Prince George Citizen August 12, 2021 by Prince George Citizen

‘Justice for Christin’

Murder victim mourned by family, friends

More than a hundred people gathered in front of the RCMP detachment on Victoria Street on Monday to walk in honour of Christin Marion West who was murdered in her own home over the weekend

On Saturday, Aug 7, police attended West’s apartment on the 2000 block of 20th Ave after her family reported her missing.

Police then discovered the 36-yearold’s body and immediately began a homicide investigation. Shortly after,

investigators arrested Dennis Daniel Gladue in connection to the homicide.

West’s family, friends, and supporters gathered at the RCMP detachment to mourn together and walk to her apartment on 20th Avenue.

She was Indigenous and a member of the Khast’an Drummers who have performed traditional drumming at many cultural events in the city.

While holding signs reading “Justice for Christin” and “Indigenous Lives Matter” the group drummed and sang in her honour as they walked through

downtown to West’s apartment.

Prior to her murder, West posted online about being stalked because she “refused to be somebody’s girlfriend” and felt that she wasn’t believed by the police

West’s mother Beatrice also spoke to the crowd, thanking everyone for their support.

“It’s not easy for any parent to lose a child She was such an outgoing person and an outgoing girl in her life She loved to get along with everyone when she can,” she said.

TED CLARKE

TREE BRANCH KILLS MAN AT CITY PARK

A 73-year-old man was killed when he was struck by large branch that fell from a tree as he sat on a park bench at Paddlewheel Park in South Fort George. Witnesses told police that the branch broke off with a loud crack and hit the man on the head at about 5:35 p.m. on Friday. They performed CPR on him but he was unresponsive to their life-saving efforts. He was transported to hospital and later died of his injuries.

Dave Wyssen, who was the man’s friend and neighbour, said they frequently would walk together to the park. Wyssen said this was third time this summer a large branch has fallen from that particular tree, a cottonwood poplar, which is a prominent feature of the riverside park which overlooks the Fraser River

“I was quite angry because the city has been steadily working with the area for large falling branches, and especially that very tree,” said Wyssen. “That tree, just in the past month, has had two massive branches come down that have bounced off the benches that are there below it. They clean them up with a considerable amount of time and you would imagine with the work crews there cleaning up these massive messes nobody in the city would think to investigate this?”

Wyssen said the first falling-branch incident happened in June. He said he called the city about two weeks ago, right after the second branch came down, but said nothing was done about it.

Mike Kellet, the city’s senior communications officer, confirmed city staff are looking into the fatal incident but could not reveal any details

“The City of Prince George offers its condolences to the family and friends of the man who died over the weekend after an incident at Paddlewheel Park.”

HANNA PETERSEN

CITIZEN STAFF PHOTO

A march began outside of the RCMP detachment on Victoria Street on Monday and went to Chirstin West’s apartment building on 20th Avenue, where the Prince George woman was found murdered Saturday.

WHAT:

NOTICE OF PUBLIC HEARINGS AND CITY COUNCIL CONSIDERATION OF APPLICATIONS

Public Hearings regarding:

•Proposed amendments to “City of Prince George Ofﬁcial Community Plan Bylaw No. 8383, 2011”

•Proposed amendments to “City of Prince George Zoning BylawNo. 7850, 2007”

City Council consideration of applications:

•Liquor Licence Application No. LL100174

•Proposed amendments to “City of Prince George Zoning BylawNo. 7850, 2007”

WHERE:

Council ChambersofCity Hall, 2nd Floor,1100 Patricia Boulevard, Prince George, BC

WHEN: Monday, August 16, 2021

PROPOSALS:

1. “City of Prince George Zoning BylawNo. 7850, 2007, Amendment Bylaw No. 9222, 2021”

Applicant: L&M Engineering Ltd. for T.R. Projects Ltd., Inc. No. BC0729296

Subject Properties: 2599 North NechakoRoad and 4439 Craig Drive

Time: 6:00 p.m.

BylawNo. 9222, 2021 proposes to rezone the subject properties as follows:

a. That District Lot 4051, Cariboo District, Except: Firstly; Plan B3724, Secondly; Plan 22731, Thirdly; Plan BCP4770, Fourthly; Plan BCP4772, Fifthly; Plan BCP20972, be rezoned from AF: Agriculture &Forestry(43.26 hectares), AG:Greenbelt (6.43 hectares), P1: Parksand Recreation (1.02 hectares) and U1: Minor Utility (1.74 hectares) to AG:Greenbelt (5.48 hectares), P1: Parksand Recreation (2.71 hectares), RM1: Multiple Residential (2.12 hectares), RS2: Single Residential (41.04 hectares) and RT1: Two-Unit Residential (1.1 hectares); and b. That Block A(Plan B3724), District Lot 4051, Cariboo District, Except Plan 22731, be rezoned from AF: Agriculture &Forestry(1.53 hectares) and AG:Greenbelt (3.31 hectares) to AG:Greenbelt (1.45 hectares), RM1: Multiple Residential (1.68 hectares) and RS2: Single Residential (1.71 hectares);

all as shown outlined in bold black on Location Map #1 below

The purpose of this application is to facilitate afuture subdivision to create a residential neighbourhood with amix of housing forms and greenbelt areas on the subject properties, or other uses, pursuant to the proposed AG:Greenbelt, P1: Parks and Recreation, RM1: Multiple Residential, RS2: Single Residential and RT1: Two-Unit zoning designation(s).

9181, 2021

Applicant: Deadfall Brewing CompanyLtd. for Brookwood Properties Inc., Inc. No. 762283

Subject Property: 1733 Nicholson Street

Time: 7:00 p.m

BylawNo. 9181, 2021 proposes to amend “City of Prince George Zoning Bylaw No. 7850, 2007” by adding “Liquor Primary, Minor”, to only be applied to the subject property,asasecondaryuse under the M1: Light Industrial zone.

The purpose of this application is to develop amicrobrewery to manufacture liquor within an existing light industrial building located on the subject property and to facilitate alounge area for patrons to sample and purchase liquor,orother uses, pursuant to the M1: Light Industrial zoning designation(s).

2.1 Liquor Licence Application No. LL100174

The applicant has applied to the Liquor and Cannabis Regulation Branch to allow Lounge Area Endorsement for the microbrewery proposed to be operated in an existing building on the subject property

The purpose of this application is to facilitate alounge area for patrons to purchase and consume product made on-site.

The proposed hoursofliquor service will be between Mondayand Sundayfrom 9:00 a.m. and 11:00 p.m. with an occupancy of thirty (30) patrons.

Notice of City Council’sdecision will be forwarded to the Liquor and Cannabis Regulation Branch for their reviewand ﬁnal determination on this application.

The proposed Zoning Amendment Bylawand Liquor Licence Application applies to the property legally described as Lot 1, District Lot 936, Cariboo District, Plan 21687, as shown outlined in bold black on Location Map #2 below.

Location Map #2

1733 Nicholson Street

City of Prince George Zoning BylawNo. 7850, 2007, Amendment BylawNo.

NOTICE OF PUBLIC HEARINGS AND CITY COUNCIL CONSIDERATION OF APPLICATIONS

3. “City of Prince George Ofﬁcial Community Plan BylawNo. 8383, 2011, Amendment BylawNo. 9178, 2021” AND “City of Prince George Zoning BylawNo. 7850, 2007, Amendment BylawNo. 9179, 2021”

Applicant: McWalter Consulting Limited on behalf of Catla Enterprises Ltd., Inc. No. BC1034348

Subject Properties: 3751 and 3777 Barnes Drive

Time: 7:00 p.m.

The applications propose to amend the Ofﬁcial Community Plan and rezone the subject properties located at 3751 and 3777 Barnes Drive to facilitate afuture boundarylot line adjustment.

3.1. Ofﬁcial Community Plan (OCP) Amendment BylawNo. 9178, 2021

BylawNo. 9178, 2021 proposes to amend “City of Prince George Ofﬁcial Community Plan BylawNo. 8383, 2011” as follows:

a. That “Schedule B-6: Future Land Use” be amended by re-designating aportion of Lot 1, District Lot 9263, Cariboo District, Plan 16592 and Lot 2, District Lot 9263, Cariboo District, Plan 16592 from Rural Resource to Neighbourhood Residential; and

b. That “Schedule B-4: Growth Management”, be amended by re-designating aportion of Lot 1, District Lot 9263, Cariboo District, Plan 16592 and Lot 2, District Lot 9263, Cariboo District, Plan 16592 from Rural Resource to Inﬁll;

all as shown outlined in bold black on Location Map #3below

3.2 Zoning Amendment BylawNo. 9179, 2021

BylawNo. 9179, 2021 proposes to amend “City of Prince George Zoning Bylaw No. 7850, 2007” as follows:

a. That aportion of the subject property located at Lot 1, District Lot 9263, Cariboo District, Plan 16592 be rezoned from AF: Agriculture &Forestryand AG:Greenbelt to RS1: Suburban Residential and AG:Greenbelt; and

b. That aportion of the subject property located at Lot 2, District Lot 9263, Cariboo District, Plan 16592 be rezoned from AF: Agriculture &Forestryand AG:Greenbelt to RS1: Suburban Residential and AG:Greenbelt;

all as shown outlined in bold black on Location Map #3 below

Location Map #3 3751 and 3777 Barnes Drive

HOWCAN IPROVIDE COMMENT?

Residents are invited to provide comment in writing,bytelephone or in person.

Pursuant to Section 464(2) of the Local Government Act,City Council has waived the requirements for aPublic Hearing to be held respecting proposed Zoning Amendment

BylawNo. 9222, 2021 during the Regular Council Meeting held Monday, July 26, 2021.

Submissions in writing

Residents are encouraged to provide written comments to Council to be included in the Council meeting agenda package and available for public viewing on the City’swebsite.

Forsubmissions to be included on the agenda for Council’sreviewinadvance of the meeting date, theymust be received by the Corporate Ofﬁcer no later than 5:00 p.m., Tuesday, August 10, 2021.Submissions received after the noted deadline and before 3:00 p.m., Monday, August 16, 2021,will be provided to Council on the dayofthe meeting for their consideration during deliberations on the application.

Submissions maybesent by email to cityclerk@princegeorge.ca, faxed to (250)561-0183, mailed or delivered to the address noted on the third page of this notice.

Residents wishing to provide comments to Council on the following Bylaws and applications, maydoso, by submitting written correspondence:

•“City of Prince George Zoning BylawNo. 7850, 2007, Amendment BylawNo. 9181, 2021”;

•Liquor Licence Application No. LL100174;

•“City of Prince George Ofﬁcial Community Plan BylawNo. 8383, 2011, Amendment BylawNo. 9178, 2021”;

•“City of Prince George Zoning BylawNo. 7850, 2007, Amendment BylawNo. 9179, 2021”; and

•“City of Prince George Zoning BylawNo. 7850, 2007, Amendment BylawNo. 9222, 2021”.

Please note that written submissions for all applications will formpartofthe Council agenda, become public record and are posted on the City’swebsite. By making awritten submission you are consenting to the disclosure of anypersonal information that you provide.

Submissions by telephone

In an efforttoprovide the public with options to speak to Council on aPublic Hearing application(s) and in accordance with the current Ministerial Order,the City now offers participation remotely via telephone during Public Hearings.

Telephone submissions mayonly be received during Formal Public Hearings. Residents are invited to participate by telephone for the following applications:

•“City of Prince George Zoning BylawNo. 7850, 2007, Amendment BylawNo. 9181, 2021”;

•“City of Prince George Ofﬁcial Community Plan BylawNo. 8383, 2011, Amendment BylawNo. 9178, 2021; and

•“City of Prince George Zoning BylawNo. 7850, 2007, Amendment BylawNo. 9179, 2021.

Residents can pre-register to speak to the proposed Bylaw(s) live via telephone. Pre-registration will be open from 8:30 a.m., Thursday, August 12, 2021 to Monday, August 16, 2021 at 12:00 p.m. To pre-register to speak to Council via phone, visit our website www.princegeorge.ca/publichearings to complete an online registration formor call 311. If you miss pre-registering,please watch the online live meeting broadcast as there will be an opportunity for you to call in for alimited period of time.

Submissions in person

Residents who wish to speak in person can do so during the Public Hearing in Council Chambersonthe 2nd Floor of City Hall at 7:00 p.m. on Monday, August 16, 2021.

The City of Prince George follows the ordersofthe Provincial Health Ofﬁcer and guidelines regarding the size of the gatherings and physical distancing.Where Public Hearings are required to be held, measures have been put in place to ensure the safety of membersofthe public attending the Public Hearing to provide comments.

