Bulletin Daily Paper 04-10-14 by Western Communications, Inc.

Serving Central Oregon since190375

THURSDAY April10,2014

OunCIn aC Inm NIll Ill gI'

Prep track SPORTS • C1

HEALTH• D1

bendbulletin.com TODAY'S READERBOARD

Salamanders — The unsung heroes in the fight against climate change?A3

By Tyler Leeds The Bulletin

The Central Oregon Community College board voted unanimously Wednesday night to not hire its "top choice" as the school's next president, following the revelation that the can-

PluS: LOOk Smart — Look more attractive if you want people to think you're smart, a new study says.A3

BEND

I1I1IA IS OLl

New

same day announced the deci- will begin the search anew this Jim Middleton, is set to retire this sion to postpone the board's vote. upcoming school year, mirror- summer after a decade with the Lanning, 48, is chief acaing the approach which school. Abernethy said he has demicofficerof instruction COCC initiated last fall. not asked Middleton whether and student servicesfor Because of this change, he will stay on longer. However, the Chemeketa Commu/ - ., t h e college probably will Abernethy did say the school ' nity College District and not have a new president intends to hire an interim pres' its Yamhill Valley Campus until the summer of 2015. ident, a decision the board will "We're looking at it as discuss at a meeting next Monpresident in McMinnville. Lsnning

didate was placed on paid adif we're hitting the reset day. Abernethy noted that both ministrative leave by his current During th e r e cruitment employer Feb. 11. process, Lanning never button," Abernethy said. internal and external candidates The college was poised to ap- informed COCC he was on leave. "We're basically just pushing may be considered for the interpoint Patrick Lanning its next Bruce Abernethy, COCC thingsback ayear." impost. president on March 17, but that board chairman, said the college C O CC's current president, SeeLanning/A4

CIIVISIOBS

for city work By Monicia Warner The Bulletin

The city of Bend has created two new departments

in recent years and plans to create a

Bank robberies — south-

third soon. Because

ern California was ahotbed for heists. But not anymore. What's changed?A6

the recession caused layoffs and major restructuring, the city

is starting fresh with departments that

Martial arts —They're

will focus specifically on population growth and improv-

more than just an exciting and novel way to exercise.01

ing streets.

It's a sign that Bend is on the re-

Plus: Nutrition —Make your own nut milk andmore. D1

bound from the

downturn.

Mass stabbing — Teento

One of the recent additions is a

be charged as an adult. A2

Growth and Management Depart-

And a Web exclusive-

ment that will bring

Florida lawmakerswantthe state's newest international touristattraction to behealth care. beettbelletie.cem/extras

together seven land use and transporta-

tion planners from other departments to work on at least four

major projects. This includes planning

EDITOR'SCHOICE

for future growth

and the possible expansion of the city boundary. The city is also expected to hire a

Report Russia held backintel on marathon bomb suspect

transportation di-

rector who will head up a new Transportation Services Department that

will oversee street tr ' ///

(

By Michael S. Schmidt and Eric Schmitt

maintenance, transJ '

portation funding and the city's vehicle

fleet. The Public

rq ' I

New Yorh Times News Service

•

Works Department currently oversees

•

WASHINGTON — The

Russian government declined to provide the FBI with information about one of the Boston marathon

Principal Dave Perdue gets hugs from his students after an assembly on his last day Wednesday at Redmond's John Tuck Elementary.

bombing suspects two years before the attack that likely would have prompted more extensive scrutiny

ofthe suspect,according to an inspector general's review of how U.S. intel-

ligence and law enforcement agencies could have

thesetasks. SeeBend /A4

Photos by Ryan Brennecke/The Bulletin

By Leslie Pugmire Holee The Bulletin

The teachers cry. The kids cry. Parents cry and eventually even the principal cries. It's a bittersweet day at John Tuck Elementary School in Redmond: Dave Perdue, longtime principal, is

moving on.

thwarted the bombing.

Russian officials had

Several dozen Tuck students

told the FBI in 2011 that the suspect, Tamerlan

raise their hands at Perdue's farewell assembly Wednesday

Tsarnaev, "was a follower

when asked whether their

of radical Islam and a strong believer" and that

he prepared to leave the

parents had Perdue, 55, as a principal. Twenty-seven years — 19 at Redmond High, eight at Tuck — is a long time to dedicate to a single school dis-

United States for travel to

trict, but Perdue wouldn't have

the country's region to join unspecified underground groups."

changed a thing. "As I leave, I feel good about what we've done here at Tuck," he said. He's also proud of his 14 years on the leadership team at Redmond

Tsarnaev "had changed drastically since 2010 as

But after an initial in-

vestigation by FBI agents in Boston, the Russians

High School, serving as assistant principal during years of tremendous challenge and change. "If a person is heading into a storm, Dave's the guy you want by your side," said Mike McIntosh, Redmond School District superintendent. "He's

By Jia LynnYang The Washington Post

Nina Olson, the

national taxpayer advocate, likes to

keep track of the unlikeliest places people can get their

600D LUCK AT ALPINE N

MR PERDUE

unflappable, steady as a rock." Perdue has accepted a job as principal of Alpine Elemen-

taxes done. For ex-

tary in Alpine, Utah, a state where three of his adult chil-

ample, someone sent her a photo of a dog groomer who was offeringtoprepare

dren reside.

people's tax returns.

O'E. WILL "WIISS YOU

SeePrincipal/A5

declined several bureau

requests for additional information they had about Tsarnaev. At the time, U.S. law

enforcement officials believed that Tsarnaev

Billing Medicare while financing top Democrats

posed a far greater threat to Russia. The new inspector general's report found that it was only after the bombing

New York TimesNews Service

occurred last April that

highest Medicare reimburse-

the Russians shared with

ments in 2012 are both major contributors to Democratic Par-

the FBI the additional

intelligence, including information from a telephone conversation the Russian authorities had intercepted

between Tsarnaev and his mother in which they dis-

cussed Islamic jihad. SeeIntel /A4

By FrancesRoblesand EricLipton MIAMI — Two Florida doctors who received the nation's

ty causes, and they have turned to the political system in recent

The pattern of large Medicare payments and six-figure

Health and Human Services.

years to defend themselves

political donations shows up

against suspicions that they may have submitted fraudulent

among several of the doctors whose payment records were

fused to make the data public and finally did so only after being sued by The Wall Street

or excessive charges to the fed-

released for the first time this

Journal.

eral government.

week by the Department of

See Medicare/A4

INDEX

The Bulletin

TODAY'S WEATHER Sunny High 63, Low34 Page B6

Tax prep pros often unlicensed

Business Calendar Classified

C5-6 Comics/Puzzles E3-4 Health D1-6 Obituaries B2 Crosswords E 4 H o roscope D5 S I Et-6 Dear Abby D5 Lo cal/State Bt-6 TV/Movies

For years, the department re-

B5 Ct 4 D5

AnIndependent Newspaper

Vol. 112, No. 100,

30 pages, 5 sections 0

A few years ago, on a trip to Texas, Olson spotted a massage parlor offering tax services. "It could be that

the person at the massage parlor is a very, very qualified return preparer. But I have no idea," Olson said in an interview.

"And that's my

point — I have no

idea," she continued. SeeTaxes/A4

Q l/i/e use recycled newsprint

IIIIIIIIIIIII 88267 02329

TH E BULLETIN• THURSDAY, APRIL 10, 2014

The Bulletin HOW to reaCh US STOP, START OR MISS YOUR PAPER?

541-385-5800

NATION Ee ORLD

eenc ar e in

Phonehours:5:30a.m.-5 p.m. Mon.-r ii.,6:30a.m .-noonSat.-eun

SC OOS

GENERAL INFORMATION

541-382-1811

in s

PakiStan bumbiugS —A powerful explosion ripped through a crowded fruit market in Islamabad onWednesday, killing at least 22 people and injuring about100 in the deadliest attack in the Pakistani capital in more than five years. Theattack coincided with government efforts to negotiate a peacedeal with the Pakistani Taliban, which is officially observing a cease-fire until Thursday. A spokesman for the Taliban immediately denied responsibility in the bombing. Instead, a manidentifying himself as a spokesman for a little-known separatist group, the United Baluch Army, claimed responsibility.

By KevinBegosandJoe Mandak

ONLINE

www.bendbulletin.com EMAIL

bulletin©bendbulletin.com N EW S R O O M AFTER HOURS AND WEEKENDS

541-383-0367 NEW S R O O M FA X

541-385-5804

The Associated Press

M URRYSVILLE, P a .

Flailing away with two kitchen knives, a 16-year-old boy with a "blank expression" stabbed and slashed 21 stu-

dents and a security guard in the crowded halls of his suburban Pittsburgh high school Wednesday before an assistant principal tackled him. At least five students were

N EW S R O O M E M A IL Business .....businesstlbendbulletin.com Ciiy Desk..........news@bendbulletin.com CommunityLife communitylife@bendbulletin.com Sports..............sports©bendbulletin.com

OUR ADDRESS Street ...........1777 S.W.Chandler Ave. Bend, OR97702 Mailing.........P.O.Box6020 Bend, OR97706

Si sil.ArL

Drserirsre

ADMINISTRATION Chairwoman Elizabeth C.McCool..........541-363-0374 Publisher Gordon Black .................... Editor-in-Chief John Costa........................541-383-0337

DEPARTMENT HEADS Advertising Jay Brandt.....541-363-0370 Circulation AdamSears...541-365-5605 FinanceHolly West..........541-363-0321 HumanResources Traci Donaca.....................541-363-0327 Operations James Baisinger...............541-617-7624

TALK TO AN EDITOR Business Tim Ooran.........541-363-0360 CiiySheila G.Miler..........541-617-7631 CommunityLife, Health JulieJohnson....................541-383-0308 EditorialsRichard Coe.....541-363-0353 GO! Magazine Ben Salmon....................... Home,All Ages AlandraJohnson...............541-617-7860 NewsJanJordan..............541-383-0315 Photos DeanGuernsey.....541-363-0366 SportsBill Bigelow............541-363-0359 State Projects Lily Raff McCaulou...........541-410-9207

REDMOND BUREAU Street address.......226N.W.Sixth St. Redmond, OR 97756 Mailing address....P.O.Box766 Redmond, OR 97756 Phone................................541-504-2336 Fax ....................................541-546-3203

CORRECTIONS The Bulletin's primary concern is that all stories areaccurate. If you knowof an error in a story,call us at541-363-0356

TO SUBSCRIBE

Home deliveryandE-Editien: One mOnth: $17 <Prinonl t y:$16)

By mail in DsschutssCounty: One month: $14.50 Bymail outside Deschutes County:Onemonth: $18 E-Editien only:Onemonth: $13 TO PLACE AN AD Classified...........................541-365-5609 Advertising fax..................541-365-5602 Other information ............. 541-362-1 Bt 1

OTHER SERVICES Photo reprints...................541-363-0356 Obituaries.........................541-617-7625 Back issues ......................541-365-5600

All Bulletinpaymentsareaccepted at the drop boxat City Hall. Checkpayments may be converted toanelectronic funds transfer.TheBulletin, USPS A552-520, ispublished daily byWestern CommunicationsInc.,1777 S.W.Chandler Ave., Bend,OR97702.Periodicalspostage paid atBend,OR.Postmaster: Send addresschangesto TheBulletin circulation depart ment,Po.Box6020,Bend,OR 97706.TheBulletin retainsownershipand copyright protection ofall staff-prepared news copy,advertising copyandnews or ad illustrations.Theymay not be reproduced withoutexplicit priorapproval.

