC WORKSHOPS Samba Drumming
Led by Readipop
KS3 I SEN
Half Day £250 I Whole Day £475
Use the drums to make exciting samba sounds and rhythms that come straight from Brazil! In this session, you’ll learn how to work together to form a drumming group and show off your new skills when you perform together. Ideal for Year 5 and 6.
African Drumming
Led by Readipop
KS3 I SEN
Half Day £250 I Whole Day £475
Learn and create traditional and new African rhythms using Djembe drums as a class. Your group will quickly be playing together, with the chance to perform a drum solo.
WHAT DID OTHER SCHOOLS THINK?
‘It worked really well and engaged all the children for over 40 minutes - no mean feat with 4 year olds! It left the children buzzing with excitement and was something totally different to what we are normally able to offer them for music’
Burchett’s Green Primary School
MUSIC WORKSHOPS
Steel Band Music
Led by CultureMix Arts
KS3 I SEN
Half Day £600 I Whole Day £950
Create a steel pan band in your class! Taster workshops are an ideal way to introduce steel pan music to your students through a series of hands on music workshops with tutors and a full set of instruments provided. Programmed to suit your school timetable each workshop covers the history and origins of the steel pan instrument, basic playing techniques and learning a simple song to play together.
Full day covers the whole school day with up to 6 workshops.
Circle Songs: Make Music on the Spot
Led by Marta Marthea Radwan
KS3 | KS4 | SEN
Half Day £275 I Whole Day £500
Circle Song is a form of creating music on the spot. No sheet music or rehearsal required. Just a pure fun of singing and making music together regardless of age or musical experience. Led by the leader musical circle is a great ‘team building’ experience.
WHAT DID OTHER SCHOOLS THINK?
‘I loved seeing how the facilitators built up the music and taught the different parts so effectively - it really sounded great! The workshop leaders had high aspirations for the children and it was incredible to see and hear how much they achieved in an hour. It gave the children an opportunity to take part in a new activity, from a different culture’
Cookham Rise Primary School
MUSIC WORKSHOPS
XOX Music Tech
Led by Readipop
KS3 I SEN
Half Day £250 I Whole Day £475
Learn to make and programme your own beats, rhythms and recognisable tunes using Readipop’s historically significant synthesisers and drum machines. Lots of strange and interesting sounds can be explored. A fun workshop for all abilities.
WHAT DID OTHER SCHOOLS THINK?
‘This was amazing the students loved the session. They enjoyed it being interactive, having a team approach so each person got a turn. They paced it right and engaged all students and staff’ Manor Green School
Singing Improvisation: Unleash Your Musical Creativity
Led by Marta Marthea Radwan
KS3 | KS4 | SEN
Half Day £275 I Whole Day £500
Singing Improvisation is a great way to express yourself and explore music creativity. Through funny exercises children learn how to make their own music and own songs. It helps build confidence in creating and performing. Lots of fun and laughter whilst building key skills in music.
DRAMA WORKSHOPS
From Page to Stage
Led by Little Tanks
KS3 | SEN
Half Day £200 | Whole Day £400 (plus materials)
Bring to life a book, short story or play in your classroom. Bring new meaning to your story through drama that your pupils will remember forever! Please provide Little Tanks with the story of your choice at least two weeks in advance of your workshop.
Explore Galore and Go!
Led by Nisha Anil
KS3
Half Day £200 | Whole Day £400
Explore the emotions and the elements to help find a character. Students will use their imaginations to create their own character and story through play and movement. Build confidence, try out ideas and invent something new.
Stories and Theatre
Led by Nisha Anil
KS3
Half Day £200 | Whole Day £400
Pick a story, tell a summary of it, turn it into a song, turn the song into a dance, then turn the dance into a new story. A new story is created with each activity without having to be written down.
DRAMA WORKSHOPS
Lights, Camera, Actions!
Intro to TV and Film-making
Led
by Nisha Anil KS3
Half Day £300 | Whole Day £600
Learn the basics of Acting, Camera Operating, Directing and Presenting* through games, tasks and film-making exercises.