City of Prince George open Council meetings are public and maybetelevised, streamed live by webcast, recorded and archived on the City’swebsite for viewing by the public. By attending an open Council meeting or making asubmission at apublic hearing you are consenting to the disclosure of anypersonal information that you provide.

Formore detailed information on providing submissions to Council, please visit www.princegeorge.ca/publichearings.

‘Menace to society’ sentenced to prison

ARTHUR WILLIAMS

A Prince George man described as a “menace to society” was sentenced Monday to five-and-a-half years in jail.

Julien Naseem Abdala Yasin Lazarre, 23, and another man were arrested after fleeing on foot from police on Sept. 25, 2019.

The officers had been in the 1400 block area of Carney Street investigating a theft from a motor vehicle when they spotted the two known offenders, according to information released by RCMP at the time. Lazare and the other man fled into the alley and one of the officers pursuing him described thinking “he was going to get into a gunfight in that alley,” the Crown lawyer said, drawing on testimony made during the trial. Lazare had a “serious criminal history,” the prosecutor said, including violent offences involving weapons.

When Lazare was arrested, he had a rock of fentanyl/heroin mix, 33 tablets of ecstasy (also known as MDMA or molly) and $6,000 cash on him, as well as an empty pistol holster on his hip, the Crown told the court A search by a police dog located a stolen, loaded pistol a short distance away from where Lazare was arrested.

The gun had a loaded magazine and a round in the chamber ready to fire, the Crown told the court

At the time of the offence, he had already twice been prohibited from possessing firearms as a result of previous convictions.

Lazare’s father was murdered in front of him when he was 11 months old and he experienced a difficult childhood being raised by multiple members of his extended family on the Nak’azdli Whu’ten First Nation reserve near Fort St. James until he was 14 years old, Lazare’s lawyer said. Lazare had lost multiple family members to murder and suicide.

His mother, a survivor of the Indian day school system, suffered from addiction issues when he was a child, his lawyer said.

In addition, Lazare identifies as black and suffered from racism both on and off reserve.

His family was the poorest on the reservation and Lazare suffered from learning disabilities that resulted in him being held back in school and suffering further taunting and violence from his peers growing up, the lawyer said Lazare had spent 674 days in prison prior to his sentencing, and was given 1,011 days credit for time served, leaving him 997 days remaining to serve, Mengering said. He was also sentenced him to a lifetime firearms prohibition.

NOTICE OF PUBLIC HEARINGS AND CITY COUNCIL CONSIDERATION OF APPLICATIONS

Personal information is collected under the authority of section 26(g) and disclosed under the authority of section 33.1(1) of the Freedom of Information and Protection of Privacy Act (FIPPA). Forinformation or questions, contact the City’sFIPPA Coordinator at (250)561-7600 or 1100 Patricia Boulevard, Prince George, BC, V2L 3V9.

NEED MORE INFORMATION?

Acopyofthe Bylaws, Liquor Licence Application and other related documents will be available for reviewbythe public on the City’swebsite www.princegeorge.ca under ‘News and Notices’ beginning Wednesday, August 4, 2021. These documents may also be reviewedatthe Development Services ofﬁce on the 2nd Floor of City Hall on August 4, 5, 6, 9, 10, 11, 12, 13 and 16, 2021,between the hoursof 8:30 a.m. and 5:00 p.m.

WHO CAN ISPEAK TO?

Formore information, please contact Development Services in person on the 2nd Floor of City Hall, by telephone at (250)561-7611 or by email to devserv@princegeorge.ca.

Forquestions related to Public Hearing participation and procedures, please contact Legislative Services Division by telephone (250)561-7793 or by email to cityclerk@princegeorge.ca.

Chief speaks out against plastics plant

HANNA PETERSEN

Lheidli T’enneh First Nation Chief Dolleen Logan has made her stance on proposed projects in the Prince George area by Calgary-based West Coast Olefins Lts. (WCOL) clear: “We don’t want them here.”

The company has recently proposed to build a natural gas liquids (NGL) extraction plant on a 320-acre parcel of land in the Pineview area. The extraction plant would process natural gas from the Enbridge Westcoast Energy pipeline, which runs through the property, and extract propane, butane, and natural gas condensates.

A 10-inch steel high-pressure vapour

pipeline would be built to transport the extracted hydrocarbons 7.5 kilometres from the natural gas recovery system in Pineview to a storage/processing facility on the company’s 120-hectare property in the BCR site., in an area zoned for heavy industrial use. This natural gas extraction plant being proposed for Pineview would be a separate but complementary project from the $5.6 billion plastic pellet complex West Coast Olefins announced plans to build in July 2019.

The Pineview extraction plant would contain only equipment needed to extract propane, butane, and natural gas conden-

sates from the pipeline whereas the processes to separate, store and sell the product would occur in the BCR Industrial area.

Most of the finished plastic product would then be shipped to Asia using the CN Rail line to Prince Rupert.

However, the Lheidli T’enneh First Nation remains in opposition to both projects.

“I make this declaration today on behalf of our members, Chief and Council and administration. I want the federal government, the B.C. Government and our local government partners to be clear in our position about this company and these projects,” said Logan on Aug. 4.

“I want the Canadian financial and energy sectors to be very clear about our position. West Coast Olefins Is not welcome in our territory and on our unceded ancestral lands.”

CITIZEN STAFF PHOTO

Lheildi T’enneh First Nations Chief Dolleen Logan held a press conference restating the Nation’s opposition for West Coast Oleﬁns projects in Prince George.

FRASER LAKE MAN HITS JACKPOT

Jordaine Weber, a Fraser Lake resident, has scored a $1 million Maxmillions prize after purchasing a Lotto Max ticket.

Weber bought the winning ticket from the June 15 draw at a Chevron on Chowsunket Street in Fraser Lake, about 150 km west of Prince George.

“I was in pure shock,” he recalled after he checked his ticket on the self-checker.

“My mind went completely blank… I was very happy!” Weber said couldn’t wait to

tell his wife the life-changing news. “She was very happy for me,” he added.

Weber says this win means a lot for him and his family, and will give him the opportunity to invest some of the win for his children’s university education

“I would like to take my time and spend it wisely It’s going to be great for my family and kids!”

So far in 2021, B.C. lottery players have redeemed more than $105 million in winnings from Lotto Max.

Apply now: grants available forﬁsh &wildlifeprojects

The Fish &WildlifeCompensation Program fundsprojects to help conserve and enhance ﬁsh and wildlifeinwatersheds impactedbyBCHydro dams.

Ourannual grantintakeopensThursday, Aug. 12, and we’relooking for grantapplicationsfor potential projects thatalign with our Peace Region action plan priorities.

Keydates:

•Peace Regiongrant applicants mustsubmit anotice of intent by Monday, Sept.13.

•Grant applications aredue Friday, Oct. 29.

Join us online:

•Notice of intent info session: Wednesday, Sept. 1, 9a.m.–10:30 a.m. PT.

•Grantinfosession: Tuesday, Sept. 28, 1p.m.–2:30 p.m. PT.

•RSVP at fwcp@bchydro.com.

This year we approved approximately $1.3 million for26 projects in ourPeaceRegion, which arebeing deliveredby FirstNations, consultants,agencies, stewardshipgroups, and others.

UNBC

prof targets diabetes

Dr Sarah Gray, an associate professor with the UBC Northern Medical Program, is exploring a unique way to treat type 2 diabetes.

The two-year $198,743 project is funded by the Government of Canada’s New Frontiers in Research Fund, through the three federal research funding agencies (Canadian Institutes of Health Research, the Natural Sciences and Engineering Research Council, and the Social Sciences and Humanities Research Council).

Working closely with Dr Urs Häfeli, a professor in the Faculty of Pharmaceutical Sciences at the University of British

Columbia who develops novel drug delivery tools, Gray will test how magnetic nanoparticles developed by Häfeli can be used in type 2 diabetes treatment. Magnetic nanoparticles are a drug delivery tool that has been tested for other clinical interventions such as cancer treatment and medical imaging.

“Our goal is to concentrate the drugs in fat where they can act to improve metabolism, without inducing negative side-effects on the body,” explains Gray. “We hope to provide evidence that will support safe and effective therapeutics for people living with type 2 diabetes.”

NOTICE OF CONSIDERATION

What: TemporaryUsePermitNo.247

When and Where: 1:30p.m.,Thursday,August19,2021 RegionalDistrictBoardRoom 155GeorgeStreet,PrinceGeorgeBC

Owner: JamieandDaleMintz

Proposal: ThepurposeofTemporaryUse PermitNo.247istopermitCampground use(withamaximumofthreecampsites) onthesubjectpropertyforathree-year period.Thesubjectpropertyislegally describedasLot3DistrictLot7366 CaribooDistrictPlan32601andislocated at3235SawyerRoad.

Need moreinfo? Acopyoftheproposed Permitandanyrelevantbackground materialsareavailableforreviewbythe publicontheRegionalDistrict’swebsite athttp://www.rdffg.bc.ca/services/ development/land-use-planning/currentapplications/orattheRegionalDistrict office,byappointmentonly,Monday throughFriday,8:00amto4:30pm, betweenJuly26andAugust17,2021. TheRegionalDistrictofficewillbeclosed onMonday,August2,2021.Tomakean appointmentcontacttheRegionalDistrict at250-960-4400or developmentservices@rdffg.bc.ca

Who can Ispeak to? RichardBuchan, PlannerII,250-960-4400

SUBMITTED PHOTO

Dr Sarah Gray is an associate professor in the Northern Medical Program

SUBMITTED PHOTO

Jordaine Weber won $1 million after purchasing a Lotto Max ticket in Fraser Lake.

Inquest examining prisoner’s death

HANNA PETERSEN

A public inquiry into the death of a prisoner, who died on Highway 97 near 100 Mile House while being transported from Prince George to Maple Ridge, is now underway Alexander Charles Joseph, 36, died on Oct. 4, 2018, of a suspected overdose while he was being transported with eight other prisoners in a corrections van.

Lyn Blenkinsop, presiding coroner, and a jury of five are hearing evidence from witnesses to determine the facts surrounding his death. Upon conclusion of the four-day proceedings, the jury will make recommendations aimed at preventing deaths under similar circumstances

During the first day of the inquest

Monday, the jury heard testimony about Jospeh’s background from his aunt and probation officer

They then heard testimony from those who assisted at the scene: an RCMP officer, two passersby with medical training including a doctor and first aid attendant, and a paramedic from BC Ambulance. During his opening statement, Inquest Counsel John Orr summarized the circumstances during transport.

Orr states the prisoners tried to get the attention of the corrections officers for a while but the journey keeps going until they get are eventually able to get the attention of the officers.

The corrections officers then see a police cruiser who has a vehicle pulled over on the side of the highway and stop to ask the RCMP officer for assistance. The corrections officers then removed Joseph from the van and begin performing CPR.

The police officer, Cpl. Rick Meaver, also assists with CPR along with the two passersbys, general practitioner Dr. Stefan De Swardt and Michael Raftery, who has a high level of first aid training.

“Alex was a mischievous child, full of life, daredevil, funny and always on the go.

A very beautiful boy,” said his aunt Ann Joseph, who was the first to testify

“Alex, being a child of a survivor of Lejac Residential School, had grown up fast and had to leave behind his carefree childhood days and his little boy life. His mom tried her best but the demons of physical, mental and sexual abuse by the nuns and priests was too much for the young mom and she lost her way.”

NOTICE OF WAIVER OF PUBLIC HEARING

NoticeisherebygiventhattheRegional DistrictBoardhaswaivedtheholdingofa publichearingintoZoningBylawNo.2892, AmendmentBylawNo.3230,2021.The RegionalDistrictBoardwillconsiderthird readingofBylawNo.3230atitsregular meetingscheduledfor1:30p.m.,Thursday, August19,2021intheRegionalDistrictBoard roomlocatedat155GeorgeStreet,Prince George,BC.

ThepurposeofBylawNo.3230istorezone ParcelA(beingaconsolidationoflots3and 4,seeCA8840079)DistrictLot4227Cariboo DistrictPlan19890fromSeasonalRecreation 1(SR1)andResidential3(R3)toResidential 3(R3).Theamendmentisproposedtopermit aResidential-SingleFamilyuseandother permittedusespursuanttotheR3zone.The subjectpropertyislocatedat23485West LakeRoad

AcopyoftheproposedBylawandany relevantbackgroundmaterialsareavailable forreviewbythepublicontheRegional District’swebsiteat http://www.rdffg.bc.ca/ services/development/land-use-planning/ current-applications/ (ElectoralArea‘C’)or attheRegionalDistrictoﬃce,byappointment only,MondaythroughFriday,8:00amto 4:30pm,betweenJuly26,2021andAugust 19,2021.TheRegionalDistrictOﬃcewill beclosedonAugust2,2021.Tomakean appointmentcontacttheRegionalDistrict at developmentservices@rdffg.bc.ca orat 250-960-4400orat

Social agencies bring health fair to homeless

MARK NIELSEN

Local Journalism Initiative Reporter

The entrance to the homeless camp at the east end of Fifth Avenue took on a festive mood last Wednesday as local social agencies and branches of Northern Health teamed up to host a health fair.