Oregon Lottery results As listed at www.oregonlottery.org and individual lottery websites

POWERBALL The numbers drawn Wednesday night are:

critically wounded, including a boy whose liver was pierced by a knife thrust that narrow-

ly missed his heart and aorta, doctorssaid.Others also sufKeith Srakocic 1 The Associated Press fered deep abdominal punc- Alex Hribal, 16, the suspect in the multiple stabbings at the Frankture wounds. lin Regional High School in Murrysville, Ps., is escorted to a district The rampage - which magistrate to be arraigned on Wednesday in Export, Pa. Authoricame after decades in which ties say he will be prosecuted as anadult. U.S. schools geared much of their emergency planning toward mass shootings, not psychiatric examination. the freakiest part," he said. stabbings — set off a screamThe attack unfolded in the "He wasn't saying anything. ing stampede, left blood on the morning just minutes be- He didn't have any anger on floor and walls, and brought fore the start of classes at his face. It was just a blank teachers rushing to help the 1 ,200-student Franklin R e - expression." victims. gional High School, in an upAssistant Principal Sam Police shed little light on the per-middle-class area 15 miles King finally tackled the boy motive. east of Pittsburgh. and disarmed him, and a MurT he suspect, Alex H r i b It was over in about five rysville police officer who al, was taken into custody minutes, during which the boy is regularly assigned to the and treated for a minor hand ran wildly down about 200 school handcuffed him, police wound, then was brought into feet of hallway, slashing away sard. King's son told The Associcourt in shackles and a hos- with knives 8 t o 10 i nches pital gown and charged with long, police said. ated Press that his father was four counts of attempted hoNate Moore, 15, said he saw treated at a hospital, though micide and 21 counts of aggra- the boy tackle and knife a authorities said he was not vated assault. He was jailed freshman. He said he going to knifed. "He says he's OK. He's a without bail, and authorities try to break it up when the boy said he would be prosecuted got up and slashed Moore's tough cookie and sometimes as an adult. face, opening a wound that re- hides things, but I believe he's OK," Zack King said. He addAt the brief hearing, District quired 11 stitches. "It was really fast. It felt like ed: "I'm proud of him." Attorney John Peck said that after he was seized, Hribal he hit me with a wet rag beIn addition to the 22 stabbed made comments suggesting cause I felt the blood splash on or slashed, two people sufhe wanted to die. my face. It spurted up on my fered other injuries, authoriDefense attorney Patrick forehead," Moore said. ties said. The security guard, Thomassey described him as The attacker "had the same who was wounded after intera good student who got along expression on his face that vening early in the melee, was with others, and asked for a he has every day, which was not seriously hurt.

By Peter Baker and Manny Femandez

Gender pay gap —Republicans blocked a Senate bill Wednesdayaimed atnarrowingthepaygapbetween men andwomen,an election-year ritual that Democrats hope will help spur womento back them in this fall's congressional elections. GOP lawmakers said the measure could hinder employers from granting raises, or permitting flexible hours in exchangefor lower pay, for fear of costly lawsuits. For Democrats, the bill was the latest stressing income-fairness they are pushing this campaign season, a procession that includes proposals to extend jobless benefits, boost the minimum wageand help students and families afford college loans. — From wire reports

KILLEEN, Texas —

CI|ntial Omgan r

ii -, RV QIIaliIrS I

Arrayed in front of the presi-

New York Times News Service

dent were three helmets mount-

F i ve ed on rifles, three sets of boots

years after a similar visit, Pres- and three photographs, one for ident Barack Obama was back each of those shot to death by Wednesday on the same field Spc. Ivan Lopez on April 2, just in front of the same building as therewere 13 such sets five on the same Army post in the years ago. And just as he did same state, with some of the in November 2009,after Maj. same faces again grieving Nidal Malik Hasan's shooting for soldiers killed in an act of spree,Obama paid homage to senseless violence. the courage of a generation of For president and mourn- men and women who signed up ers alike, the outdoor service to protect their country only to for the victims of last week's lose their lives at home. military base rampage at Fort Gen. Ray Odierno, the Army Hood proved a haunting re- chief of staff and former compeat of the first mass shooting mander in Iraq during some of on Obama's watch, in the fall the worst of the fighting there, of 2009. The casualty toll was said death in combat was "a lighter this time and the appar- risk we can understand" as solent motives different, but the diers. "That these soldiers were anguish was no less powerful. lost on American soil at the "Part of what makes this hands of one of our own makes so painful is that we've been this tragedy heartbreaking and herebefore,"a somber Obama inexplicable," he said. told an estimated 3,000 people. The service came seven days "Thistragedy tears at wounds after Lopezkilledthree soldiers still raw from five years ago. and wounded 16 others before Once more, soldiers who sur- taking his own life, following vived foreign war zones were an argument he had with solstruck down here at h ome,

APRIE 10 - 18 SELCO 0

avetimeIndshopover AmeriCa'TO SPBPa FREE SHOW- FREEPRIZES FREE PARKINQ!

Ex~~+ Aiprll 10th - I Sth Thurs. - Sat. 9 am - 6 pm Sun. I 0 am - 5 Pm

49th Transportation Battalion. Eleven of the 19 soldiers he While base commanders killed or wounded were shot inwere still trying to determine side the battalion's administrawhy a soldier shot three of his tive office, where his argument

dress mental illness among veterans. "Today, four American soldiers are gone; four Army families are devastated," he said. "As commander in chief,

in 25 yearsthe Central OregonRVDealers havecome a Iong way inbringing youthe RVsyou want. Come seethenew 20I5sw ith new technologyand new floor plans. ManufacturerRepsat show!

diers from his unit about their

not in word or talk, but in deed and in truth."

comrades and then himself,

g . wry't7i.'

CotuMUNITV CREDIT UNION

where they're supposed to be handling of his request for safe. We still do not yet know leave. exactly why. But we do know Many of Lopez's victims this. We must honor their lives were soldiers in his unit, the

over his leave request began. Collectively, the three sol-

years of service in the Army. Sgt. 1st Class Daniel Ferguson served nearly 21 years and was engaged tobe married. Staff I'm determined we will contin- Sgt. Carlos Lazaney-Rodriguez ueto step up our efforts toreach was months away from retiring our troops and veterans who after 20 years. Sgt. Timothyare hurting, to deliver to them Owens joined the service after the care that they need and to the start of the wars in Afghanmake sure we never stigmatize istan and Iraq, knowing he those that have the courage to could be sent into combat.

The estimated jackpot is now $1 million.

Flight 370 —Planes and ships hunting for the missing Malaysian jetliner zeroed in on a targeted patch of the Indian Ocean on Thursday, after a Navy ship picked up underwater signals that are consistent with a plane's black box. Today's search zonewasthe smallest yet in the monthlong search for Flight 370 — 22,364 square miles of ocean — andcomes aday after the Australian official in charge of the search expressed hopethat crews were closing in on the "final resting place" of the vanished jet.

seek help."

The estimated jackpot is now $94 million.

10Q 12Q 13Q 18Q 29Q 31 Q

ReSCue at Sea —Six days after a family of four found themselves helpless andadrift in a sailboat far into the Pacific with a vomiting, feverish1-year-old, a Navywarship delivered them safely Wednesday to SanDiego, where they began their attempted aroundthe-world voyage before the child was born. TheRebel Heart, the 36-foot sailboat that had been their home for seven years, is at the bottom of the ocean900 miles off Mexico, sunk by rescuers because it was taking on water after losing its steering and most of its communications. A satellite phone ping from the boat last weekset off a huge rescue effort that involved skydiving National Guardsmen, three federal agencies, a plane, a frigate and scores of personnel.

•

offers comfort to troops at Fort Hood

Qsg4QeeQ mQ 4s The numbers drawn Wednesday night are:

Day-Care CraSh —A car smashed into an Orlando-area daycare Wednesday, killing a girl and injuring 14 others, at least a dozenof them children, and authorities were searching for the driver of an SUV who they saystarted the crash, officials said. A Toyota Solara convertible went out of control after it was struck by aDodge Durango, jumped a curb andsmashed into the day care, breaking through the wall and into the building, said Florida Highway Patrol spokesman WandaDiaz. Theconvertible driver was not hurt. The Durango left the scene but was located almost two hours later after it had been abandoned. Officials said the driver is being sought.

Once again,Obama

Obamavowed to do more to ad-

MEGABUCKS

PeaCe talkS —In an unusually pointed rebuke of an ally, the United States, Israel said Wednesdaythat it was "deeply disappointed" by U.S. Secretary of State John Kerry's remarks a dayearlier that appeared to lay primary blame on Israel for the crisis in the U.S.-brokered Middle East peacetalks. The Israeli-Palestinian dispute that has brought the talks to the brink of collapse appeared to bedeveloping into an open row between Israel and the United States, even as Israeli and Palestinian negotiators were said to be planning a third meeting this week with U.S. mediators to try to resolve the crisis.

diers who were killed had 50

Free Show - Free Prizes

BIQQKST IVSHSW Ct. z O RVSMAIUNE The Bulletin ®kbn Z serving central oregon since 19ts

Z d l o m e dia beseen getheard.