*Presenting skills basics can be covered but this could run as a separate workshop.
WHAT DID OTHER SCHOOLS THINK?
‘It’s always excellent seeing students work with an outside professional. The students were engaged and thoroughly enjoyed the workshop. It gave them a space to be creative and work with others’
Furze Platt Senior
Exploring Themes: Develop, Discover and Devise
Led by Little Tanks
KS3 | KS4
Half Day £200 | Whole Day £400 (plus materials)
This interactive and immersive workshop is designed to guide participants through the creative process of devising theatre based on a theme. Through collaborative exercises, participants will discover various storytelling techniques, develop original material, and create a deeper understanding on the theme. The workshop aims to harness the collective creativity of the group, encourage innovation, teamwork, and personal expression.
Please provide Little Tanks with a theme of your choice with at least two weeks in advance of your workshop.
DANCE WORKSHOPS
Street Dance
Led by Street Dance Energy KS3
2 hour workshop £250 Available Tuesdays and Thursdays
Explore street dance by learning breaking, locking, body popping and some cool street dance footwork.
WHAT DID OTHER SCHOOLS THINK?
‘Students fully engaged and enjoyed the session. They enjoyed the telling of the story through dance. Students found the music relaxing and expressions very interesting. They were all intrigued by the dance form’ Manor Green School
African Dance
Led by Mandinka Roots KS3 | KS4
Half Day £350 | Whole Day £450
This workshop gives children of all ages and abilities the opportunity to experience this wonderful, vibrant and diverse culture whilst learning some of the traditional dance moves. Children leave with a spring in their step but also a broad understanding of cultural diversity.
MINDFULNESSWORKSHOPS
Wellbeing Animation
Led by Animation Expressions
KS3 | KS4 | SEN
Half Day £350 | Whole Day £550
6 Week Course - 1 Hour Each Week | £720
This workshop can be booked as a stand alone session or as a 6 week course. Wellbeing Animation would be best suited to a smaller group of select students.
Students will have the opportunity to work as a team, learn new skills and turn their stories into an inspiration through animation. This workshop can be part of a PSHE, ART or ICT lesson.
These workshops are a great benefit to students who may be suffering from loneliness, anxiety, low self esteem, SEN or those who may simply want to experience something new. The students will create stories based on true experiences and think of ways to overcome negative inner thoughts and turn them into positive ones. The animation technique is called rotoscope which is a simple yet effective form of animation for any ability. The participants will create a story around the topic ‘thoughts inside of me’, enabling them to explore their emotions and express their thoughts creatively.
WORK EXPERIENCE
At Norden Farm we have a strong commitment to encouraging young people's involvement in the arts
Work experience placements run from Tuesday - Friday and allow a student to work with all of the departments, (Box Office, Front Of House, Catering, Technical, Marketing and Education). The week includes 2 evening shifts. We can offer 1 placement a month during May - Jul and Sept - Oct (This is subject to change)
As you can imagine we become very oversubscribed for placements and therefore prioritise students who go to school/college within the RBWM area first, and then, if placements are still available, to other areas We also recommend submitting your application as early as possible.
Students who have a demonstrative interest in the arts will be prioritised. As part of the selection process applicants need to submit a review of a live performance or exhibition, they have seen at Norden Farm within 2 months of their application.
If you are interested in work experience here, please head to the Norden Farm website to fill in the application form!
YOUNG LEADERS
The Young Leadership Programme at Norden Farm allows students to gain hands on work experience
The programme, which runs throughout the Easter and Summer holidays is open to young people, aged 14- 17 years.
During Summer 2024 we will recruit a team of Young Leaders to work with us on our Holiday programme, supporting local Young People to engage with the Arts
Participants will join us from Tuesday 6 August to Friday 9 August and from Tuesday 13 August to Friday 16 August During the week participants will assist with workshops and with Front of House, work alongside professional artists and performers and lead an end of week open workshop for local children and families and work on our Art Week holiday programme.