With the help of a passport, patrons went from station to station, each beneath a series of tent canopies decorated with purple balloons where they could connect with community supports, get information about staying healthy while out on the street.

Patrons could even “personalize” with paint the naloxone kits many keep handy in case a friend overdoses on fentanyl.

The strategically-placed array was the brainchild of Jennifer Hoy, who coordinates the high-acuity support program at the Central Interior Native Health Society. More accurately, one of her clients came up with the germ of the idea and Hoy took it to the next level.

“We do harm reduction outreach with a peer and one of the residents of the other tent city had mentioned people don’t carry Narcan (a brand name for naloxone) and there’s been such an increase in overdoses,” Hoy said. “It really bothered us because we work really hard to try and keep people alive and healthy and well connected.

“And so she had some ideas about how she ‘would like to have a Narcan kit painting day and (said) ‘I don’t how I would do it.’ I said ‘well, we could probably organize something like that,’ and then when we started talking about it, we were like ‘well, there are a lot of other agencies that really love our street community and our downtown population and they’d love to get involved.”

Among the patrons were Trevor Charles and Moe Whitehead, a couple who have been living in the empty lot on George Street across from the courthouse

Like many, Charles said more housing and easier access to treatment would go a long way to reducing the city’s homeless population.

Even for those who are ready to go into detox and treatment, “it takes you just

Trevor Charles fills out an application for supported housing.

about a week to get in there,” chimed in Whitehead as she draped an arm around Charles.

On the plus side, they expressed strong support for the POUNDS Project, the street-level outreach program.

Charles, 51, said he used to “drink and fight” and got hooked on opioids after an adversary smashed in a side of his face with a golf club.

“They had to put a plate in my face... and pain control, for me, that’s what I was after,” he said.

“I needed something for pain, they wouldn’t give it to me so I turned to the street and that’s how I got started.”

Whitehead, 43, said she became addicted to cocaine while living in Dawson Creek.

“It was curiosity I was 19 and I didn’t even know what cocaine was, but that feeling it gave me, and I’ve been addicted ever since,” she said before walking away briefly to deal with another matter, then returning to give Charles a big smooch as he continued to talk.

Both ended up on the streets of Prince George hooked on opioids in the time before fentanyl seeped into the supply They’re now on a safe supply of methadone and have been doing some peer support work while relying on disability for income.

CITIZEN STAFF PHOTO

Country show set for September

Two of the biggest male stars in Canadian country music will headline the two-day Best Damn Music Festival at Exhibition Park in Prince George on Sept. 11 and 12

Brett Kissel will play Friday night and Dean Brody will take the stage Saturday night. Supporting acts include The Reklaws, The Washboard Union, High Valley and Tyler Joe Miller The festival is a 19-years plus event.

Tickets are now on sale at Tickets North. From now until Aug. 22, a single day pass is $99.99, a two-day pass is $174.99 and a VIP pass is $399.99, which includes early access, VIP tent with food and drink, covered lounge with seating and premium stage view access. After Aug. 22, single-day passes will cost $109.99, two-day passes will go for $199.99 and VIP passes will cost $449.99. Service changes apply on all tickets.

EQUIPMENT FORSALE

ARTICULATING TRUCKS

AT1507 2013 VolvoA40F 6x6

AT1508 2013 VolvoA40F 6x6

ArticulatedDump Truck

AT1509 2012 VolvoA40F ArticulatedDump Truck

AT1510 2012 VolvoA40F ArticulatedDump Truck

AT1511 2012 VolvoA40F ArticulatedDump Truck

AT1512 2013 VolvoA40F 6x6

ArticulatedDump Truck

AT1513 2013 VolvoA40F 6x6 ArticulatedDump Truck

AT1514 2012 VolvoA40F Haul/Rock Truck

AT1515 2013 VolvoA40F Haul/Rock Truck AT1516 2014 VolvoA40F Rock Truck

DOZERS

DZ1509 1994 Caterpillar D8N Crawler Tractor

DZ1510 2006 Caterpillar D9T Crawler Tractor

DZ1511 2007 Caterpillar D10T Crawler Tractor

DZ1512 2012 John Deere650J LGPCrawler Tractor

DZ1513 2011 Caterpillar D6T XW Crawler Tractor

EXCAVATORS

EX1508 1996 Hitachi EX700 Excavator

EX1511 2006 John Deere850D LC Excavator

EX1515 2008 VolvoEC700BCL Excavator

EX1516 2014 John Deere470 GExcavator

EX1517 2013 CAT324EL Hydraulic Excavator

EX1518 2012 VolvoEC480DL Hydraulic Excavator

EX1519 470G Lifting Devicefor Unit EX1516

EX1520 2014 John Deere470G LC VG Hydraulic Excavator

EX1522 2012 John Deere470 GLCVGHydarulic Excavator

GENERATORS/GRADERS/LOADERS/BOBCATS

GR1503 2009 CATGRADER 160M AWDVHP PLUS

GR1503 CAT160M SnowWing included in Value

LD1504 1997 Caterpillar 988F Wheel Loader

LD1506 2012 John Deere644K Wheel Loader -w.Forks

LD1507 2014 844K John DeereWheel Loader

LD1508 2013 Hyundai HL780-9AWheel Loader

SK1600 2009 John DeereCT322 Skidsteer w. 78” Bucket

SK1601 84” Rotary Angle Broom forSkidsteer SK1600

SK1602 Fork forSkidsteer

COMPACTORS

PA1509 2009 Hamm 3412 Vibratory Roller

PA1513 2009 Hamm 3307 Roller Packer

VEHICLES International WaterTruck 3800 Gallons

Art collaboration on display at gallery

Area residents are invited to a “garden party of the imagination” on display at Two Rivers Gallery until Oct. 3.

The gallery is hosting The Covidian Garden Party, a multi-media exhibit by Prince George artist Cat Sivertsen and 24 collaborating artists from Canada, England, France, Germany and Singapore.

While recovering from life-saving surgery during the height of the COVID-19 pandemic, Sivertsen envisioned a party thrown in her honour So she invited 24 “guests” to each collaborate a page to a book, envisioning the garden party that couldn’t be

“Over the pandemic we have all experienced the kind of isolation that Sivertsen’s Covidian Garden Party was made to counteract,” Two Rivers Gallery curator and artistic director George Harris said.

The book is on display at the gallery, along with a video about each of the submissions In addition, the show includes other works by Sivertsen. Airing It is a photo exhibit documenting an installation of linens that honoured Sivertsen’s grandmother, who immigrated to Canada from Northern Ireland. The Invisibility Paradox is a study based on an installation of cutglass beads, in which the artist ponders the question of aging. And Firescapes

The Covidian Garden Party is a collaboration of 24 artists from ﬁve countries. The book, along with other work by local artist Cat Sivertsen, is on display at Two Rivers Gallery

records the aftermath of a wildfire using mixed-media drawing on birch panels. A travelling version of the exhibit will be on display at the Mackenzie Community Arts Centre from Aug. 6 to Aug. 29, the Valemount and Area Museum from Sept. 3 to Sept. 26 and the Valley Museum and Archives in McBride from Oct. 1 to Oct. 31

SUBMITTED PHOTO

CITIZEN FILE PHOTO

Dean Brody plays at CN Centre in Prince George in this 2015 ﬁle photo.

YOUNG PROMOTED TO AAA

TED CLARKE

Jared Young is on his way to triple-A

The 26-year-old Prince George-born-andbred Young got the call-up to the Chicago Cubs’ top farm team on Monday after turning in another productive weekend for the double-A Tennessee Smokies.

Young went 3-for-4 Sunday in a 2-0 road loss to the Montgomery Biscuits, coming off a 5-2 win over the Biscuits on Saturday. In that game, Young’s two-run single in the eighth inning gave the Smokies a 4-1 lead. He finished with two hits in four plate appearances. On Friday, the Smokies hammered the Biscuits 10-0 and Young clubbed his fourth home run of the season, a two-run shot in the second inning. He also delivered a single in the fifth inning to finish 2-for-4 at the plate.

Young has been one of the top hitters lately in the eight-team Double-A South League He’s hitting .326 with 22 runs batted in and three stolen bases. His on-base percentage is .396 and he has a .915 OBS (on base percentage plus slugging percentage). He has 42 hits in 129 at-bats, with 11 doubles and one triple.

He said he knew his performance at the double-A level was not going unnoticed by the parent Chicago Cubs, so Monday’s news was not unexpected.

“I was playing well, so you always want good things to happen,” said Young, while waiting for his plane at the Knoxville airport.

“It’s great, it’s exciting It doesn’t change anything I’ve been doing and it doesn’t change how I’ve been going about playing. It’s just a new team at a different level and I’m excited.”

Drafted by the Cubs in the 15th round of the Major League Baseball draft in 2017, he’s been in the organization ever since and he’ll be greeted by familiar faces in the Iowa locker room.

“I know a lot of them, I’ve been with the Cubs for four or five years now, so anywhere they send me I’ll know a few people, that’s for sure,” he said. “You’re one call away now (from the majors) and that’s where you want to be. You want to be with the best and you want to be competing to be in the big leagues.”

Young occasionally draws assignments in the outfield but has played most of his 35 games this season at first base.

On June 30, he returned from a shoulder injury that forced him out of the lineup for nearly two months and has been one of the Smokies’ most consistent players since then.

He joined his Iowa teammates in Nebraska where they started a six-game series Tuesday against the Omaha Storm Chasers

Having grown up representing his home city playing for the Prince George Knights, he becomes the first P.G. player ever to earn a call-up to a triple-A baseball team. tclarke@pgcitizen.ca

Diane Van Bakel, right, returns the ball while doubles partner Deb Schwader defends the other side of the court on Sunday during their women’s doubles quarterﬁnal match against Cindy Motschilnig and Suyi Sibbald, both of Terrace. The Prince George Open was held at the Prince George Tennis and Pickleball Club. Motschilnig/Sibbald won the match 10-11, 11-9, 11-7.

Soccer star wins tennis tourney

TED CLARKE

Jon LaFontaine hadn’t played a tennis tournament in eight years. Turns out that long layoff didn’t do him any harm

The 44-year-old city utilities supervisor was in championship form all weekend at the Prince George Tennis and Pickleball Club and saved his best for last in Sunday’s tennis singles final, earning a three-set victory over Thomas Tannert to win the Prince George Open title.

Better known for his athletic prowess on the local soccer field, LaFontaine overcame a 6-4 loss in the opening set to take the next two, 6-2 and 6-3, to win the match and claim the Matt Altizer Memorial Cup.

The match was punctuated by long rallies, slicing backhand winners from both sides and only rare serving faults and Lafontaine made fewer unforced errors to turn it in his favour. He strained a calf muscle in his opening match against Matt McMath and came out for the final wearing a compression bandage on his left leg.

That seemed to do the trick because he wasn’t hobbled by his injury and Tannert had difficulty gaining momentum to ty to put away his opponent in the second set Tannert, 47, a wood construction engineering professor at UNBC, plays a similar style as Lafontaine, not overpowering with his shots but very consistent at finding the court with his returns, and that paid off in the initial stages of their match.

Cory Fleck and Michael Latella teamed up in the doubles final to defeat Shawn Hegan and Fara Kashanchi, 3-6, 6-3-6-4 Pickleball tournament results were as follows: Mixed doubles - Jeany de Witt/ Riaan de Witt (both of Terrace) defeated Denise Wellband (Quesnel/Dave Stewart (Prince George), 11-6, 6-11, 11-10; Men’s doubles - Jordan Booth/Callum Catto (both of Quesnel) beat Stacy Sneader/Joe Morgan (both of Kitimat), 11-3, 11-8; Women’s doubles champions - Jen Hidber (Terrace)/ Jeany de Witt topped Carmella Aquino/ Sherry Jasper (both of Quesnel), 11-6, 11-3.

CITIZEN STAFF PHOTO

Lessons from golf’s

loveable loser

Each week this summer, Citizen editor Neil Godbout will share his experience learning to golf at the Prince George Golf and Curling Club.