THURSDAY, APRIL 10, 2014 • THE BULLETIN

TART TODAY

• Discoveries, breakthroughs,trends, namesin the news— the things you needto know to start out your day

It's Thursday, April10, the 100th day of 2014. Thereare 265 days left in the year.

HAPPENINGS IRS scandal — AHouse committee will vote on whether to hold former IRSemployee Lois Lerner in contempt after she refused to testify about investigations into conservative organizations' tax-exempt status.

POWer grid — TheSenate Energy committee will hold a hearing on electric grid security.

HISTORY Highlight:In1864, during the Civil War, Dr. Mary Edwards Walker, an assistant surgeon for the 52nd OhioVolunteers, was captured by theConfederates and accused of being a Union spy; shewas held until her release in August1864 as part of a prisoner exchange. (Walker received the Medal of Honor in 1865, the only woman to date so recognized; although the citation was withdrawn in1917,Walker continued to wear themedal until her death in1919. President Jimmy Carter restored the citation in1977.) In1790, President George Washington signed the first United States Patent Act. In1864, Maximilian, archduke of Austria, was proclaimed emperor of Mexico. In1866,the American Society for the Prevention of Cruelty to Animals was incorporated. In1912, the RMSTitanic set sail from Southampton, England, on its ill-fated maiden voyage. In1925, the novel "TheGreat Gatsby," by EScott Fitzgerald, was first published. In1932, German president Paul Von Hindenburg was re-elected in a runoff, with Adolf Hitler coming in second. In1947, Brooklyn Dodgers president Branch Rickey purchased the contract of Jackie Robinson from the Montreal Royals. In1953, the 3-D horror movie "House of Wax," produced by Warner Bros. andstarring Vincent Price, premiered in New York. In1963,the fast-attack nuclear submarine USSThresher (SSN-593) sank during deep-diving tests east of Cape Cod, Mass., in a disaster that claimed 129 lives. In1974, Golda Meir told party leaders shewas resigning as prime minister of Israel. In1998,the Northern Ireland peace talks concluded asnegotiators reached alandmark settlement to end 30years of bitter rivalries and bloody attacks. In2010, Polish President LechKaczynski,60,waskilled in a plane crash in western Russia that also claimed the lives of his wife and top Polish political, military and church officials. Ten years age: TheWhite House declassified and released a document sent to President George W.Bush before the September11 attacks which cited recent intelligence concerning a possible al-Qaida plot to strike inside the United States. Five years age: Police in Tracy, Calif., arrested Sunday school teacher Melissa Huckaby in connection with the death of 8-year-old SandraCantu, whose body hadbeenfound in a suitcase. (Huckabyeventually pleaded guilty to kidnapping and murdering her daughter's playmate; shewassentenced to life without parole.) One year age: President Barack Obamaproposed a $3.8 trillion budget that would raise taxes on smokers and wealthy Americans andtrim Social Security benefits for millions.

BIRTHDAYS Actor Max vonSydowis 85. Actor OmarSharif is 82. Sportscaster John Maddenis 78. Actor StevenSeagal is 63. Actor Peter MacNicol is 60. Olympic gold medalspeedskater Cathy Turner is 52. — From wire reports

PHENOMENON

RESEARCH

Want people to think you're smarter?Smile

aaman er's e roe in o m e rican oress

By Christopher Ingraham

identify smart women. Researchers s u r mised New research offers good that judging women on their news and bad news for the intelligence — rather than homely among us. First, the their attractiveness — may good news: People can't tell just not be something peohow smart you are by how plepracticevery much: "The good you look. The bad strong halo effect of attracnews'? They think they can. tivenessmay thus prevent an As reported last month accurate assessment of the in the journal Plos One, re- intelligence of women." searchers had 40 men and But it gets weirder: When 40 women take a standard researchers compared the intelligence test. Then they a ttractiveness ratings f o r photographed the subject's various subjects with their faces, instructing them "to IQ scores, they found no adopt a neutral, non-smiling relationship wha t s oever. expression and avoid facial This suggests that there is cosmetics, jewelry, and other absolutely no c onnection decorations." between brains and beauNext, 160 strangers re- ty. But assumptions about a viewed the p hotographs. person's intelligence seem be Half of the reviewers rated basedlargely on stereotypes the photos according to how related, at least in part, to noThe Washington Post

Small but prolific predators, salamanders affect the ecosystem of a forest and collectively could help stave off climate disaster. By Richard Conniff New York Times News Service

If someone asked you to name the top predator in North American forests, you might thinkofbears,orm aybe great horned owls. But here's another

-0 » •

/ )

' p •

O g

answer to think about: wood-

i'l.,

•

'< e

land salamanders. These skittish, slippery amphibians literally live under a rock, or a log, or any convenient dark and damp forest habitat. As apex predators go, they are mainly small, a few inches long and weighing well under an

' •

1 •

•

•'

,•'

a•

•

ounce.

-s

smart the subjects looked,

Todd W.Pierson I University of Georgia via New York Times News Service

But they are hugely abun- A black-chinned red salamander, pseudotriton ruber schencki, dant — and very hungry. On from the Appalachian Trail. On an average day, a salamander eats an average day, a salamander 20 ants, two fly or beetle larvae, one adult beetle and half of an eats 20 ants of all sizes, two fly insect called the springtail — almost all "shredding invertebrates" orbeetle larvae, one adultbeetle and half of an insect called the

jects'at tractiveness. The researchers found a strong relationship be-

tween how attractive people

energycycle. Shahid Naeem, an ecologist

salamanders there were more

perhaps farbeyond. According to a new study in

about 13 percent more of the leaf litter. Almost half of that

and dimate scientist at Co-

thejournalEtx1sphere, salamanders play a signiTicant role in the

lost weight was carbon, re-

"temperature, rain and other

shredders, and they consumed

lumbia University, agreed that

nonbiological factors probably "It's more than just a curious explain more about the carbon global carbon cyde. If flatulent cattle are among the black hats phenomenon," Welsh said. "It's cyde than salamanders." of dimate change (the livestock real." But he added: 'What's nice industry emits 14.5 percent of The authors calculate that about the study is the elegant human-associated greenhouse woodland salamanders at the quantification of how a change gases), then salamanders may density in their study would in a food web has consequencjust be the white hats, helping to send 179 pounds of carbon per es — something a lot of people stave off dimate disaster. If no acre of forest down into the know when it comes to the big, onehas noticedthisbefore, well, soil, rather than up into the at- visible species, but not when it this is how it goes when you live mosphere. Extrapolated to the comes to the smaller, less visunder arock. huge numbers of woodland ible, ones. Lose the salamansalamanders and other preda- ders, and there are effects that Salamanders'roie tors working in the leaf litter of ripple throughthe system." The study — by Hartwell forests around the world, that is The notion of losing someWelsh, a herpetologist at the enough to affect global dimate. thing as abundant as salamanU.S. Forest Service's research ders is not all that far-fetched. leased into the atmosphere.

'Vacuum cleaners'

A nother new study, in

But the connection be-

trients in their own bodies, or in

gence was much less clear. Indeed, there was a significant gender gap: Reviewers did pretty well at guessing the actual intelligence of men, but they were com-

pletely lost when trying to

til it can be captured by the soil, the form of abundant offspring. aprocess called humiT1cation. This low-key lifestyle makes At least in theory, having them the hidden masters of the m ore salamanders in a forest forest — "the vacuum cleaners should mean fewer shredding oftheforestfloor,"asM aerzput it.

Europeari Car Care

sive chin and a smallish nose characterizes the prediction of low-intelligence."

924 wllso", s"'te F On the corner of sridgeford & Iviison

VW • BMW

& some domestics Come check out our new location and let us quote your next service.

55 years — about 1 percent per

European Car Care 924 Wilson, Suite F, Bend

generation. That is "one of the largest and fastest rates of change ever

On the corner of Bridgeford 8t Wilson

safely locked underground. But he and the Ecosphere recorded in any animal," Lips The researchers tested this the- authors do not entirely agree sald. ory in a forest in northwestern

and broader face with a mas-

We specialize in European makes: Audi • Mercedes • Porsche

showed that salamanders had shrunk insize by 8 percentin

541-508-5238

about what that means for

California, laying out a series the larger significance of of 16-squarefoot enclosures, salamanders. like containers for raised-bed

Maerz thinks the effect on

gardens. the carbon cyde may apply in Some of the endosures had wet conditions, but not when salamanders, others

d i dn't. t he weather is too dr y f o r

openings, s o

i n v e rtebrates strated that stable isotopes of

could move freely back and carbonand nitrogen in leaves forth, but the salamanders had end up, via shredding inverteto remain in their enclosures.

brates, stored away in the flesh

The presence of salamanders resulted in a significant decrease in shredders: fly and beetle larvae, adult beetles and springtails. In the plots with no

of salammders — like"a standing crop of nutrients," he said.

' I

Each endosure was joined to humification. its neighbors by low, screened His own studies have demon•

•

••

''•I

•

' '

•

•'

ON-LINE BIDING STARTS APRIL 6 AT 9 A.M.

www.BulletinBidnBuy.com

fers to think of them simply as a dominant driver of the forest

Call Jerry Gilmaur (NMLs¹124521 ) 17 years reverse mortgage experience In person, professional consultation

. t, ! ,i

VOU CAIU BID OIU:

I I

Lot 22 in the Yarrow Community Located in Madras Rahril @lue@B,QS *60% Reserve

p~ 1SriBametteValleysank HOME LOAN DIVISION

541-382-4189

•

But dimate heroes'? Maerz pre-

Low Cost Reverse Mortgage

stereotype of h igh-intelligence, while a rather oval

IS MOVING TO BEND!

the

see to Maryland. Their results

a c tual i n t elli- and a larger prolonged nose characterizes the predicted

gence and

Another factor is that many journal Global Change Biolsalamanders have no lungs. ogy, compares present-day About 70 percent of all sala- salamanders with some of the mandersbelongto a single fam- 180,000 specimens collected ily, the Plethodontidae, which across the United States by in effect breathe through their herpetologist Richard Highton, skin. now retired from the University them. The process requires much of Maryland. Highton, who beLeaf litter from deciduous less energy than breathing with gan collecting in 1957, thought trees is on average 47.5 per- lungs, enabling salammders he saw a decrease in salamancent carbon, which tends to be to "be really small and exploit der size and abundance beginreleased into the atmosphere, really tiny things that are not ning about 1980. along with methane, when the calorically sufficient for birds When Karen Lips, an amshredding invertebrates shred or mammals," said John Maerz, phibian specialist, came to the and eat them. a salamander specialist at the University of Maryland a few If there aren't as many shred- University of Georgia who was yearsago, she decided to folders at work and the leaves re- not involved in the Ecosphere low up that hunch. She and main in place, uneaten, they are study. While humans, withtheir colleagues revisited many of covered by other leaves, "like relentless metabolism, burn Highton's research sites, conbeingtrapped under a wet blan- off most of what they eat, sala- centrating on r elatively unket," as Welsh put it. The anaer- mandersstore large amounts of changed habitat in national obic environment under those carbon, nitrogen and other nu- parks and forests from Tennes-