Participation in this course can be used toward Bronze, Silver or Gold Arts Award and DofE Award.
If you are interested in taking part in our Young Leader programme please head to the Norden Farm website to fill in the application form!
LANTERN PARADE
Annual Project The Carnival of the Animals
Maidenhead Community Lantern Parade
School Lantern Making Workshops
Led by Same Sky
KS2 | SEN
Nov and Dec 2024 | In your school
A contribution towards the cost of a full day workshop in your school (final prices TBC)
(For schools in the Old Borough of Maidenhead: Your Farm Out Funding cannot to be used for booking this workshops)
With the help of professional visual artists Same Sky, students learn how to weave willow to create large centrepieces and individual lanterns which are inspired by the animals of the world.
Norden Farm’s annual community lantern parade will take place on Saturday 7 December 2024
Assembling at around 4.15pm outside Maidenhead Town Hall, the Parade departs at 5pm, Celebratory Concert from 5.45pm – 6.15pm (all times to be confirmed).
Annual Project
Kite Festival - Kite Making Workshops
School Kite Making Workshops
KS2 | SEN Summer Term 2025 | In your school
A contribution towards the cost of a full day workshop in your school (final prices TBC)
(For schools in the Old Borough of Maidenhead: Your Farm Out Funding can be used for booking this workshop)
Working with professional visual artists from Community Kite Project learn to design and create a kite ready for our annual Kite Festival in September 2024
A limited number of school workshops are available to book for this project, so to register your interest please get in touch: education@nordenfarm.org
SUMMER ACTIVITY COURSES
CIRCUS WEEK
Dates to be confirmed
Led by And Circus. A week of learning incredible circus skills and performing. Learn to walk on stilts, ride a unicycle, walk the tightrope and perform on a trapeze!
Suitable for ages 7 - 13 years.
ART WEEK
Dates to be confirmed
Led by Art Adventure. Join Lucy Wright for an Art Adventure! Combining art, movement and play to provide a stimulating and creative week of fun. With a sensational exhibition at the end of the week!
Suitable for ages 8 - 11 years.
THEATRE WEEK
Dates to be confirmed
Led by Sideways Drama. Make a Play in 4 Days! Come along and dive into the world of theatre, writing, directing and star in a brand new play!
Suitable for ages 8 - 14 years.
ADVANTAGE CARD SAVINGS! more details online
IMPORTANT DATES FOR YOUR CALENDAR
Term 1
Sun 1 Sept 2024 I Kite Festival I Norden Farm Event
Wed 25 Sept 2024 I National Comic Book Day
Oct 2024 I Black History Month
Thur 3 Oct 2024 I National Poetry Day
Term 2
Oct and Nov 2024 I Lantern Parade Schools Project I Norden Farm Event
Mon 11 Nov 2024 I Remembrance Day
Thur 31 Oct- Fri 1 Nov 2024 I Diwali
Sat 7 Dec 2024 I Lantern Parade I Norden Farm Event
Term 3
Jan 2025 I International Creativity Month
Mon 27 Jan | Holocaust Memorial Day
Term 4
Mar 2024 I Women’s History Month
Thur 7 Mar 2024 I World Book Day
Fri 8 Mar 2024 I International Women’s Day
Mon 25 Mar 2024 I Holi Festival
Apr 2024 I Quest Family Festival School Project I Norden Farm Event
Term 5
Mon 22 Apr 2024 I Earth Day
Tues 23 Apr 2024 I Shakespeare Day
Mon 29 Apr 2024 I International Dance Day
Tues 30 Apr 2024 I International Jazz Day
Term 6
Wed 5 Jun 2024 I World Environment Day
Fri 21 Jun 2024 I World Day of Music / Make Music Day
Summer 2024 I Summer at The Farm I Norden Farm Event
Sun 31 Aug 2025 I Kite Festival I Norden Farm Event