Want to get in a free round with Neil? Just drop him a line at ngodbout@pgcitizen.ca

Week 11

Every golfer, from novice to pro, from kids in their first season in junior golf to seniors who have 50 years and more than a thousand rounds under their belt, has stories to tell. Yet there is one golf story that eclipses all golf stories and it’s not about winning, it’s about losing Jean Van De Velde of France had a threestroke lead with just one hole to play at the 1999 British Open. Ranked 152nd in the world heading into the Open, he led for most of the tournament. On the par-4 18, all he had to do was shoot a 6, a twoover-par double-bogey to have his name engraved on the Claret Jug, the only trophy in sports that holds a candle to the Stanley Cup. To put that score in perspective, there are hundreds of golfers, male and female, teens to seniors, in Prince George who could shoot a 6 on that hole Dozens of local golfers could shoot a five and a handful could reliably par that hole.

Of course, they wouldn’t be shooting their 72nd hole in four days at the most famous golf tournament in the world with a global audience of millions and the aspirations of an entire country on their back. Van De Velde would have been the first Frenchman to win the Open in 92 years For Van De Velde, everything that could have gone wrong went wrong. His tee shot ended up on the fairway of a neighbouring hole (a lucky break that he could have recovered from) but then his following shots ended up in the long grass, then water and

then the bunker. He sunk a 10-foot putt just to make it into a playoff but mentally he was destroyed and he finished second. Ironically, Van De Velde is remembered far more than the man who actually won (Paul Lawrie)

From a golf perspective, there is plenty to take away from Van De Velde’s disastrous final hole, even for a novice like me. Making smart choices is critical. The par-5 16 at the Prince George Golf and Curling Club has a small but significant strip of water separating the fairway from the green. If you find yourself less than 200 yards from the hole, you have a choice to make much like Van De Velde had. Do you go for it and shoot for the green or play it safe, chip it up to the water and then chip it over onto the green in two shots?

On a recent round, I found myself about 75 yards from the hole, close enough to safely make it over the water and onto the large green but far enough to worry me. The water was there and I could hear it shouting “feed me, Seymour!,” like the greedy, flesh-eating plant from the Little Shop of Horrors. So I fed it (and like the hapless Seymour, I have kept feeding it for much of the summer).

The most important golf and life lesson is it’s just a game and to just keep playing. Van De Velde lost the British Open in spectacular fashion and life went on for him, too, in a meaningful and inspirational way (check out the episode on him in Losers, a new Netflix documentary series).

The same thing always happens in golf. After being struck by the club, the ball belongs to gravity, inertia and fate, forces far more powerful than skill or desire.

That’s the core of the game.

The stories are just the details.

COUGARS ADD ASSOCIATE COACH

Josh Dixon will take over from Jason Smith as associate coach when the local WHL team kicks off its season next month.

After two seasons with the Cougars, Smith accepted a position with the Lehigh Valley Phantoms, the American Hockey League (AHL) affiliate of the Philadelphia Flyers. Smith was captain of the Flyers during the 2007-08 NHL season.

Dixon brings a wealth of experience with him to the Cougars, as he has coached over 20 years at various levels. Most recently, the Oakville, Ontario product spent parts of three seasons (2017-19) as the Head Coach of the Saint John Sea Dogs in the Quebec Major Junior Hockey League (QMJHL). During his time with the Sea Dogs, he served as an Assistant Coach for the QMJHL All-Stars in the 2019 Canada-Russia Series. Previously to his time behind the bench in Saint John, Dixon spent four seasons in the Western Hockey

League as an Associate Coach and Assistant Coach. Dixon was an Assistant Coach for three seasons (2011-2014) with the Regina Pats and was an Associate Coach on Cougars Head Coach and GM Mark Lamb’s staff with the Swift Current Broncos during the 2014-15 season.

Dixon has also worked in Hockey Canada’s Program of Excellence, as he’s twice served as an Assistant Coach at the World Under-17 Hockey Challenge and was the Head Coach for Team Saskatchewan at the 2015 Canada Winter Games. Dixon has also served as an Assistant Coach for men’s and women’s hockey programs at Carleton University, University of Calgary, and Mount Royal University

He holds a Master’s degree in Sports Psychology from the University of Calgary and a Master’s degree in High Performance Coaching from the National Coaching Institute.

NOTICEOF PUBLIC HEARING

What: PublicHearingregardingZoningBylawNo.2892,AmendmentBylawNo.3168,2020

When and Where: 6:00pm,Wednesday,August25,2021 Viatelephoneconferencecallandinpersonattendance

ThepublichearingwillbechairedbyadelegateoftheRegionalDistrictBoard.

Owner: AmyTaylorandLaneVaughn

Proposal: BylawNo.3168isproposedtorezoneaportionofthesubjectpropertyfromRural 2(Ru2)toControlledRecreationCommercial1(CRC1)topermitallusespursuanttotheCRC1 zone.BylawNo.3168alsoproposesatextamendmenttoreplacethetermCommunityHall withAssemblyHallandtopermitAssemblyHalluseonaportionofthesubjectpropertyona sitespeciﬁcbasis.BylawNo.3168alsoproposestopermittwoRecreationCabinusesinthe Ru2zoneonasitespeciﬁcbasis.ThesubjectpropertyisBlockAExcept:Firstly:PlanH789; Secondly:PartSubdividedbyPlanBCP28206;DistrictLot8501CaribooDistrictandislocated at39385&39355Highway16W.

Anyonewhobelievesthattheirinterestinlandisaﬀectedbytheproposedbylawshallbe aﬀordedareasonableopportunitytobeheardatthepublichearingortopresentwritten commentspriortooratthepublichearingregardingmatterscontainedinthebylaws.

Ifplanningtoattendinperson,pleaseconsiderthatinpersonattendanceatpublichearings mustmeetprovincialhealthorders.Masksarerecommendedinindoorpublicsettingsfor allpeople12andolderwhoarenotyetfullyvaccinated.Thepublichearingwillalsobeheld remotelyviatelephoneconferencecall.

Attend in person: Membersofthepublicinterestedinparticipatingviainpersonattendance canattendthepublichearingat:

Uda Dune Baiyoh ‘House of Ancestors’ Conference Centre 355 Vancouver St, Prince George BC

Submit written comments: WrittencommentswillbeacceptedbytheRegionalDistrictin advanceofthepublichearinguntil9:00amonAugust25,2021by:

Email: developmentservices@rdﬀg.bc.ca

Hand/Mail: 155GeorgeStreet,PrinceGeorge,BCV2L1P8

Fax: 250-562-8676

Writtencommentsreceivedby9:00amonAugust25,2021(dayofpublichearing)willbeposted totheRegionalDistrict’swebpage.

After9:00amonAugust25,2021,anduntilthecloseofthepublichearing,writtensubmissions canbesubmittedtotheRegionalDistrictby email: developmentservices@rdﬀg.bc.ca

Writtencommentsreceivedafter9:00amonAugust25,2021,anduntilthecloseofthepublic hearing,willbeacceptedintothepublichearing.

Attend through telephone conference call: ContacttheRegionalDistrictat250-960-4400or developmentservices@rdﬀg.bc.caforthetelephoneconferencenumberandinstructions

Anymaterialreceivedbeforeoratthepublichearingwillbecomepublicinformation.

Need moreinfo? Additionalinstructionsfortheteleconferencepublichearing,acopyofthe proposedBylaw,andanyrelevantbackgroundmaterialsareavailableforreviewbythepublic ontheRegionalDistrict’swebsiteat http://www.rdffg.bc.ca/services/development/land-useplanning/current-applications/ orattheRegionalDistrictoffice,byappointmentonly,Monday throughFriday,8:00a.m.to4:30p.m.,betweenAugust9and25,2021.Tomakeanappointment contacttheRegionalDistrictat250-960-4400ordevelopmentservices@rdffg.bc.ca

Who can Ispeak to? HeatherMeierRPP,MCIP,PlanningLeader,250-960-4400

BEFORE YOU ROLL INTO THE CAMPSITE...

PIERRE PELLETIER

Since January 2018, Pierre along with his wife Kerry and their 12-year-old Labrador Kodi have been living and travelling throughout North America in their 32-foot fifth wheel – mostly living off the grid using solar power.

In this column, we’ll talk about camping at a campsite, one that offers both partial hook up (usually water and electricity) and full hook up (water, electricity, and sewage).

So, when you call a campground to book your first site, ask for the full hook upmuch easier for your first foray If you’re booking over the phone, ask for an email confirmation of the date, full hook up, and price. You’d be surprised how often we’d check in at a campground only to find the price has changed or they didn’t have our “verbal” booking. If they refuse to send you the email confirmation - big red flag - book somewhere else.

If you’re comfortable backing up, you can save a few dollars and book a back in site. (If you’re not comfortable backing up your RV, go to an empty parking lot and practice, practice, practice.) Otherwise, get a pull thru - you drive in when you arrive and drive straight out of your campsite when you leave. Unfortunately, most

campgrounds have limited pull thrus so the sooner you learn to back up, the better. You’ll also learn quickly that not all campgrounds are the same - or logical. For instance the services offered. The

NOTICE OF CONSIDERATION

What: TemporaryUsePermitNo.235

When and Where: 1:30p.m.,Thursday,August19,2021 RegionalDistrictBoardRoom 155GeorgeStreet,PrinceGeorgeBC

Owner: JudySindia

Proposal: ThepurposeofTemporaryUse PermitNo.235istopermitEquipment RepairandServicinguseandLogging/ TruckingContractoruseonpartofthe subjectpropertyforathree-yearperiod. ThesubjectpropertyisThatPartofthe SouthEast¼ofDistrictLot3819Cariboo DistrictasShownonPlanB7466andis locatedat24935HartHighway

Need moreinfo? Acopyoftheproposed Permitandanyrelevantbackground materialsareavailableforreviewbythe publicontheRegionalDistrict’swebsite athttp://www.rdffg.bc.ca/services/ development/land-use-planning/currentapplications/orattheRegionalDistrict office,byappointmentonly,Monday throughFriday,8:00amto4:30pm, betweenJuly28andAugust19,2021. Tomakeanappointmentcontactthe RegionalDistrictat250-960-4400or developmentservices@rdffg.bc.ca

Who can Ispeak to? HeatherMeier, PlanningLeader,250-960-4400

vast majority of RVs have the services (electric, water, and sewage) at the rear of the RV on the driver’s side. So you would think all your campsite services would logically be at the back of your campsite on the driver’s side.

Au contraire, mon ami

In Yorktown, Sask., the water spigot was located at the front of the campsite, so far away that our 25ft long water hose wasn’t long enough to reach. (We ended up having to buy a 50 footer. We also have an eight footer - very handy when the campsite spigot is close to your RVs water intake hole.)

In New Brunswick, just outside of Sussex, all the hook ups at our campsite were on the passenger side. We had to swing all the lines (water, sewage, and electrical) underneath our fifth wheel just to reach the services. (That’s where we had to buy an extension to our sewage hose in order for it to reach the sewage hole.)

Let’s look at a few items that are very inexpensive but extremely important to a

smooth RVing experience.

First thing I’d suggest buying is a water filter that attaches to your water hoseindividually, they cost about $35 and last three months. Don’t assume the water at the campsite is safe drinkable water

Also get a water pressure regulator that controls the flow of water that comes out of the tap and into your RV lines. We’ve heard horror stories of campgrounds that have too much pressure in their water lines and that water pressure damaging the RV’s water lines This little device is attached to the tap and is reasonably priced at about $20.

Helpful tip: buy what’s called a water bandit. Sometimes the thread on the campsite’s spigot/tap is worn out (stripped) and you can’t attach your hose. The water bandit tightly wraps around any tap like a sock allowing you to connect any tap to your water hose. Costs around $10.

Another item that we’ve found invaluable – and my favourite – is a voltage tester Never make the assumption that you always have 120 volts ripping through your wall outlets When everyone at the campground has their air conditioner running, you’d be shocked to know that often you might only have 106 or less. Older campgrounds that haven’t upgraded their electrical systems are also dangerous. We always look at our voltage meter before we turn on any appliance that takes a fair amount of power such as the microwave or air conditioner

A simple $30 voltage meter that plugs into your RV’s wall outlet can you save you thousands on repairs.

Finally, for your sewage needs, buy a see-through end nozzle that attaches to your sewage hose and that you stick in the sewage hole. Much easier to gauge if your black and grey tanks are empty if you can see the water going down the hole then having to guess because your end nozzle is not see-through.

Now that you’ve added a few common sense items, it’s time to hit the road.