In both sexes, a n a rrower face with a thinner chin

tween perceived i ntelli-

chaelBest, nowat the College of the Redwoods in Eureka, Calif. — notes that salamanders' prey consists almost entirely of "shredding invertebrates," bugs that spend their lives ripping leaves to little bits and eating

invertebratesand more carbon

for both men and women,

using the photographs reviewers had rated by level of thought a person was and intelligence. "Our data suggest that a assumptions about their intelligence: The higher the at- clear mental image (of) how tractiveness rating, the high- a smart face should look er the rating for smarts. This does exist for both men and relationship was particularly women within the commustrong when the subjects nity of human raters," the were female. researchers concluded.

that, left unchecked, would be chomping down on leaves.

collectively affect the entire course oflife inthe forest — and

layers preserves the carbon un-

the researchers constructed "intelligence stereotypes"

them according to the sub-

springtail. And in doing so, they

station in Arcata, Calif., and Mi-

tions of attractiveness. To probe this idea further,

while the other half rated

' I

I I

TH E BULLETIN• THURSDAY, APRIL 10, 2014

Medicare

tions about his Medicare bills were unjustified.

"Just looking at the sheer Continued fromA1 Topping the list is Dr. Salo- volume of work and billings mon Melgen,59, an ophthal- from single physician is not a mologist from North Palm sign of wrongdoing," Qamar Beach, Fla., wh o r e ceived said, noting that his practice $21 million in Medicare re- handles cardiac procedures imbursements in 2012 alone. in its outpatient clinics that The doctor billed a bulk of his would be done inside a hosreimbursements for Lucen- pital in m any o ther states, tis, a medication used to treat which he said explained the macular degeneration made large billable amounts. by a company that pays genThe state of Florida was erous rebates to its doctors. home to many of the physiMelgen's fir m d o nated cians who received the largmore than $700,000 to Ma- est payments, 28 out of the jority PAC, a super PAC run t op 100. California, with a by former aides to the Senate much larger population, was majority leader, Harry Reid, second, with 10 of the top 100. D-Nev. The super PAC then Doctors in Florida have spent $600,000 to help re- been frequent targets of electSen. Robert Menendez, Medicare fraud i nvestigaD-N.J., a close friend of Mel- tions, based on i r regular gen's. Last year, Menendez patterns of bills or extremely himself became a target of in- high bills. vestigation after the senator Qamar has sent more than intervened on behalf of Mel-

gen with federal officials and took flights on his private jet. A nother physician, D r . Asad Qamar, an interventional cardiologist in Ocala,

$100,000 to th e D e mocratic National Committee and

other state-based branches of the Democratic Party, and has donated to Obama's

Fla., has sent at least $250,000

presidential campaigns and groups with ties to Obama,

in donations over the past

federal records show. He has

decade to the political cam-

also made donations to congressional candidates — al-

paigns of President Barack Obama and other prominent

most all of them Democrats

Democrats; he has become

— from Nevada, Pennsylva-

the target of scrutiny related

nia, Indiana, Iowa and Flor-

to cardiovascular treatment ida, among other states, the centers he runs i n C entral records show. Florida. The political donations, QaQamar was paid more than mar said, are unrelated to the

$18 million in 2012, making Medicare scrutiny, but he achim and Melgen by far the knowledged he had reached largest payment recipients out to lawmakers in Congress n ationwide, a c cording t o to persuade the federal govthe data. A pathologist from ernment to back down. "The auditors put an asNew Jersey received the third-largest Medicare reimtronomical burden on us, in bursement, $12.6 million. terms of manpower," he said. In an i nterview Wednes- "I would just hope there is day, Qamar said any ques- some end to it."

Bend

"It didn't take much to say, let's just put the two groups

Continued fromA1 Two years ago, an Engineer-

(back) together," Arnis said, referring to the creation of the

ing and Infrastructure Plan-

Growth and Management De-

Somepuestionsonthe Medicare data What data did Medicare • just publish? • For the first time, • Medicare has released information about how much individual doctors billed the program, how muchMedicare paid the doctors and the total number of treatments the doctors provided. Thedata release covers $77 billion In payments to 880,000 health-care professional across the country in 2012 for just Medicare Part B, which covers outpatient services like lab tests, surgeries and office visits. The dataexclude providers who sawfewer than11 Medicare patients, and individual patient information wasn't released.

What kind of doctors . appearonthelist? . Ophthalmologists, • oncologists and pathologists were amongthe specialties ranking highest on Medicare's billing list. The high tallies don't necessarily represent what a doctor is pocketing for high-cost services for some procedures, a major chunk of the Medicare dollars could be going toward equipment, drugs, support personnel and other overhead costs. Doctors billing more than $3 million, however, deserve someextra scrutiny, the Health and HumanServices inspector general concluded last December. The services the doctors choose matter. For example, previous evidence showsthat ophthalmologists were more likely to choose adrug costing $2,000 per injection over a$50 drug because it wasbetter for

Q•

against Dzhokhar Tsarnaev. The report was produced

Continued fromA1 by the inspector general for "They found that the Rus- the Office of Intelligence sians did not provide all Community, which has rethe information that t h ey sponsibility for 17 separate had on him back then, and agencies, and the inspectors based on everything that general from the Departwas available the FBI did all ment of Homeland Securithat it could," said a senior ty, the Justice Department U.S. official briefed on the

and the CIA. It has not been

review.

made public, but members of Congress are scheduled

Tsarnaev, who was killed attempting to elude the police, and his brother, Dz-

hokhar, are believed to be

to be briefed on it Thursday,

and some of its findings are expected to be released be-

fore Tuesday, the anniversatack, which killed three peo- ry of the bombings. ple and injured more than I ts c ontents w er e d e 200 near the marathon's fin- scribed by several senior ish line. U.S. officials who spoke on The Justice Department the condition of anonymity said in January that it would because the report has not seek the death penalty been publicly released. the sole suspects in the at-

filed suit in district court alleging that the agency did not

Continued fromA1

have the authorityto issue the

"In many states there are

regulations. regulations of massages. The The courts have agreed. massage part of what that In February, the U.S. District person does is subject to test- Court of Appeals affirmed a ing and hygiene visits. But the 2013 ruling that the IRS does preparing of taxes? There's not have the power to license no regulation." tax preparers. Out of 79 million individual Dan Alban, an attorney tax returns prepared by pro- with the Institute for Justice, fessionals in 2011, more than a libertarian public-interest half were completed by un- law firm, has argued that the regulated tax preparers, ac- rules would favor big comcording to Internal Revenue panies such as H&R Block Service records. while putting small tax preThesetax professionalsare parers out of business. He not licensed lawyers or ac- also thinks the root problem

their bottom line. do doctors feel Q •• How about this? • Not so great. The Ameri. can Medical Association, the largest physician lobbying group, had strongly fought against the disclosure in court. The AMAsaid it's worried that the public will draw thewrong conclusions about doctors based on thedata, potentially "ruining careers." Doctors Wednesdaymorning disputed their inclusion on the list. SomesaIdthey are the single namefor billing for an entire practice, so they're not solely responsible for the amounts listed bytheCenters for Medicare andMedicaid Services. Others contacted byThe Washington Post said that CMS provided inaccurate data.

countants. Rather, it turns out that anyone — with no need for a license or particular deturns and then start doing it.

"A lot of people think a tax

an attorney with the National

Consumer Law Center. "My middle-school-aged son could set up a card table and prepare taxes. There's nothing to stop him."

While many of these tax preparers have been making an honest living for years, others are frequently making errors, charging exorbitant fees or committing outright fraud. And victims tend to

be those with lower incomes, especially people who rely heavily on benefits such as the earned-income tax credit and who typically would not need to file or who should be filing simple returns. Of the more than 27 million

taxpayers who claimed the

2013.

tax credit in 2011, 59 percent relied on apreparer to do their

— TIie WashingtonPost

mission is to i n troduce the on the League of Oregon Cities out how we wanna grow and

Public Works Department at

antine tax code. "The sheer ficult to prepare tax returns without any errors," Alban

a ccountant said Tuesday at a hearing on or someone who has special the matter before the Senate training, but that's not neces- Finance Committee. sarily true," said Chi Chi Wu, Sen. Ron Wyden, D-Ore.,

• More transparency is . alwaysagoodthing, especially in ahealth-care industry that doesn't seem tohave enough of it. Fromthis data, patients will havemore information about doctors' experience with proceduresthough not the total picture, sincethenewdata do not include private Insurance or other government programs. For journalists andresearchers, it may beeasIer to detect billing patterns andpotentially identify wasteandabusein Medicare. Andthere's a lot of that. Improper paymentsaccounted for about$29.6 billion of $350 billion in payments Medicare madefor services in

website. The department will officially separate from the

parers but the country's byz-

preparer is a n

What will this datatell Q •• Us?

public to different ways we can work together to figure

is not the skill of the tax pre-

gree — can announce that complexity of the federal tax he or she is preparing tax re- code makes it notoriously dif-

start introducing all these new the beginning of the new fiscal ning Department was imple- partment. "We're doing the methods and practices to the year on July 1. "One person i n P u blic mented to handle capital im- same work and it gets better community." According to Paul Rheault, Works can't represent the provement projects and master response out to the public. It planning with then-Assistant just seemed to make a lot of Bend'spublic works director, whole community," Rheault Public Works Director Tom sense." the Transportation Services said. "We're geographicalHickmann named as director. Arnis said the department's Department will focus more ly spread out, with facilities Nick Ar nis, formerly t he short-term goals involve pub- on Bend's streets. He said spread out over 32 milescity's transportation engineer- lic outreach and working with there are no additional costs some outside city limits. We ing manager, will become the the community to figure out associated with creating the feel the timing is right now to director of the Growth and the best way to handle Bend's new department because the separate into two departments Management D e partment. growth spike. city didn't hire another assis- (and) we'll be better served by Arnis said that a similar de"We took this general plan tant public works director af- having a director that can solepartment was in place seven 10 years ago and the city just ter Hickmann was promoted. ly focus on transport and fleet to eight years ago, but this kind of stopped it and then The salary for the transporta- needs of the city." time around it will be more (the population) grew really tion director is listed between — Reporter: 541-633-2117, organized. quickly," he said. "Part of our $96,000 and nearly $125,000 mwarnerlbendbulletin.com

Intel

Taxes

the committee chairman, was

sympathetic to that argument but said that people should nonetheless be able to find tax

preparers they can rely on. "As long as the U.S. tax code is so overgrown and complicated that most Amer-

icans have to seek out help to file, they shouldn't have

to worry about crooked or incompetent tax preparers," Wyden said a t

' I l i esday's

hearing. Instead of regulating, the government has turned to

prosecuting. In a recent case against Instant Tax Service, once the fourth-largest tax

preparation business in the United States, prosecutors alleged that the company preparedphony W-2s,falsely claimed education and child

taxes, for an average credit credits that customers were of $2,270, according to data not qualified for, reported made-up income figures and from the IRS. The IRS has tried to regu- even filed returns without the late the tax preparation busi- permission of the taxpayer. ness by proposing rules that The alleged behavior was so would force tax preparers egregious that a federal judge to be licensed and certified. ordered the company to shut In 2012, three tax preparers down immediately.