In next week’s column, we’ll talk about selecting the right site for you and campsite set up.

ppelletier@pgcitizen.ca

CITIZEN STAFF PHOTOS

A voltage test, left, and a water pressure regulator, right, are essential tools when going to full hook up campsites.

What are libraries for?

My regular readers will know that I do not often speak up in favour of public institutions. My reason is that too often public institutions forget they are in the service business; their duty is to serve their clients, not their faceless government benefactor, and to serve the folks who need their services, not the ones who directly pay their bills.

Libraries have, by and large, managed to avoid losing sight of their role in a democratic society They have kept their strong stance against censorship to remain in service of the broad and diverse people they serve with books and information for every legal taste and style.

It has also helped them withstand the extremists on both ends of the political spectrum that regularly try to get books banned. Libraries have remained one safe place for the discussion, or at least

So

many

THINKING ALOUD

TRUDY KLASSEN

reading, of a broad range of ideas in our polarized society. Not only do they support diverse ideas, they also support the mental health of a broad range of people. Whether you are young, old, in the middle, rich, poor or struggling, religious or agnostic or in between, educated or not, homeschooling or sending your children to public schools, our Prince George libraries, both the Bob Harkins Branch and the Nechako Branch, have managed to support our community through innovative programs designed to be helpful.

It was Ruth at the Bob Harkins branch that helped me navigate my fears of books I didn’t want my children to read. Her

gentle and educational answers helped me grow up as a young mom. Our libraries provided my children not only with piles of books to take home, (we loved the compiled educational boxes that addressed one subject, like Music or Horses) but also a refuge from bad weather beyond our four walls. Our library’s service to our community’s mental health is significant. Therefore, it was a surprise to open my Twitter feed this week and see this beloved institution the target of a small TOM (Twitter Outrage Mob.) How had the library managed to get into hot water with this small group of folks? The offending policy appeared to be the rational decision to keep the library safe for their staff (and patrons, I would say) by locking their bathrooms and checking them in between each use. This seems like a very reasonable thing to me, in light of the ongoing illicit drug use/overdose, mental health problems people are dealing with especially downtown.

reasons to get the shot

I was asked recently why I keep advocating for people to get vaccinated against the COVID-19 virus. After all, “the vaccine hasn’t been approved,” the questioner pointed out.

An interesting choice of semantics that. It has been “authorized” under the legislation allowing Health Canada to approve medicine for emergency purposes. So for all intents and purposes, the vaccines we have are approved for use against the virus.

There are doctors who question the ethics of using an unproven vaccine. True. There are also doctors who advocate for the use of acupuncture. And doctors who smoke cigarettes. And doctors who likely believe in Santa Claus (or should!)

The category “medical doctor” is a big class of individuals who have a wide variety of opinions on a wide variety of subjects. Given the size of the pool of individuals, it would be surprising to not find some who disagree with the present health strategy After all, you can find pretty much any opinion about anything if you look hard enough.

But the question shouldn’t be whether or not doctors agree or disagree on the use of the vaccines. It should be what does the data indicate about the efficacy of the vaccines. Personal opinions aside, the

AS I SEE IT TODD WHITCOMBE

numbers tell the tale.

Countries, such as Canada, where vaccination is reasonably widespread have seen a steady decline in case numbers. Has the number gone to zero? No Nor is it likely to ever get to zero cases.

This is due to there always being some people who either can’t be vaccinated for medical reasons, object to vaccinations on religious grounds, or simple refuse to be vaccinated because of personal concerns about the drugs

All of those objections are fair enough but these individuals are then banking on the rest of the population to protect them by achieving a sufficiently high enough vaccination rate to dampen the disease down to manageable levels. They would like everyone else to do the work for them.

Personally, I don’t mind. I will take a shot in the arm which was, at best, a minor inconvenience if it ensures that I and the people I interact with are relatively safe from the virus. Judging by the fact that Canada is one of the most vaccinated and

As a young mom, I didn’t think twice to send my children to the bathroom at the library. It never occurred to me that they may happen upon someone smoking crack or finding discarded needles on the floor This has become a problem and the library needs to be congratulated for staying focused on its mission: “The Prince George Public Library connects people and ideas inspiring the community to read, learn and discover.” It is not reasonable for anyone to think that “discover” means to discover illicit drug use happening on the premises. The library is not, and should not, become a “safe injection site” as some of the Twitter mob was suggesting.

Libraries are more important than ever with the ever-increasing polarization of our society They are one protection against the extremists, and they have to be safe places for people who come to use their service, within their mission statement. Let’s leave libraries out of our cultural, social, and political battles

fully vaccinated countries in the world, I would say most Canadians feel it is their responsibility to ensure they and their fellow Canadians are safe.

But there are other reasons why I have continued to write about the need for full vaccination. The first is the numbers themselves. We know coronaviruses can be very contagious and deadly. Ironically, if the disease was any more deadly, it wouldn’t have become a pandemic as it would have effectively burnt itself out.

However, 18 months into this pandemic and it would appear the disease kills about two per cent of the population it infects. In Canada, as of last weekend, that translates to 26,669 people dead and 1,401,714 recovered.

If the disease was to run rampant through the entire Canadian population with no controls or vaccines – that is, if everyone in Canada became infected with COVID-19 – then we would see a death toll just over 700,000. That would be like wiping out the entire population of New Brunswick with the exception of Saint John.

That is not something I can countenance. Getting vaccinated saves lives and, with any luck, it will keep the death toll where it is at.

Of course, I am not naïve enough to think everyone will get vaccinated so the threat

of another wave of the disease will keep impacting our daily lives. Particularly as the virus mutates over time This is a natural feature of all viral vectors. They evolve through a series of mutations which, to some extent, are a consequence of suppression of the disease. The hardy strains are the ones which become dominant and so we have the “delta” strain gaining ground.

But the other reason I keep writing about the need for vaccination came as a question from a student. One of his friends had said they were not going to get vaccinated because the whole thing is a hoax. My student wanted to know if I thought COVID-19 was a hoax.

No. It is not a hoax It is a very real disease killing people. 4,305,967 people worldwide have lost their lives to the virus. Actually, like every other pandemic in history, that number is probably the lower limit as people have died from the disease without the death being attributed to COVID-19. The usual retort to such a statement is “Well, I don’t know anyone who has died from COVID-19” but to that I would answer “just wait.”

Without widespread vaccination, I am sure we will all know someone who has died. So please get vaccinated – if not for yourself, for those you hold dear

Being respectful better than being right

There is a 2018 episode of The Channel 4 News from the United Kingdom that has become rather infamous. Canadian psychologist and professor Jordan Peterson is interviewed by Cathy Newman about his book 12 Rules of Life, feminism and gender identity.

Peterson has become very popular among those to the extreme right of the political spectrum. He has also been demonized by many on the far left.

Some would characterize the 2018 interview as one where Peterson proved to the left that they were wrong and he was right, but I find that view rather narrow Newman had done her homework before the interview She was aware of the criticisms of Peterson and she zeroed in on those arguments. It was clear that she made Peterson uncomfortable and at one point he even stated that fact.

Newman demonstrated her greatest skill as a journalist, however, when she allowed Peterson to respond to her queries. She

LESSONS IN LEARNING

GERRY CHIDIAC

gave him time to think and to articulate himself and she responded by further challenging his views

At one point, Peterson made his point so clear that Newman did not have a counterargument While she did appear a bit embarrassed by this turn in the discourse, she graciously moved on to a new topic. What is particularly interesting, however, is the public response after the interview While Peterson was being celebrated, Newman received death threats and insults. This is unfortunate because both Peterson and Newman did an excellent job in promoting civil, public discourse. Some have argued that Newman was not actually listening to Peterson, but kept repeating the same questions, distorting what he had

actually said for the sake of promoting her own agenda.

While I cannot speak to the interviewer’s intention, I sincerely appreciate her willingness to engage in a public debate with a very intelligent and well-spoken individual and even to risk looking foolish

In our polarized world, many of us have become very defensive of our views. This is evidenced in social media, on television and even in our educational institutions. We seem to think that acknowledging the legitimacy of someone else’s argument makes us weak or stupid.

The most confident and competent people among us, however, are also the best listeners They know that their ideas do not define who they are as human beings, that their opinions can change but their intrinsic value does not.

It is magical when we engage in intelligent and respectful debate with others Our views are challenged, so we must articulate our perspectives more clearly Ideally, the other party is doing the same We may have to take a break and gather

evidence to strengthen our arguments, but isn’t that all part of the excitement?

I recently discussed my attitudes toward this sort of discussion with my 88-year-old father. As I was growing up, we shared many differing perspectives. I was a young socialist and he was an executive with a multinational corporation.

Behind our often loud and heated disagreements there was always a love and respect, an appreciation of the other person and where their views were coming from. I trusted my father enough to doubt my own views and this honest humility has served me well.

My family still engages in boisterous debates and I am forever grateful for this loving discourse.

The world is full of problems and questions and no one has all the right answers, not even Jordan Peterson. I think that even he would agree, however, that the greatest legacy we can leave for the world is not being right but showing respect for our neighbour and thus bringing humanity a little closer to wisdom.

THEATRE EAGER TO WELCOME BACK AUDIENCE

MARNIE HAMAGAMI

It is important to note that I am not a writer I am not an artist, and those of you who have been to the theatre and seen me on stage know that I am not greatly interested in being a performer – even for the three minutes it takes me to stand up there and remind you to turn your phones off and thank the sponsors. I have started this piece no less than three times and each time considered emailing Solomon and telling him he was back on to write the article this week. Honestly, I am more comfortable in Excel than Word Each time I think of asking somebody else to write this article, I hesitate. I do have something to say. I want to tell you about all the work we have done in the past 17 months at the theatre. I want to tell you that we have spent time asking ourselves why we do what we do and who we are trying to serve. I want to tell you about all the exciting new programs we are building aimed at growing our presence in this community I want to tell you about the

exciting couple of seasons we have been planning and about the raft of local artists we are welcoming to our stage, many for the first time ever I want to tell you how hard we have worked and are continuing to work to re-invent ourselves while still

LETTER TO THE EDITOR

Vaccine passports needed now

We are hearing a lot about the pandemic of the unvaccinated.

There have been lots of questions from epidemiologists, citizens, schools, first responders, childcare/senior care about “mandatory” vaccinations and it seems the small group of citizens who call themselves anti-vaccinators and conspiracy theorists, and let’s not forget the political theorists who believe this is a matter of choice

under a democratic society. When you have a health crisis that comes with the risk of permanent health issues and death, when does our democratic government implement the mandated/mandatory methodology for the greater good?

Democratic governments have implemented and supported harmful policy for the greater good when it came to addressing climate change 30 years ago. The Paris Accord serves as a crystal ball and Canada leads the way of increasing our CO-2 emissions every year So while the USA

honouring the work of the people that came before us. Alas, I am not a writer, and any attempt to show, rather than tell (which is what I am told great writers do), will likely result in confusion for all of us. None of that changes the fact that I have something rather simple to say: we are still here, we have been working hard, we have missed you, and we have been planning for your return.

Many of the programs and changes are not quite ready to be announced – or they are ready, but my announcing them would steal the thunder of people who have been working hard on them. One thing I can talk about is our stage reading program. We are going to continue those into the fall. We love having more local artists on stage. Those of you lucky enough to have caught one of our sold out (at the time there were only 50 tickets allowed) stage readings this past fall got to see something great. We have a bunch planned for the coming months and I hope you get to see one or two.

The other program that is near and dear to me, which I can talk about, is our continued Relaxed Theatre Program. This is work we have been doing for the past four seasons, taking our regular programming and making it adaptive (changing minor aspects of the performance to ensure the comfort of people with extra sensory sensitivities). We will be both continuing with and expanding this work out of our mainstage programs, and into the rest of our organization.

I am not an artist, not a writer, not a performer I facilitate art. And I am here to tell you that what we have on deck (note the sports metaphor – again, not an artist). We can’t wait to see you again, whether you are talking a class (hint hint) or seeing a show, or, even want to get on the stage yourself.

Marnie Hamagami has been with Theatre NorthWest in one form or another for 6 years. She has led the organization for the past three years and looks forward to see you all at the theatre soon.

is keeping the border closed, our Liberal Government has opened the border to fully vaccinated Americans, but what we know from medical experts, the fully vaccinated can carry the virus.

So why are the Liberals doing this? Oh right, they are calling for an election in the fall and does this give them economy bragging rights amidst the sick and dying.

Canadians want a normal life back, not a majority government! Personally, I think the government we have now listens. Arrogance and entitlement get left at the door when power is shared between parties.

B.C. serves as an example of what happens when a majority is returned. The politicians stop hearing the people.

The prime minister would make wider inroads if his government made it mandatory for Canadians to get vaccinated. I welcome a vaccine passport It is the responsible thing to do. We used to carry vaccine cards for our children to ensure their safety. And don’t even raise the question of privacy – the new generations gave this over to the social media platforms. Jo-Anne Berezanski Victoria

HAMAGAMI

“TheClubhouse”Restaurant at thePrinceGeorge Golf andCurlingCluboffersaninformaldining experience to thecommunity with afullylicensed lounge TheClubhouse features acasual menu whilecateringoptions provide afull range of delicious menu options forspecial events such as weddings, milestone celebrations,awardsbanquets andbusinessretreats.

Fullypublic, everyone is always welcome, andwith itsbeautiful viewsofthe firstand 18thholes, the newpatio at TheClubhouse at Prince George Golf andCurlingClubisthe perfect placetorelax after agameofgolf.

It’s also ideal foranyonewho wantstosavourlunch or dinner in such apeaceful, naturalenvironment. Thestunning2,100 sq ft.patio is part of an extensive renovation projectthatcelebratesthe golf course’s 70thanniversary. Anicely designed

fullyaccessiblefromthe outside whileanindoorlift also provides easy accessto“TheClubhouse”and otherfacilities.

HORO SC OPES &P UZ ZLES

Send away

Coat sleeve

Cockeyed

Nails

Slender

Homework

Relieves

Fee

Fodder

On aboat

Pier

Keepsake

Slip-up

Practical

Slanted font

Angler’s tool

Approves, shortly

Filled tortilla

Otherwise

At what time?

23. Postage item

Fido’s foot

Volcanic discharge 26. Affirmative

Dent 29. Golf gadget 30. Conducted

Play part 32. Which person? 35. Fights back

PUZZLE NO. 830

for Superman

HOW TO PLAY:

Fill in the gridsothat every row, every columnand every3x3 box contains the numbers 1through 9only once.

Each3x3 box is outlined with adarker line You already have afew numbers to get you started Remember: you must not repeat the numbers 1through 9inthe same line, column or 3x3 box.

Honolulu hello

Motivate

Emblem

Snakelike fishes

Skedaddle

Common ailment 40. NYC opera house

Tiny particle

Volcanic flow

Frosted

Middle

Jest

CL ASSIF IEDS

HOURS: Monday-Friday8:30am -3:00pm •Closed 12:00pm -1:00pm forlunch OFFICE/PHONE ADS CLOSED SATURDAY &SUNDAY

DEADLINES: AD DEADLINE:FridayatNoon forthe following Thursday

With COVID-19 vaccinations progressing and the restrictions being relaxed, we will be having a Celebration of Life for Gail Ware at her family home located at 3443 Clearwood Place, Prince George on August 28th from 1pm to 5pm. Everyone that knew her or the family is welcome to attend.

Celebrating Alex

This is a casual open house event to celebrate the life of Alexander Frederick Hogh for family, friends and those whose life Alex touched.

Drop by to take the opportunity to share your favourite memories of Alex while enjoying some food, music, art work, and photos.

August 21, 2021 @ the Elks Hall

663 Douglas Street Prince George from 11am-4pm

January 11, 1929August 12, 2013

For although it brings us comfort To walk down memory lane It reminds us how without you Life has never been the same.

REMEMBRANCES

We love you Mom

Theresa (Terry) Merie Lalonde (Poirier)

Terry passed away peacefully on the morning of August 3, 2021 at the age of 84. She is survived by four of her children, Trevor (Carol), Drinda (Jim), Bart (Sue), Mitch (Marie), 13 grandchildren, 12 great grandchildren and many other loved ones too numerous to name.

She enriched the lives of all those that had the pleasure of knowing her, and she will be forever missed by those she has left behind. She is now at peace and will be welcomed by her mother and father, five older siblings and her loving daughter, Lynn.

Thank you to the kind nurses at UHNBC for their caring attention through her last days.

There will be a private family service held to celebrate her life on Wednesday, August 11, 2021. In lieu of flowers, please make donations to the SPCA.

Armand Lefebvre passed away July 28th, 2021 in Prince George, BC at 83 years of age.

Armand is survived by his loving wife Gert; daughters Lissa, Sandy (Brian), Jenny, Lori (Chantal), Patti, Brandi (Paul); sons Brad, Jody (Kris), Dennis (Shara); sister Phyllis (Lorne); fourteen grandchildren and eight greatgrandchildren.

He was predeceased by his parents Jude & Geneva Lefebvre and son Bryon Lefebvre.

Armand was born July 11th, 1938 in New Westminster, BC. He grew up in Birch River, MB and then moved back to BC where he was heavy equipment operator with the IUOE Local 115.

Armand was known for his unfailing love for his truck, his daily Timmies coffee and the occasional Teen burger or DQ strawberry sundae.

No service by request. In lieu of flowers donations can be made to the PG Hospice Society or the BC Cancer Agency.

Barb passed away on July 28, 2021, leaving behind her earthly suffering and many grieving loved ones, especially her daughter, Chris; son, Mike (Lisa); her brother, Richard (Jan); her partner, John; and her three grandchildren, Alex, Matt, and Dan. She was predeceased by her husband, Vern, her parents, Percy and Myrtle Teeters, and her sister, Lorraine Schmidt (Gene).

Barb lived an amazing life, moving from St. Paul to the wilds of northern Ontario to manage a fishing resort with her husband, Vern. From there, they moved across the country to Prince George, British Columbia where Vern operated a guide-outfitting operation in the far north, and Barb worked as an accountant for General Motors. After a long, loving marriage together, Vern passed away in 1999. Barb was heartbroken at the loss, but she knew that life is meant to be lived, not grieved as it passes. In her autumn years, Barbara was blessed to find a fellow adventurer and companion, John. The two traveled the world together and shared many wonderful memories. Now Barb’s journeys have ended, and we are all diminished by her passing. Barb was loved and will be forever missed.

John 1:5

The light shines in the darkness, and the darkness has not overcome it.

Memorial Services In Memoriam

Obituaries

Celebration of Life for Gail Ware

In loving memory Helen Lucci

Barbara Carson

Armand Lefebvre

Survived by her children

Myra Maxine Jardine (Stewart)

Born July 16, 1928 - Bruno, Saskatchewan

Passed August 3, 2021 - Prince George, BC

It is with sadness and heavy hearts we announce the passing of our Mother Myra Maxine (Stewart) Jardine at the age of 93.

Myra was a very talented and creative woman, a loving Mother, Grandmother, Great Grandmother, and Great Great Grandmother.

Predeceased by husband Ralph Jardine, infant daughter Laura as well as all her siblings Eileen, Francis, Etna, Zena, Mavis, Beryl, Raymond and Mervin.

Bruce (Isabel), Allan (Georgia), Joan (Joe), Donna (Gary), Debbie (Rick), and Dean (Lyanne). Grandchildren, Great Grandchildren and Great Great Grandchildren

She will also be missed by many nieces, nephews, family members and friends.

It is with great sadness, and heavy hearts to announce that Brigette Block passed away on the morning of July 25th at the Prince George Hospice House, surrounded by family, friends, and the love of her life Myles.

Brigette lived each day fully, despite the fears she was faced with in the end; and she brought an infectious smile and passion for life to everything she touched. She leaves behind numerous friends and family, who will always remember her smile, spark and determination. She truly immersed herself in all that life had to give. She did not let her prognosis bring her down or define how she was going to live her life. She was a beautiful soul and will be greatly missed.

Brigette leaves behind her spouse Myles Mohammed, her mother Debbie Horseburgh, father Steven Block, stepfather William Horseburgh, inlaws Peter and Thelma Mohammed, siblings April Block, Amanda Gudmundson, Steven, Brian and Mark Van Damme, Ali Marjoribanks, nieces, nephews, extended family and spouses.

Though her smile is gone forever, and her hand we cannot hold, memories of the one we loved so much will always be carried in our hearts.

Her family would like to extend sincere gratitude to all the physicians, nurses and integrated health team whom she worked so closely with at the BC Cancer Agency, as well as her physician Dr. Saif.

Always missed, but never forgotten.

As you share the stories and the memories of how they lived their lives and how very much they meant, may you ﬁnd comfor t...

GOYER, Maurice

June 20, 1948July 28, 2021

It is with great sadness that the family of Maurice Goyer announce his passing after a short but hard fought battle with illness on Wednesday, July 28th, 2021 at the age of 73.

Maurice worked as a millwright for 40 plus years with the majority of those years employed by Northwood Pulp and Paper. When he was not at work (which was not often) you could find him tinkering in his garage, more often known as the office of MAG Maintenance. Maurice enjoyed playing hockey and waterskiing in his spare time. In his later years he enjoyed quadding and even tried his hand at sailing.

Maurice will be greatly missed by his wife of 46 years, Bente and his three boys Paul (Sonya), Jeffrey (Heidi) and Steven. Maurice will also be fondly remembered by his six grandchildren; Noah, Elijah, Sienna, Emma, Jacob and Kristian, by his sister Rose (Rick) Delorme and numerous nieces and nephews.

Maurice was predeceased by his parents Roland and Blanche; brothers Con and Sid and sister Jean.

The family of Maurice Goyer would like to thank all our wonderful doctors at Aspen Medical Clinic, the Home care nurses and the kind and caring staff at the Prince George Rotary Hospice House for the care they provided Maurice in his final days.

The service department of MAG Maintenance is now closed but full of great memories.

In keeping with Maurice’s wishes there will be no funeral service. In lieu of flowers please make donations to the Prince George Rotary Hospice House.

Condolences may be offered at www.AssmansFuneralChapel.com

Beryl Ann Botham (nee Huble)

1943-2021

It is with heavy hearts that we announce the passing of Beryl Ann Botham (nee Huble) on the morning of August 4, 2021. Beryl passed peacefully in her sleep with her loving family and friends close by. Beryl leaves behind the love of her life, John Botham, and beloved sons Steven and Kevin Botham. She is also survived by her daughters-in-law Melanie Short and Bobbi Borys, as well as her four loving granddaughters: Sydney, Emily, Lauren, and Kaitlin and cousins Myles Huble, Violet Huble and Barry Henry (Bev). Beryl was born to Albert and Ann Huble on September 25, 1943, in Surrey, England. She moved to Canada at a young age where she would later pursue a career in teaching. Beryl’s impact was felt by many in her 30+ years of teaching during which time she taught in Summit Lake, Smithers, Vanderhoof, Connaught (Ron Brent) Elementary, Harwin Elementary, and Heritage Elementary. Later in her career, she uncovered a passion for teaching ESL and would go on to become the district representative in that field.

Those who knew her recognize Beryl’s generosity and kindness. She was an active member of her community and donated her time to the Council of Seniors and the Huble Homestead Board of Directors. At the end of the day, there was nothing Beryl loved more than her family. She enjoyed many summers with them at Summit and Carp Lake. She also had a passion for sewing, quilting, knitting, and crocheting. She could often be found cooking for her family or engaging in a spirited game of cards.

The Botham family wishes to extend their thanks to the wonderful staff at the Prince George Rotary Hospice House and Dr. Mader and her team for their kindness and caring during a very difficult time. In lieu of flowers, please contribute to the Huble Homestead or Prince George Rotary Hospice House in her honour. There will be a Celebration of Life at a later date.

Condolences may be offered at www.AssmansFuneralChapel.com

Randolph Scott Allen

February 13, 1957 to July 26, 2021

Randy is survived by brothers: Kim (Linda) and Colin (Cindy) and sister-in-law Maureen; nieces and nephew: Trina, Sherri (Sandor), Jane (Matt), Leah (Ryan), Lauren (Yuki), Brett (Becky), and Jaimie (Kevin); and was a Great Uncle to:Tristin, Darian, Desmond, Conrad, Oakley, and Brannen; Predeceased by: father Joe, mother Ellen and brother Craig.

Rest in Peace, you are forever in our hearts.

Celebrate the lives of loved ones with your stories, photographs and tributes

Because I Love You So

Time will not dim the face I love,

The voice I heard each day,

The many things you did for me,

In your own special way. All my life I’ll miss you,

Celebrate the lives of loved ones with your stories, photographs and tributes

As the years come and go, But in my heart I’ll keep you, Because I love you so.

Brigette Block

Florence Isabel Woycik

July 15, 1923 ~ July 28, 2021

Florence Woycik passed peacefully in her sleep on Wednesday, July 28, 2021, at the very respectable age of 98.

May your eyes and ears see and hear all, again Rest in Peace, Mom

For more information and to leave condolence messages, please visit: www.schoeningfuneralservice.com

September 18, 1946July 22, 2021

The family of Stuart Dick is sad to announce his passing on July 22, 2021 after battling a terminal lung disease for a number of years.