Lanning

keta has not told us," Abernethy sald.

Continued fromA1 "We could have gone out

While Lanningnever indicated he was on leave during the

again now, and done an earnest search,and tried to have some-

recruitment process,Paradis

did not feel that would serve the

leave. However, Abernethy not-

' ;.-~:~ + w'

does not know if Lanning was one," Abernethy said. "But we ever directly asked if he was on campus well. We really needed ed Lanning was asked if there a breather." was anything in his past that COCC's spokesman Ron could be an embarrassment Paradis said the school learned to the college, to which he rethe week of March 17 that Lan- sponded in the negative. "This has been a very diffining was on a dministrative leave. Paradis could not specify cult last couple of weeks," Abwhich day the school learned ernethy said. "Obviously this this. Paradis also said COCC is

is not the news we wanted. I

not aware of why Lanningis on feel at this point we have made leave but is aware that Cheme- the right decision about movketa is conducting an investiga- ing forward and that we have tion into Lanning. been fair in our treatment of Dr. "We do not know the specif- Lanning." ics of the investigation, its time-

— Reporter: 541-633-2160, tleeds@bendbulletin.com

line, or anything else. Cheme-

"It'S a Spring Thing".

; SSoFF $2S ., g *Valid through 4/20/14 on

g g g g g g

in-store purchases at the Bend WBU. ne O discountper purchase. Offer not valid on previous purchases, sale items, gift cards, or Daily Savings ClubQjg memberships. a mm

I I

->- g > <

wemima I

m m m m m a m m m m m m m m m m m m e

Forum Center, Bend (541)617-8840 www.wbu.com/bend BIRDFOOD • FEEDERS •GARDEN ACCENTS • UNIQUE GIFTS

...Patio Living soon begins!

Clearance 2013 Patio Sets

1/2 Price Additional discount on orders of 2014 Patio Sets

BBQ Islands 1/2 Price

Patio World Z22 SE Reed Market Road - Bend 541-388-0022 PatioWorldBend.coe hhori-Sat 9:30-5:30 S u r i 10-5

THURSDAY, APRIL 10, 2014 • THE BULLETIN

In Eastern U raine, t e 'i ea' o acountr, ut itteese By Andrew Higgins New York Times News Service

DONETSK, Ukraine — Nikolai Solntsev, the self-de-

Principal

"Dave understands and em- Perdue said. "What a wonderbraces change and uses it to pro- ful opportunity to make a difContinued from A1 mote ~ " s a id Mclntosh. ference in ways we never did For the rest of the school Never having taught or before." With the move to Alpine, year, a retired Redmond been an administrator at an district administrator, Tim elementary school, Perdue Perdue is once again replacing Gleeson, will lead Tuck. was replacing longtime Tuck a principal who had to leave "I almost got rid of all Principal Linda Seeberg, who before year's end and, except my ties this year, thinking I was moving on to Redmond's for the abrupt departure from didn't need them anymore,"

newest elementary at the time,

Gleeson joked at the farewell party. "I was just too

McCall, and taking a sizable that. number ofteachersfrom Tuck The butterflies are back. "I'm really excited about this withher. "I was excited to think about change, the new opportunithe future, about whether I ties," he said. was equal to the job," Perdue Perdue's former mentor, recalled. "I had butterflies be- Purple, sees Perdue's profound cause I knew I'd have to prove dedication to family and his myself and I was following faith as an integral part of his a bundle of energy — Linda role as school leader. "Dave has very little ego; he is so outgoing and I'm more reserved — but from the be- sees himself as a servant and ginning I was going to be who has an almost missionary viI am." His first week at Tuck sion of what a school can be," Perdue and his wife repainted Purple said. "He doesn't spend Seeberg's lavenderoffice. a lot of timing pining for what "I admitted to the staff that could be or what was. His deI was green about elementa- parture is a loss not just for the ries but I knew how to support district but for the community." teachers and give them the At the assembly, first-gradtools they need to be success- ers sang a song written for ful, and I think I earned re- Perdue, telling him "in our spect when they saw I had their school and in our hearts you'll backs," he said. always have a home." A girl When Perdue took over as presented him a painting of a principal, Tuck was also un- bird leaving a nest, saying that dergoing tremendous change. is Perdue. Teacher Joe SwanNot only did it have a mostly son'sfifth-gradersperformed a new staff ,butboundary chang- popular song with customized es caused the student popula- lyrics and intricate cup-andtion at Tuck to go from about clapping percussion. "We're gonna miss you 25 percent of kids qualified for free and reduced lunch to when you're gone," they sang. By day's end, Perdue and about 65 percent. "We welcomed that — not his wife are in a m oving that we wanted more needy truck, heading east to a new students, but I believe in ac- adventure. cepting the reality you're giv— Reporter: 541-548-2186, en and not making excuses," lpugmire@bendbulletin.com

lazy — and now see what

happens." During Perdue's tenure at Redmond High, where he started as a language arts teacher in 1987, change

claredcommissar ofthe Eastern Front and a founding father of the newly proclaimed Donetsk People's Republic, has been waiting 22 years, three months and 14 days for this moment.

was a constant. The school

lost population when Sisters High opened, then gained

That is the time the former

all that back and more as

submariner in the Soviet navy has had to endure since the

the community grew. It built its first addition but failed to pass two bond measures de-

Soviet Union collapsed, leav-

ing him without a country he felt at home in and could serve Mauricio Lima/New YorkTimes NewsService with pride. A supporter of pro-Russian protesters donates money Wednesday

Soviet ties

ulation swelled and eventuadd a veritable campus of 10

"The Soviet Union does not exist, but my oath of service remains. I never took an oath to Ukraine," Solntsev said,

portable dassrooms dubbed Camp Redmond.

government building within functioning services — is "the 48 hours, either through nego- idea" of a country that "speaks explaining why he feels no tiation or force. Even officials for the people." In the case of loyalty to the country where in the Party of Regions, the Donetsk, Solntsev said, this he lives but is ready to serve former ruling party of ousted means for Russian speakers, an imaginary new nation that President Viktor Yanukovych, who he said felt like unwantnobody, not even Russia, rec- denouncedthe seizure ofoffi- ed aliens in a nation that has ognizes. The Donetsk People's cial premises and called on the been dominated by Ukrainian Republic has no authority protesters to end their occupa- speakers from the west since outside an 11-story Ukrainian tion and accept that Donetsk is the ouster of Yanukovych, a government building that an part of Ukraine. Donetsk native, in February. unruly Ru s sian-speaking, T he cluster o f fri n ge While only 4.7 percent of loclub-bearing crowd has occu- pro-Russia political outfits be- cal residents want a separate pied since Sunday. It also has hind the Donetsk People's Re- Donetsk state, just over a third no electricity: The authori- public, which the authorities in like to identify themselves as ties cut that off as soon as the Kiev denounce as a local pow- "citizens of Ukraine." More "Russian-speaking People's Republic declared its er grab instigated by Moscow, prefer existence. disagree on their final goal. residents of Ukraine" or "resIt is a quixotic and, to many They cannot decide whether idents of the Donets Basin," here, crackpot project, but one to push to join Russia, to give according to a survey released that feeds on a deep pool of substance to their chimerical Wednesday by the Donetsk resentment and fear that ex- stateor to secure more au- Institute for Social Research tends beyond the few hundred tonomy for the region within and Political Analysis. people now holed up in the Ukraine. Igor Koval, th e a cting government building. But the People's Republic chairman of the Donetsk reNobody really expects the does now have a 12-member gional council, complained People's Republic, a revival of governing council, w hich that the protesters occupying the short-lived Donetsk Re- meets on the 11th floor, Solnt- the administration building public set up amid the chaos sev said. That space was pre- had made it impossible for that followed Russia's 1917 viously occupied by Donetsk's him to do any work because Communist revolution, to last Kiev-appointed governor, the they would not let him into more than a few days. billionaire m etals m a gnate the council chamber on the But the rifts rooted in lanSergei Taruta, who now holds 10th floor. They should leave, Koval said. But he added that guage, culture, politics and his meetings in a local hotel. economics that created itWith the power cut off in the he understood and shared and that have dogged Ukraine occupied government block, their anger at "being treated since its independence in 1991 the elevators no longer work, like second-class citizens" — show little sign of fading. requiring the portly Solntsev by a n ational government Nor do the tensions created and his comrades — who in- that "does not listen to or unby the struggle in Donetsk, clude two newly appointed derstand the problems of the about 45 miles from the border ministers, one for foreign af- east." with Russia. Late Wednesday, fairsand one forsecurity — to The government installed a group ofprotesters blocked climb the stairs past masked after Yanukovych fled the the exit of a Ukrainian mili-

signed to relieve overcrowding. The school's Latinopopally the school was forced to

at a fortified barrier outside the regional government building that was seized by the protesters in Donetsk, Ukraine.

men armed with metal rods

capital on Feb. 21 ended the

tarysit e here and forced bus- and wooden clubs. Solntsev dominance of Russian-speakes carrying troops to go back said he could not remember ing politicians from the east of inside. either minister's name. the country — most of whom Solntsev a c k nowledged had opposed the pro-Europe that the People's Republic, de- A national identity protests in Kiev that toppled clared Monday, faced anuphill F ar more i m p ortant, h e Yanukovych — and shifted struggle. On Wednesday, the said, than the conventional power sharply to Ukrainian Ukrainian government vowed trappings of statehood — de- speakers from western and to end the occupation of the tails like territory, laws and central regions.

Joining the administration team in 1992 was a

tough transition for Perdue, who missed being in the classroom every day. "I went from being a teacher most kids liked to

being the disciplinarian and for my first five years as a

a d m inistrator t hat

was my role: the guy in the black hat," he said. He tried not to take animosity from

parents and kids personally and kept focused on the goal: helping kids realize their full potential. In later years Perdue

Redmond, Perdue is OK with

was the assistant principal

in charge of curriculum, working under Principal Dan Purple, whom he cred-

its with great leadership. "Those were great years, we had a very strong administrative team and the kids could sense our dedication. I think i t p u shed

them to dig a little deeper," Perdue said.

"Dave is a very caring person; as a teacher you could go to him with any issue and he was calm and consistent," Redmond High teacher Rebecca Barrett

recalled. "He has a unique ability to step back and

Awbrey Glen Golf Club

manage the situation, he's

such a quiet, collected kind of guy." When Purple retired in

2005 many people — includi,ng Perdue — assumed that as assistant principal

Your Journey Begins Here.

he would step into the leadership role. So when an

Enroll as a Journey Golf Member by May j. for early season discounts!

outside administrator was

Experience our Lcaming Center and new perspectives.

hired instead and Perdue was offered the principal job at 'Ihck, he quickly decided it was time for a change.

541-385-6011 ( barbatagawbmyglen.com

vvww.ambreyglen.com

• I

•

• ®y

•

WEEKLV CIIFT

Neen) i • r

APRIL 20th 10am- Noon Easter Bunnyvisit, •

I g

•

~ ~ • I

sas l

•

$16.M

$8.50 CHISREN I5-I3 PlayerS'Club CardRIIIWI.

I I

• •

•

HARE

•

y lii

III

)II • •

•

• )

• •

j •

• • l

TH E BULLETIN• THURSDAY, APRIL 10, 2014

TODAY'S READ:SOUTHERN CALIFORNIA BANK ROBBERIES

ere i a By Victoria Kim

e cIA I

to cash and tellers. Convicted walks away empty-handed. bank robberies than the next robbers are also getting heftier The sums from traditional LOS ANGELES — For de- four regions — New York, San sentences, largely because of robberies seem particularly cades, Southern California Francisco, Portland, and Sac- firearm enhancements as well paltry compared to the loot in was the undisputed capital of ramento— combined. as California's three-strikes the growing number of cyber "I was flabbergasted when law. Under federal law, each heists, in which hackers swipe bank robbery. When five Bank of Amerwe broke 400. Then we broke count of bank robbery carries millions on their keyboards ica branches were robbed in 300," said special agent Ste- a statutory maximum of 20 without ever setting foot in a under an hour, an FBI agent phen May, the bureau's bank years, and 25 years for armed bank. shrugged and called it "just robbery coordinator in Los robbery. That doesn't mean people another day in L .A." It w as Angeles. Considering the reLengthy prison terms mean don't keep trying. The cast of fodder for national news and gion's 19 million people and fewer career robbers like characters who robbed SouthHollywood scripts, and the FBI 4,500 financial institutions, the William Vance Turner, who ern California banks in 2013 field office had "Bank Robbery per capita rate of bank robber- robbed his first bank in 1981 induded thieves authorities Capital of the World" embla- ies is even lower, May said. and later served prison time nicknamed the Button-down zoned on its fax cover sheets. for aseries of robberies in the Bandit, the New Hat Bandits, Explaining the decline '90s, earning him the nick- the Purse Packing Bandit and In 1992, the worst year, as many as 28 Los Angeles banks Just as authorities strug- name the Pershing Square the Boom Boom Bandit — a were robbed in a single day. gled to explain the sharp rise Bandit. Barely a year after his man so named for showing the Then the number of r obin the 1980s and 1990s — The release, he was back to holding teller what looks like a homeberies began falling, part of vast network of freeways'? The up banks — this time wearing made explosive and a note: an overall trend that has seen booming population and num- a hat that got him dubbed the "No drama, no boom boom." crime rates plummet across ber of banks? Availability of Goofy Hat Bandit. In 2009, he In one case, an assistant the country. weapons on the streets in the was sentenced to 16 years in bank manager strapped on Now, half a century after the wake of the L.A. riots? — there prison after pleading guilty to a fake bomb and robbed her Los Angeles Times reported doesn't appear to be a singu- his latest string of robberies. own bank in cahoots with her "We had a revolving door," boyfriend. In another, an innothat the region was "Getting lar explanation for the steady Title of Bank Holdup Capi- decline. said former agent Bill Rehder, vative crew carved their way tal" in 1963, the long-standing Technology is certainly high who supervised bank rob- into banks through the roof. reign is fizzling to an end. on the list. Agents used to pull bery investigations in L.A. for Those five men were arrested The seven-county region 35mm film from security cam- two decades before retiring in last year, power saw and ladcovered by the FBI's L.A. office eras and have it developed, 1999. der in hand, after they had cut saw a mere 212 bank robber- hoping for a fleeting, grainy through the concrete roof of a ies in 2013, reaching a low not image of the bandit. Nowa- High risk, lowpay Citibank in Diamond Bar — in seen since the 1960s. That's days, driving to the scene of A nother f actor m a y b e what investigators believe was less than a tenth of what it was the heist, investigators get that would-be robbers are reat least the fourth hit by the at its height in the early '90s, high-resolution photos emailed considering whether hitting gang since 2011. when the region logged 2,641. to them on their smartphones a bank is worth the effort. All five have pleaded guilty The numbers have gotten in a matter of minutes. And the In 2003, the average heist in a nd await s entencing t h i s so low, in fact, that for the first Internet makes disseminating the U.S. yielded more than June. time in recent memory, the the images to the public far $10,000. In 2011, the last year Despite being a crime with San Francisco region — with faster and easier than relying the bureau published national one of the highest clearance less than half the populationon the evening newscast. statistics, the average haul was rates — about 60 percent end had more bank robberies last Beefed-up security mea- just over $7,500. A nonviolent in arrests in any given year year, with 227. Other regions sures at banks, including heist in which the perpetrator — there are still robbers who have also edged ahead of Los bulletproof plexiglass "ban- uses a note most often yields eludecapture.May is personAngeles in recent years, in- d it-barriers," have m ade i t less than $1,000, investigators ally most troubled by the AKcluding Atlanta. Compare that harder for robbers to get access say, and one in 10 robbers 47 Bandit, a stocky man stand-

to 1983, when L.A. had more

Los Angeles Times

Don Kelsen / Los Angeles Times file photo

Members of the Orange County Sheriff's SWAT team take position outside a Laguna Hills, Calif., strip mall in 2006 before apprehending the bank robber known as the Cue Card Bandit. Once the undisputed center of the bank robbery universe, Southern California

has seen a steep drop in the crime in recent years. ing 5 feet 10 who is wanted for

recalled Rehder, who created

robberies in California, Idaho the fax cover sheets and still and Washington. In 2012, af- drinks out of a coffee mug he ter robbing a Chino bank with designed, with a cartoon banan assault rifle, he shot at and dit and the words "Bank Robseriously wounded a patrol bery Capital of the World" in officer. red across the bottom. "I got as With the decrease in bank big an adrenaline pump out of robberies, the FBI's L.A. office (investigating) as these guys has disbanded the squad of do planning and pulling off agents it once had devoted to robberies." investigating them. Now they are investigated by agents in the violent crime squad. It's a dramatic change from the old days, says Rehder, the 541-548-2066 retired longtime agent. "It w as the m ost a c Adjustablc tion-packed squad we had," Beds

WILSONSsf Redmond

mplements t risrse J ~ I e ~ r s ~J 70 SW Century DT., Ste. 145 Bend, OR 97702• 541-322-7337 complementshomeittteriors.com

IiATTRESS

G allery - B e n d 541-3$0-50$4

The Bm11etin r U M a g a m iss,e ar Rohhe r s o n p o r d , p r e s e sst 0

Heor cLo yom an,cm yoe,r , faxnily have han,'? SencL ms a faxnily photo teken im, eemtral Oregon am,6 you am,cL your faxnily c.'ouhl be om, yoer may to the NorthweSt'8 1argeSt imdoor waterpar3e

resort CfR R A

XAT O T a P T a OD C M

in eemtra1ia, %'ashingtom,. It'S eaSy to enter and eaSy to Win! JUSt Send US a PhOtO of

your family having fun in Central Oregon. Kids, no kids, pets? ShOW US hoW you define family and Central OregOn fun!

TO ENTER just upload your photo st:

hendhulletin.comlfamilyphotocontelt and yoil are automatically entered to win!

WINNERS will bs announced in Therhrrstis's U MAGAZINE along with some of oul' favorite photo pics. Look for your next edition of U MAGAZINEpudlishing in The Bulletin on Saturday, June 7. New prizes will be awarded in upcoming editions of U Magazine, so enter as often as you like!

Enter t;ocmay for yoeI c.'hamc.'e to

WIN THIS GRKÃD PRIZE • A $500 GIFT CERTIFICATE TO THE GREAT WO L F L ODGE IN CFNTRALIA, WASHINGTO N • USE OF A 2014 FORD ESCAPE FOR 3 DAYS • A $100 GAS CARD A $1,400 value. Courtesy of ROBBERSON FORD. $500 gift certificate equals the expense of two nights lodging and water park passes for four. Winner is responsible for any additional taxes or fees. Prize has no cash value. Must be 21 or older to win. Visit www.bendbulletin.com/familyphotocontest for complete rules.