Stuart was born in Indian Head, Sask. to Bill and Helen Dick on Sept. 18, 1946. He spent much of his early life in Peebles, Sask. until moving to Prince George in 1956. He graduated from Prince George Secondary and went on to work at AJ Forsyth, BC Rail and School District # 57, from where he retired.

He enjoyed vacationing in first Hawaii and then Le Penita, Mexico where he met many friends. Here at home, he could often be found having lunch at the Senior’s Centre or cruising the aisles of Costco in their electric scooter.

Stuart was predeceased by his parents, Bill and Helen Dick and brother-in-law Dale Cannon. He and his unique sense of humour will be missed by his family; sister Isabel (Garry), brother Bill (Deanna), nephews Bryon (Anita) and Curtis (Barb), nieces Leah (Graham) and Alexandria (Lui), his plethora of cousins, his rescue cat, Rooney, and his many special friends.

There will be a remembrance gathering for friends and family to reminisce and enjoy a Costco fudge bar in his memory, location and date to be announced.

Kateryna Beznochuk

June 6, 1921 – August 4, 2021

It is with great sadness that we announce the passing of our Baba, Kateryna Beznochuk, long time resident of Pineview. Born in a small village in Ukraine she was the youngest of ten siblings. Predeceased by her husband Alexander, infant son Vladimer, mother Faye, father Demitri, and all her siblings.

Mom will be deeply missed by son Victor (Heather) and daughter Olga (Byron). She leaves her precious grandchildren Corinne, Christine (Ryan), Steven (Courtenay), Kevin (Emma), Darren (Chelise), great grandchildren Grayson, Emery, Ethan, Annika, Myla, Nora, Anika and Jacob, all of whom adored their Baba immensely.

All who were fortunate to know Kateryna will remember the passion for her vegetable garden, Ukrainian cooking, reading numerous Russian books, and fascinating story telling with her remarkable long lasting memory. Baba so much cherished her privacy and independence. She had such a loving and caring soul who cared deeply for so many.

The family is thankful for the compassionate care provided by Dr. Youssef, Dr. Geddes and their staff. At Baba’s request, no service will be held. After cremation her immediate family will privately bury her ashes, finally reuniting her with her husband. A celebration of life to be planned later.

Jack James Tennant

Jack James Tennant, born and raised in Quesnel, retired to Prince George BC, passed away peacefully surrounded by family on July 30, 2021, after a year long struggle with cancer.

Jack is survived by his wife Valerie, his boys Darren (Tristan) and Darcy (Chrystal), his step children Kenneth (Julie), Nicole (Eddie) and 5 grandchildren. Predeceased by his brothers Scott and Bart, and his parents James and Merlie Tennant.

His use of colorful vocabulary will be remembered by the many that met him over his many years working as a mechanic at Arrow in Quesnel. His family will always remember his love of ratty old slippers that often left him flat on his back, his love of cats and his insistence on all meat being cooked til “crunchy” and in need of much ketchup to make it edible.

Jack was the typical old biker. Long hair and leather were his style and he took great pride in the fact that he still had a full head of hair. If Valerie could have found a perfume scented as burning rubber, Jack would have been the happiest man in the world. Jack did fill his desire for that aroma every year when Valerie and He spent their time at The Stomp, where Jack was well known for his smoke show and glowing pipes.

As per Jack’s wishes there will be no service and the family will mourn privately.

Dearest Jack

Our lives go on without you but nothing is the same, We have to hide our heartaches when someone speaks your name. Sad are the hearts that love you.

Silent the tears fall, living our hearts without you, is the hardest part of all. You did so many things for us your heart was kind and true, And when we needed to talk to someone we could always count on you. The special years will not return when we were all together, but with the love within our hearts you will walk with us forever Ride on my love.

With the opportunity for great personalization, the funeral service can truly reflect the uniqueness of the life it honours. Contact us to find out more.

Stuart Dick

MARGARET PROCHNICKI

2x56.8

PGC002283

Crossman,Gary September06,1934-July29,2021

GaryCrossmanpassedawayattheageof86onJuly29, 2021intheRoyalAlexandraHospitalEdmontonwithhis daughtersRoseandHeatherbyhisside.

IspredeceasedbyhislovingwifeDonnaof52years married.Hewillbegreatlymissedbyhisremainingfamily members,manyfriendsandbrothersinthe115union. TheoldestofsixchildrenfromSackville,NewBrunswick. JoinedtheAirForceintheearly1950s.Movedallaround AlbertaandBC.Workedintheoilfields,mining,road constructionofCoquihallahighway,IUOE115,driving taxi,ambulanceattendant,blastingcrew,lovedtogarden andhadmanyrescuedogs.

SurvivedbysisterMadelyn,daughtersRose(Kent), Heather(Steve),grandchildrenKyla(Matt)Stevan,April (Steve),GaryandMichael.GreatgrandchildrenCasey, Kenley,ZoieandScarlett.

PleasedonateinmemoryofGarytoyourlocaldog shelter.

1946-2021

It is with great sadness that we announce the passing of LARRY JOHN KLASSEN, who passed away on August 2nd, 2021 at the age of 75 years. Survived by his loving wife Marty, son Caleb, daughters; Bobbylynn, Jody and Jennifer, brothers; Don, Randy (Leslie) and Peter (Jan) Klassen, grandchildren; Ty, Janelle, Morgan, Noah, Alexander (Lex), Larry (Carol), Dianne (Mike), Muriel (Albert), Audrey (Ralph), Darrell (Muriel), Cheryl (Roy), Morris (Joan), Heather (Don), Joe (Tam), Fred (Sherry), Shelley, Lyle (Chris), Leslie (Robert) and numerous close friends. Larry was predeceased by his parents John and Bonnie Klassen, brother Len and son Todd Klassen. A celebration of his life will be held at Lakewood Alliance Church 4001 5th Avenue Prince George, B.C. on August 13, 2021at 1:00pm with Pastor Dave officiating. In lieu of flowers, donations may be made to the Hospice House.

Edward (Teddy) Fredrick Buchanan

After a long and valiant fight with Cancer, Edward (Teddy) Fredrick Buchanan passed away at age 73 on Monday, July 26th at Vanderhoof Hospital. Teddy loved nature and the outdoors he lived his entire life in the North, off the grid epitomizing what it is to be an autonomously independent person. Ted was an accomplished feller-buncher operator, logger and woodcutter. He carried a tall reputation as both a hard-working man always up for any physical challenge as well as possessing a robust sense of humor, which was with him until the end. Ted knew how to enjoy life and loved a good party, he was a gifted singer and musician skilled in playing many musical instruments including the guitar, button-key accordion and harmonica. Ted felt one of his greatest accomplishments was being able to teach himself mechanics through memorization, rather than academics, which enabled him to build, maintain and repair his machinery. He leaves behind his partner Donna Leslie, seven children Len, Lacey (Gordy), Chad (Christina), Lucille (Shane), Will (Kate), Monica (Kyle) & Peter (Roxanne), 23 grandchildren, six great– grandchildren and is survived by six younger siblings- two brothers & four sisters. Teddy was dearly loved and will be greatly missed by family and friends. A celebration of life is planned for August 8th, 2021 in Fraser Lake, BC.

Christopher Lee Collins

1975-2021

With sadness in our hearts, we are sorry to announce the recent and unexpected passing of Christopher Lee Collins, deceased July 31st, 2021, in Vancouver, British Columbia.

Chris was born October 9th, 1975, in Prince George, British Columbia. Predeceased by father, Leonard Collins, grandparents Mary and Richard Collins, Alice and William Andrews, and sister Pauline. Left to mourn, mother Yvonne and stepfather Ed, lifelong friend Darryl, and partner Jody, sister Arlette (Curtis, Shalysa, Tiara, Miyah, Devonne, Nadina, Meeka), sister Nadina (Adam, Kascha, Devin, and Zoe) and great nephew Noah, brother Wesley (Frances, Robert, Meghan), brother Leonard (Jen, Tiana), brother Ronnie, brother Aaron (Sanisha), and numerous aunts and uncles.

Memorial service will be held at Prince George Funeral Service on 1014 Douglas street, Prince George, B.C. on August 14th at 1:00pm.

Cecil Stinson McCabe

December 26, 1933July 30, 2021

It is with great sadness and heavy hearts we, the family of Cecil McCabe, announce his passing on July 30, 2021 at the age of 87.

Cecil was predeceased by his loving wife Avis in 2001; parents Clarence and Sophie McCabe; siblings Darlene, Bernice, Ila and Vernon. It comforts us to know he will be welcomed with loving arms into the forever after.

Cecil will be dearly missed by his children Mabel (Jim) Meng, Betty (Ron) Scott, Shirley (Chris) Adams and Rob McCabe; loving partner Jeannette McAvany and grandchildren Melissa, Brad, Darren, Teresa, Misty, Andrew, Calvin and Cale; ten great grandchildren and many more family and friends.

Cecil came to Prince George in the mid 1950’s to work in the logging industry, from the farm 3 1/2 miles south of Freemont Saskatchewan--where he was born and spent his childhood. He spent the majority of his working years with Northwood Shelly Sawmill, where he operated the crane. All log truck drivers new the job would be done with care and expertise. Cecil retired in the spring of 1990, when Shelly sawmill closed and the crane that was part of him was retired, so he as well felt it was time to follow. Cecil was a family man to the fullest. He enjoyed all things family and always had a Coors Light to crack open for you, and HIM. We will love and miss him, now and always. Farewell to a man of few words and a Big Heart.

In lieu of flowers, please make donations to the Alzheimer’s Society or a charity of your choice. Graveside Service took place for family and close friends on Tuesday, August 10, 2021 at 11am at the Prince George City Cemetery.

Condolences may be offered at www.AssmansFuneralChapel.com

Larry John Klassen

Dollar Saver Lumber has openings for the following positions:

• La bourers

• PL aNer FeeDer ( FT)

• Gr aDers ( FT or PT )

for 1x4, 1x3 in 8’, 7’ 6’ & 5’ lengths)

Will pay competitive wages steady Work

Please apply in person to:

Dollar Saver Lumber

Attn: Ken 9359 Nor thern Cres Prince George, BC or email keyles@lumber.ca or gobbi1@telus.net Fax: 250.561.2111

Legal Secretary

Position available immediately in a corporate lawyer’s practice with preference being give to applicants with law office experience. Provide resume to 330-500 Victoria St, Prince George, BC or to grb@grblaw.ca.

Skilled Help

2 Security-First Aid attendants required in the Chetwynd area. Permanent, full time positions. Please call (250) 261-1309 or email norsec@pris.ca for details.

TNDC is hiring!

•Heavy EquipmentOperators

•Rock Truck Drivers

•Labourers

•Heavy Duty Mechanics

Remotecampsetting – flights available from various marshalling points in BC &Calgar y, AB.M ust be able to pass mandatory pre- employmentdrug and alcohol screening. Visit our website (www.tndc.ca/careers)

Email resumes in MS Word or PDF format to jobs@tndc.ca

CAREER OPPORTUNITY

Dollar Saver lumber operates a lumber re-manufacturing operation in Prince George. We currently have an opportunity in our management group for a Sales Production coordinator.

This position is responsible to perform the following functions:

• Co-ordinate purchase of raw material to meet mill requirements

• Co-ordinate Shipments of finished products to existing customers.

• Work with Mill Management to ensure optimal inventories are maintained.

• Communicate with customers to ensure their needs are being met

Preference will be given for persons

• Completed a College Course in Business Administration or have equivalent experience

• Good computer skills including proficiency with Microsoft Excel.

The successful candidate will possess the following qualities

• The ability to deal with customer needs in a calm constructive manner

• The ability to adjust to rapidly changing conditions and developments

• The ability to work both independently and as part of a team.

• Good analytical skills

The position offers:

• A competitive salary and benefit package

• Opportunity to work in friendly non- bureaucratic environment

Please submit your resume to Frank Skerlak, General Sales Manager at fskerlak@lumber.ca or Bev at: gobbi1@telus.net Only those persons chosen for an interview will be contacted.

Trades Help

PEACEVALLEYINDUSTRIES

(2016)LTDQUALIFIED JOURNEYMANWELDERS

PeaceValleyIndustriesis currentlylookingfor QualifiedJourneyman WeldersforChetwyndB.C. Minimum5years experience.Pleaseemail resume to peacevalley@uniserve.com. Nophonecallsplease. peacevalley@uniserve.com

Trucking & Transport

CLARKFREIGHTWAYS

CLASS1LINEHAULDRIVER Cleandriver’sabstract requiredwith6-12mos previousmountaindriving experience.

$0.5491permile$25.53/hr benefits.

Email: jobs@clarkfreightways.com

Fax:604-472-2136

PEACEVALLEYINDUSTRIES (2016)LTDCOALHAUL TRUCKDRIVER

PeaceValleyislookingfor Class1Driversforthecoal haulinChetwyndBCarea. Competitivewages,benefits andaccommodations provided.Minimum5years offroadexperiencerequired. Notwillingtotrainatthis time.

Pleaseemailresumeto peacevalley@uniserve.com orcallJimat250-788-5592 peacevalley@uniserve.com

Apartments

Property For Sale

Lake, finest location by owner Only $399,000 end of Meier Rd. 604-908-0313

house with 9 acres irrigated pasture All Amenities Next to Eagle Point Golf (Kamloops) 985K Will carry mortgage View Realtor.ca 250-573-3346 e-mail biffsbenson@yahoo.ca

Houses For Rent

3 bdrm house, approx 3 km up the Hart Hwy $800/mo (250) 9600299 or (250) 564-4598

4 bdrm ground level, like new, available now. 2833 Range Rd no pets, $1700/mo + hydro & gas.(778)988-4381or (250) 5526257

4 bdrm, newly renovated available now. Close to Peden Hill School, no pets.(778)9884381or (250) 552-6257

PERSONALS

Notice is hereby given, pursuant to section 17 of the Woodlot Licence Planning and Practices Regulation, that a Woodlot Licence Plan has been prepared for Woodlot Licence 1172, licensed to Laurie Cook. This woodlot has portions located near Prince George and Saxton Lake.

If approved by the Ministry of Forests, Lands and Natural Resource Operations and Rural Development’s District Manager, this plan may apply for a term of ten years from the date of approval.

This woodlot licence plan is available for public review and comment from August 12 to September 10, 2021 by appointment at (250)

Trucks & Vans

Basement Suites

How to choose living room furniture

Whether you want to spruce up your living room or completely remodel it, choosing new furniture can be a challenge.Herearesometipsthatcanhelp.

IDENTIFY YOUR NEEDS

Considerhowthespacewillbeused. IfyouwatchalotofTVorenjoy frequentmovienights,optfora comfortablecouchwithenoughspace forthewholefamily.Foravidgamers, anentertainmentunitwithshelves tostoreconsolesandcontrollersisa practicalpurchase.Acoﬀeetablethat canbeadjustedtovariousheightsisa greatsolutionifyoutendtoeatyour mealsinthelivingroom.

Additionally, a sofa bed is a versatile choiceifyouneedyourlivingroomto double as an occasional guest room. You should also determine how much storageyou’llneedtoensurethespace isfunctionalandfreeofclutter

ASSESS THE SPACE

Measurethedimensionsofyourliving

roombeforeyougoshoppingtomake sure you choose pieces that fit If you want to maximize the space’s potential, sketch out a few different floor plans Keep in mind the location of windows, doorways, baseboard heaters and floor vents when you design the layout. You should also take note of whether direct sunlight will create glare on the TV screen or potentially fadefurniturefabric

ESTABLISH A BUDGET

Evaluate your financial situation and inquire about financing options for big-ticket items. Once you know how much you can afford to spend, decide on a budget and stick to it. Keep in mind, however, that while quality piecesaremoreexpensive,they’llalso lastalotlonger Itmaybeworthshelling out a bit more for furniture if it’s wellmade.

SETTLE ON A STYLE

When buying new furniture for your living room, it’s best to choose pieces

withcoloursandtexturesthatcomplement one another Additionally, deciding on a design style will help guide your choices and allow you to successfully pair wood, metal and glass pieces.Fromthewhimsyofbohemian chic to the crisp simplicity of Scandinavian, there’s a wide range of styles to select from. Choose one you love andpickyouritemsaccordingly

TEST EACH PIECE

Before you purchase a sofa or chair, try out the floor model to make sure it’s comfortable. If you find a few items you like in the same store, ask if they can be placed side by side so you can see how they look together You should also bring along paint chips,swatchesandphotostohelpyou find furniture that matches what you alreadyhave.

To simplify your search for living room furniture and help you create a cohesive space, consider hiring a professionalinteriordesigner

Kaycie

Janine

Donna Badowski*** Sarah

Jasmine

How to live a long and healthy life

Ifyouwanttoincreaseyourlifespan,adopting ahealthylifestylecanhelppreventillnessand injury.Here’swhatyoushoulddotolivea longlife.

EAT WELL

Anabundanceofnutrient-richfruitsand vegetables,wholegrainsandﬁshpackedwith omega-3fattyacidsarevitalcomponentsofa healthy,balanceddiet.Youshouldalsolimit yourconsumptionoftransfat,salt andreﬁnedsugar

STAY HYDRATED

Drinkatleasttwolitresofwatereverydayto helpyourbodyabsorbnutrients,regulateyour temperatureandeliminatewaste.Youcansupplementyourliquidintakewithbroth,milkand juicethat’slow insugar.

WATCH YOUR WEIGHT

Ifyou’reoverweight,youriskdevelopinga rangeofhealthproblemssuchascancer,high bloodpressureandcardiovasculardisease. You’realsomorelikelytoexperiencejointpain andreducedmobility

GET ENOUGH SLEEP

Adultsshouldsleepbetweensevenandnine hourseverynight.Tooptimizeyourrest,establishaconsistentsleepscheduleandinvestin aqualitymattressandpillow Youshouldalso avoideatingandlimityouruseofelectronic devicesbeforebed.

REMAIN ACTIVE

Healthexpertsrecommendthatadultsengage inatleast150minutesofaerobicexercise everyweek.Inadditiontoprovidingphysical

beneﬁts,anactivelifestylehelpsboostyour mood,improveyourmemoryandreducestress. Chooseanactivityyouenjoytoensureyoustay motivated.

EXERCISE YOUR MIND

Todelayorpreventcognitivedecline,you shouldchallengeyourbrainonaregularbasis. Reading,learningnewskills,solvingpuzzles andplayinggamesareallgreatwaystostimulateyourbrain.

MAINTAIN YOUR SOCIAL CIRCLE

Regularlyvisitingfriendsandfamilyhelps decreasefeelingsofdepressionandanxiety. Socialconnectionscanalsostrengthenyourimmunesystemandloweryourriskofdeveloping dementia.Plus,groupactivitiesareoftenagreat sourceofentertainmentandlaughter.

LEARN TO MANAGE STRESS

Fromulcersandirritabilitytomigrainesand highbloodpressure,stresscanhaveserious consequencesonyourhealth.Explorevarious waystorelaxandreducestresssuchasbreathingdeeply,listeningtomusicandpractising yoga.

CONSULT HEALTH PROFESSIONALS

Dependingonyourageandhealth,youshould visityourdoctor,dentist,optometristandother health-carespecialistseveryfewmonthsor years.Ifyouexperienceanyconcerningor persistentsymptoms,scheduleaconsultation rightaway

Inadditiontoadoptingthesehealthyhabits,you shouldavoidsmokingandlimityouralcohol consumptiontotherecommendedamount.

Finding Homes for Families

How to organize a home renovation project

Give old items a second life with upcycling

Upcyclingistheprocessofturningsomething unwanted into a beautiful and useful object. Whilethetermmaybenew,theconceptisn’t. Peoplehavebeenrepurposingthingsforever Notonlydoesitkeepitemsoutoflandﬁlls,it alsogivesyouanoutlettoshowoﬀyourpersonalstyle

There are two ways to upcycle: you can give something a makeover while preserving its original use, or you can change its intended purpose altogether Almost anything can be upcycled, including furniture, used clothes and items you’d normally throw out like tin cansandglassjars.

If you don’t have anything around the house you can use, check out local second hand shopsorﬂeamarkets.

Remember that whatever you’re using will retain its properties, meaning that if the dresser you’d like to paint is falling apart, a new look won’t change that You may need to repairitemsbeforeupcyclingthem.

PROJECTS TO TRY

Areyouexcitedtostartupcyclingbutnotsure wheretobegin?Hereareafewideas:

• Oldchairscanbegivennewlifewithacoat ofpaintandcolourfulcushions.

• Jamjarscanbepaintedtocreateprettystorageforthebathroomortocreateone-of-akindlightﬁxtures

• Old wooden ladders can be sanded and used to hang blankets or become rustic bookshelves.

• Tin cans can be covered in fabric and used aspenholdersinanoﬃce.

Are you ready to take on a major home renovation but don’t know where to start? Here’s how to organizeyourtasksandensureeverythinggoessmoothly

MAKE A LIST

Renovationsshouldbedoneinalogicalordertoavoid wastingtimeandmoney Forexample,youshouldn’t paintthewallsbeforeyou open them up to install insulation. To ensure you haveaclearideaofwhat’s involvedanddon’tmissa step, make an extensive list of all the tasks that needtobedone.

ESTABLISH aschedule

Once you know what your project entails, you can determine a logical sequence in which to complete tasks. In general, you should start with any necessary demolition andtacklelargestructural projectsﬁrst.Thismayinclude repairs to the foundation,supportbeamsand subﬂoor After you’ve addressed all plumbing, electrical and insulation concerns, you can hang the drywall and proceed

Formoreinspiration,browse online.Withalittletimeand imagination, you’ll be on yourwaytobecominganaccomplishedupcycler

totheﬁnishingtouches.

Depending on the scale of your renovation, you can moreorlessfollowthese10steps:

1. Demolish,startingwiththeupperﬂoors

2. Makestructuralrepairs

3. Installelectricalwiring,andplumbing

4. Cleanandupgradetheexterior

5. Addorreplaceinsulation

6. Replacethewindows

7. Closeupthewalls,ceilingsandﬂoors

8. Painttheceilingsandwalls

9. Installtheﬂooring

10. Cleanupandfurnish

If you plan to live in the house while it’s being renovated, remember to update only one bathroom at a time.This way you’ll ensure you always have one thatcanbeused.

EVALUATE CONSTRAINTS

If you can’t aﬀord to complete all of your renovations right away, determine the cost of each project andidentifyyourtoppriorities.Youcaneitherdoone roomatatimeorstartwithsmalltasksthroughoutthe housewhileyousaveupthemoney

Additionally, be sure to schedule your timeline aroundseasonal weather that could aﬀect yourrenovationprojects.Forexample,it’sbesttoavoidupgradingtheexteriorduringwinterorpaintingtheinterior inthesummer

Foroptimalresults,considerhiringacontractorwho canensuretheworkgetsdonetocode.

How to choose the right air conditioner

If you need to buy a new air conditioning system,youhaveanumberofoptions.Here areafewtipstohelpyoudecidehowtobest coolyourhome.

DETERMINE YOUR NEEDS

The appropriate system for your home will largely depend on the type of dwelling you livein.Ifyouhaveahouse,youmightwant to invest in central air conditioning or a geothermal pump. If you own a unit in a multi-family building, consider installing a wall-mountedsystem.Ifyou’reatenant,opt for a portable air conditioner Regardless of yourchoice,makesurethesystemyouselect adheres to building rules and municipal noisecontrolregulations.

ESTABLISH A BUDGET

In addition to calculating the short-term costs of purchasing and installing an air conditioning system, you should consider the associated long-term expenses. This includes the amount for all maintenance tasks and potential repairs. Determine an acceptable price range based on your current financialsituation.Ifyouneedtomakesignificantrenovationstoinstallacentralsystem, lookintoavailablefinancingoptions.

EVALUATE POWER REQUIREMENTS

The ideal cooling capacity for your air conditioner (measured in British thermal units or BTUs) will depend on the size of

your dwelling, the quality of the building’s insulation and the number of rooms and storeys you want to cool While you want a unit that’s powerful enough to maintain a comfortable temperature throughout your home, an oversized model tends to operate inshortburstsandconsumeexcessenergy

CONSIDER LOCATION

You should determine in advance where your air conditioner will be installed, especiallyifyouliveinanapartmentwithlimited spacetoaccommodateabulkyunit.Ifyou’d prefertoonlycoolcertainroomsthroughout theday,aportablemodelonwheelsmaybe a convenient choice. If your home faces southoramajorityofitswindowsareonthe southside,yourairconditioningsystemwill need to work harder However, blinds or thickcurtainscanhelpblockthesunandtherebyreduceyourcoolingcosts.

Onceyou’veselectedanairconditioner,hire a professional to install it and make sure it works.

Regardless of the type of air conditioning system you need, look for a model with Energy Star certiﬁcation. This will guarantee that the unit is energy efﬁcient.