GREAT WP)LF L O D G E

•••o3.yoe c.am,mim. om,e of tem. 42,g PaSSportS ea r cLS Co SVR X O U R T A I R F V R C E K T E R i n B e m ct. The Year Of Faxni1y Pun Photo eomtest is broeght to yoe by: BEND 2100 NE 3rd St 541 -382-4521

ROBBERSON LINCOLN

fniQ+QQ

www.robberson.com

PRINEVILLE 2289 NE 3rd St. 541-447-6820

AGAZINE

e u etin

S tart a t w o - m o n t h s u b s c r i p t i o n t o T h e B u l l e t i n f or $3 4 a n d r e c e i v e a F R E E $ 2 0 P a s s p o r t C a r d to SUN M O U N T A I N F U N C E N T E R

The Bulletin

CA LL: 541-385-5800 (mention code: U MAGAZINE),:: Offer validinThe Bulletin home delivery area only. Twomonth subscription commitment must be fulfilled or the full price of the $20 Passport Card will be deducted from the subscriber's credit card. Not valid with any other offer.

Calendar, B2 Obituaries, B5 Weather, B6

THE BULLETIN • THURSDAY, APRIL 10, 2014

CENTRAL OREGON COMMUNITY COLLEGE

ui ion ra es o in s ea •

MAY ELECTION The May 20election will serve as aprimary for a variety of statewide offices. Local races and measures will also be on the ballot.

OESCHUTES COUNTY

• District Attorney Patrick Flaherty is seeking re-election, and Bend attorney John Hummel has also filed to run for the position as well. • Commission seats held by TonyDeBoneand Tammy Baneyareupfor election. DeBone,a Republican, hasfiled to run again andfaces aprimary challenge fromRichard Esterman. Democratand current BendCity Councilor Jodie Barramhas announcedshewill run for the position aswell. • Circuit Judge Barbara Haslinger hasannounced she'll retire. Her seat on the benchwill be up for election. Randy Miller and Thomas Spear are vying for the position. • Circuit Judge Stephen Forte is upfor re-election. • The county assessor position is on the ballot. • A five-year local option fire levy would tax property owners 20 cents per $1,000 in assessed property value. Thefire department currently receives acut of $1.18 per $1,000 in assessed property value from the city's permanent tax rate of $2.80 per $1,000.

BRIEFING

•

By Tyler Leeds

$87 for the 2014-15 school year. fordable in the state. The COCC board and was also held at $100. Both budget committee weighed

The Bulletin

The nonresident veteran rate

The Central Oregon Community College board voted Wednesday night to

students who are in state but out of district and those from

hold in-district tuition flat

for the upcoming academic year, while raising rates for students from outside the district. One credit for in-district

students will continue to cost

border states will see rates rise from $113 to $115, while students from nonborder states will see rates go from $230 to $237. Maintaining COCC's in-district rate will keep the college among the most af-

n e

various options before decid-

ing on keeping rates largely unchanged. "The hydraulics are working between four main things — tuition, expenditures, en-

suring our numbers remain black into the future, and tapping nongeneral funds,"

Police: Missing teen found

said Jim Middleton, COCC's

president. The discussion was framed around three main options.

The first was to increase all tuition rates, including a $1 bump for in-district students, while leaving expenditures intact and ensuring a longterm healthy reserve fund for the college. See COCC /B6

r o w o r a snac '?

A15-year-old visiting Bend whowas reported missing Tuesdaywas found in his hometown of Vancouver,Wash., late Tuesday,according to Bend Police Lt. Nick

Parker. Kenneth Currin Schuchman,whohas been diagnosedwith Asperger's syndrome,was in Bend with his father

visiting family, Parker said. His father reported the teen missing around 1:30 a.m.Tuesday. Schuchmanreportedly left the relatives' home on foot, without access to a vehicle. Parker saidSchuchman hadmoneyand boarded aCentral Oregon Breezebus heading north out of Bend.He said it was unclear whether Schuchmanhad purchased a ticket. Working with jurisdictions north of Bend,law enforcement wasable to locate Schuchmanin Vancouver andreunite him with his mother, who lives there, Parkersaid Wednesday. "The BendPolice Department would like to thank thecommunity for all efforts in trying to locate hlm," Parkersald.

DEQ fine will not de contested A subsidiary of Les Schwab TireCenters Inc. will not contest a finefor failing to test wastewater

CROOKCOUNTY

at its Prineville facility.

• The commission seat held by SethCrawfordis up for election. Crawford has filed to runagainand faces a primary challenge from Prineville City Councilor JackSeley. • The county assessor position is on the ballot. • A measure to make nonpartisan the positions of Crook County Judge and county commissioners will also be on the ballot.

The OregonDepartment of Environmental Quality issued a$4,761 penalty March 25to LS Transport Inc. for "failing to fully monitor stormwater discharge"

Ryan Brennecke l The Bulletin

at its facility at1515 N.W.

Meadow Camp Day Use Area isn't just a place for people to picnic. On a sunny Wednesday afternoon, this river otter navigated its way up the Deschutes River to spend a little time in the area. The otter ate several small fish before heading back downstream.

JEFFERSON COUNTY

• Commission seats held by MikeAhern and John Hatfield are upfor election. Ahern is seeking re-election and will face a challenge from Floyd Paye;Tom Brown, Mae Huston and Mike Throop have filed for the other seat.

CROOK/JEFFERSON • Circuit Judge Daniel Ahern and Circuit Judge Gary Lee Williams are running unopposed for re-election.

REGISTERTO VOTE • The deadline to register to vote is 21days before Election Day. • Register online atthe Oregon secretaryof state's website, bymail using a formfound there, or in personatyour county elections office. • Absentee ballots are available 45days before the election. Voters already registered in Deschutes County can request anearly ballot in person, by mail or byfax. Use this link to thecounty website to download theform asa PDF: bitly.comflfwstbY.Voters must include aname, a residenceaddress and a mailing address.

READOURSTORIES • Coverage leading up to the election is online at benllbulletin.com/ elections ELECTION CALENDAR Are you holding anevent to educate voters in the lead-up to the Mayelection? Submit the information to elections© bendbulletin.com. We will not publish information about political fundraisers.

MAY 2014 ELE CTION

bendhulletin.com/elections

3 vying to be on

Jefferson commission By Dylan J. Darling The Bulletin

Landslide threat is low local By Dylan J. Darling The Bulletin

The steep slope at Hogg Rock, along U.S. Highway 20 west of Sisters, is known to slide. Snow slides there have

evenblocked the highway, one of the main arteries through the Cascades, for a couple of

days at a time. "But it is not mud and debris, which is a whole different type of slide concept," Peter Murphy, spokesman for the Oregon Department of Transportation

in Bend said Wednesday.

Mud, muck and debris are what search teams are contending with in Oso, Wash., where a horrific landslide on March 22 buried a small community. As of Wednesday afternoon, The Associated Press reported the Oso landslide had killed at least 36 and the search

continued for more bodies. The Oso landslide has prompted conversations about the possibility of landslideselsewhere around the Northwest.

Landslides occur when

there are the right set of circumstances, from geology to weather, said Ian Madin, the

chief scientist for the Oregon Department of Geology and Mineral Industries. Some

places around Central Oregon, such as the slopes of the Cascades orthehillsaround Prineville, could be prone to slide, but the lava flows around

and under Bend are fairly stable. "It is not a real high hazard

(around Bend)," Madin said. See Slides /B2

A former sheriff, a Madras city councilman and a tax worker are the three

candidates contending in the May election for one of

two seats up for vote on the Jefferson County Board of Commissioners.

Mike Throop, 58, of Madras was elected to three

Signs of slides

The Oregon Department of Geology and Mineral Industries continues to develop a map of historic landslides around the state. Scientists have determined where there have been landslides, an indicator that there could be more in the same places. To see an interactive version of the map, go to www.oregongeology.org/slido.

terms as Jefferson County

' •

sheriff but lost his job in 1997 when he was convict-

balles

ed of felony campaign contribution fraud in the 1992 election. Throop hopes reason not to vote for him. "I screwed up," Throop

• ' 0 —

•

else to say it." After losing his badge Throop stayed in Jefferson County and volunteered

g h , nr

• •

~~La Grande•

v.~>

e~~ • t/ •

0) 0

•

• Bend

Ontario

•

,-r 'A

•e

. • tjl. • •

STATE NEWS

district's board.

"I wanted to show people that I wasn't going to e

duck tail and run because I •

•

Falls-

human resources worker,

faces Tom Brown, 69, and Mae Huston, 63, in the election.

See Commission /B6

— Bulletin staff reports

•

he was elected twice to the

make a mistake," he said. Throop, who is a county

eeae

said. "I don't know how

with the Jefferson County Fire District. Eventually

Ifg~ ~ Salsm

voters don't use his past as

•

ePendlei%

-We

O'Neil Highway,said Krista Ratliff, stormwater permit writer in theDEQ's Bend office. Oregon lawrequires the facility to monitor its stormwater for"benchmark pollutants" at least four times permonitoring year — July1 to June30. Ratliff said thefacility is responsible for testing for suspendedsolidsdebris and dirt from the parking lot — proper pH, oil andgrease, zinc, copperandlead. DEQdetermined LS Transport Inc. conducted monitoring just once during the 2012-13year, according to aDEQnews release. Businesses finedfor failing to comply with DEQ stormwater testing standards have20 days to contest the decision, according to Oregon statute. Dale Thompson,chief marketing officer for Les Schwab, said thecompany will not file anappeal, has fixed theproblem and will meet reporting deadlines in thefuture. "We arecommitted to the Prineville community, and we takepreserving the environmentvery seriously," he said. "We know wemissed reporting in time.The breakdownwasonour part, so there's noneed to contest the fine." Ratliff confirmed this is the first time thefacility has missed areporting deadline.

Source: Oregon Department of Geology andMineral Industries

Greg Cross/The Bulletin

• Klamath Falls: SkyWest's decision to leave airport has travelers in a bind,B3 • Southern Oregon: Drought has Klamath Basin farmers facing irrigation restrictions, B3

TH E BULLETIN• THURSDAY, APRIL 10, 2014

E VENT TODAY 25TH ANNUALCENTRALOREGON RV DEALERSPRING SHOW AND SALE:Free, open to the public; 9 a.m.-6p.m.;Deschutes County Fair 8 Expo Center, 3800 S.W. Airport Way, Redmond; 541-548-2711. BOOK DISCUSSION:Discuss A Novel Idea's"The Dog Stars" by Peter Heller; free; noon; Redmond Public Library, 827 S.W. Deschutes Ave.; 541-312-1050 or www. deschuteslibrary.org/calendar. BOOK DISCUSSION:Discuss A Novel Idea's"The Dog Stars" by Peter Heller; free; noon; Downtown Bend Public Library, 601 N.W. Wall St.; 541-617-7050 or www. deschuteslibrary.org/calendar. ELLIS PAUL:The Boston-based "Fleming Artist" singer-songwriter performs at a house concert; bring dish or beverage to share; $20 donation, reservation requested;

7 p.m., doors open 6p.m. for potluck; The Glen at Newport Hills, 1019 N.W. Stannium Drive, Bend; 541-480-8830

ENDA R

Email events at least 10 days before publication date to communityli feibendbulletin.com or click on "Submit an Event" at tvtvvp.bendbulletin.com. Ongoing listings must be updated monthly. Contact: 541-383-0351.

www.2ndstreettheater.com. "NFINITYCHAMPIONS LEAGUE CHEERLEADINGEVENT": A screening of the 2014 film about cheerleading; $12.50; 7:30 p.m.; Regal Old Mill Stadium16 & IMAX, 680 S.W. Powerhouse Drive, Bend; 541-312-2901. ZACH RYANANDTHE RENEGADES:The Las Vegas Americana band performs, with

Second Son;$5; 9p.m.; Volcanic Theatre Pub, 70 S.W.Century Drive, Bend; 541-323-1881 or www. volcanictheatrepub.com. Joe Kline 1The Bulletin file photo

FRIDAY

More than1,000 amateur and professional riders will compete in the USA BMX Great Northwest Nationals at the Deschutes County Fair & Expo Center in Redmond this weekend.

OREGON POETRYASSOCIATION SPRING CONFERENCE:Featuring workshops, public readings,

consultations, openmics andmore; visit website for schedule and free events; $65, $55 for members in advance, registration requested by Friday; The Double Tree, 300 N.W. Franklin Ave., Bend; 503-916-3076

or houseconcertsintheglen©

or www.oregonpoets.org/category/ conferences.

bendbroadband.com. TIM SNIDER:The Reno, Nev., violinist performs a live looping show; free; 7 p.m.; McMenamins Old St.FrancisSchool,700 N.W .Bond St., Bend; 541-382-5174 or www. mcmenamins.com. "HELEN ONWHEELS": Cricket Daniel's play about a gun-totin', whiskey-drinkin' granny in Oklahoma; $19, $16 for students and seniors; 7:30 p.m.; 2nd Street Theater, 220 N.E. Lafayette Ave., Bend; 541-312-9626 or

25TH ANNUALCENTRAL OREGON RV DEALERSPRING SHOWAND SALE:Free, open to the public; 9 a.m.-6p.m.;DeschutesCounty Fair & Expo Center, 3800 S.W. Airport Way, Redmond; 541-548-2711. FLEA MARKET: Free admission, Saturday breakfast $5, $3 for children ages3-9;9 a.m.-4 p.m.; Terrebonne Grange Hall, 828611th St. USA BMX GREATNORTHWEST NATIONALS:More than1,000 amateur and professional BMX

riders compete on a dirt track in multiple age groups; free, VIP parking is $10; 1:30-9 p.m.; Deschutes County Fair 8 Expo Center, 3800 S.W. Airport Way, Redmond; 480-961-1903 or www. usbmx.com. MY OWN TWO HANDS: A fundraiser for the Sisters Americana Project featuring an art stroll, parade and performing arts; visit website for schedule; free admission; 3:30 p.m.; downtown Sisters; www. sistersfolkfestival.org. BEND SPRINGFESTIVAL: A celebration of the season with art, live music, food and drinks; free; 5-11 p.m.; NorthWest Crossing, Mt. Washington and Northwest Crossing drives; www.nwxevents.com. "RIVER OF NO RETURN": A screening of the 2012 nature film

about a couplewhospentayear in the wilderness; $5; 6 p.m., doors open 5 p.m.; McMenamins Old St. Francis School, 700 N.W. Bond St., Bend; 541-382-5174 or www. mcmenamins.com. INTERNATIONALDINNER FUNDRAISER:Information about various countries and an ethnic food dinner; proceeds benefit the school's Interact Club's International Service Project; $10, $7 for children ages12 and younger; 6-8 p.m.; BendHighSchool,230 N.E.Sixth St.; 541-383-6290 or www.j.mp/ BHSinteract. AUTHOR PRESENTATION:Phillip Margolin reads from his latest novel, "Worthy Brown's Daughter"; $5; 6:30p.m.;PaulinaSpringsBooks, 422 S.W. Sixth St.,Redmond; 541-526-1491.

TURTLE ISLAND QUARTET:The San Francisco Bay Area string quartet performs; $12, $8 children 12 and younger, plus fees; 7 p.m., doors open at 6 p.m.; Tower Theatre, 835 N.W. Wall St., Bend; 541-3170700 or www.towertheatre.org. "HELEN ONWHEELS": Cricket Daniel's play about a gun-totin', whiskey-drinkin' granny in Oklahoma; $19, $16 for students and seniors; 7:30 p.m.; 2nd Street Theater, 220 N.E. Lafayette Ave., Bend; 541-312-9626 or www.2ndstreettheater.com. "THE BUTLER":A screening of the 2013 film (PG-13) starring Forest Whitaker; free, refreshments available; 7:30 p.m.; Rodriguez Annex, Jefferson County Library, 134 S.E. E St., Madras; 541-4753351 or www.jcld.org. KR ANDALEXWILEY: Underground hip-hop, with Chandler P andCard1; $5; 9 p.m., doors open 8 p.m.; Domino Room, 51 N.W.Greenwood Ave., Bend; 541-408-4329 or www. facebook.com/slipmatscience. SAMMY STEELE: The Tacoma, Wash., country artist performs; $5 plus fees; 9-11:30 p.m.; Maverick's Country Bar & Grill, 20565 Brinson Blvd., Bend; 541-325-1886 or www. maverickscountrybar.com. SUNSPOTJONZ:The underground rapper performs, with Kruse, The HardChordsand DJ Raider Mystic; $5; 9 p.m.; The Astro Lounge, 939 N.W. Bond St., Bend; 541-388-0116

706-9091 or www.dojobend.com.

SATURDAY "ALLABOARD! RAILROADS INTHE HIGH DESERT"EXHIBITOPENING: Learn how the railroad has impacted local life; included in the price of admission; $12 adults, $10 ages 65and older, $7ages5-12, free ages 4 and younger; High Desert Museum, 59800 S. U.S. Highway 97, Bend; 541-382-4754 or www. highdesertmuseum.org. OREGON POETRYASSOCIATION SPRING CONFERENCE:Featuring workshops, public readings, consultations, open mics and more; visit website for schedule and free events; $65; The Double Tree,300 N.W. Franklin Ave., Bend; 503-9163076 or www.oregonpoets.org/

category/conferences. USA BMX GREATNORTHWEST NATIONALS:More than1,000 amateur and professional BMX riders compete on a dirt track in multiple age groups; free, VIP parking is $10; 7 a.m.7 p.m.;Deschutes County Fair & Expo Center, 3800 S.W.Airport Way, Redmond; 480-961-1903 or www.usbmx.com. 25TH ANNUALCENTRAL OREGON RV DEALERSPRING SHOW AND SALE:Free, open to the public; 9 a.m.-6p.m.;DeschutesCounty Fair 8 Expo Center, 3800 S.W. Airport Way, Redmond; 541-548-2711. FLEA MARKET: Free admission, Saturday breakfast $5, $3 for children ages3-9;9 a.m.-4 p.m.; Terrebonne Grange Hall, 828611th St.

or www.astroloungebend.com.

DJ ANJALI ANDTHEINCREDIBLE KID:Portland-based DJs spin global dance music; free;10 p.m.; Dojo, 852 N.W. Brooks St., Bend; 541-

Visit Central Oregon's

NEWS OF RECORD POLICE LOG The Bulletin will update items in the Police Log whensucha request is received. Any new information, such asthe dismissal of charges or acquittal, must be verifiable. For more information, call541-383-0358.

BEND POLICE DEPARTMENT DUII —Taylar J. Apsey, 42, was arrested on suspicion of driving under the influence of intoxicants at 8:20 a.m. April 4, in the area of Northeast 27th Street and Northeast Neff Road. Theft —A theft was reported at 8:25 p.m. April 7, in the 20400 block of RaeRoad. Theft —A theft was reported at 12:25 p.m. April 8, in the 63300 block of Nels Anderson Road.

6:46 p.m. April1, in the 8300 block of Southwest Tower Road inCrooked River Ranch. Unauthorized use — Avehicle was reported stolen at 7:08 p.m. April 2, in the area of state Highway 26near milepost 2 in Madras.

Courtesy Peter Murphy/Oregon Department of Transportation

Here, a tanker truck is dug out of a snow slide on Jan. 9, 2008.

Slides

website. Again, money becomesan issue.

Monday 10:23 a.m.— Unauthorized burning, 734 N.E. Norton Ave. 20 —Medical aid calls.

Weekly Arts Sr Entertainment In

"We do as much as we can

Contlnued from B1 U nderstanding w ha t

the

landslide danger in an area is requireslooking at its past, and the clues left in the land. State scientists li ke M a d in

used to do this by driving around or scanning over aerial photos, searching for signs of slides. Nowadays they use high-tech laser technology to create detailed images of the landscape, but the time-con-

A hazard map only shows part of the situation though,

given the amount of funding that Congress gives us," said

said Bill Burns, an engineering geologist with the Oregon Leslie Gordan, spokeswoman Department of Geology and for the USGS. Mineral Industries. OverlayMadin said heis set to have ing a map with roads, homes a conference call Friday with and buildings would give a USGS officials and his coun- true picture of whatis at risk. "The real question is, do we terparts from other state geological agencies around the have high hazard where we country. The conversation havepeople living," he said. will be about mapping land— Reporter: 541-617-7812, slides and finding funding for ddarling@bendbulletirt.com

suming chore of looking for places in the images where

s®aclAssir

COVERINGS

541-388%418

MAGAZBHP e

1465 SW Knoll Ave. Bend www.classic-coverings.com

ettn

PRIMEVILLE POLICE DEPARTMEMT

CONSUNER

Unlawful entry —Avehicle was reported entered at 3 a.m.April 8, in the area of Northwest Deer Street.

the work.

See 100 life-sized samples of the latest innovative and stylish Hunter Douglas window fashions! See us also for Retractable Awnings, Exterior Solar Screens, Patio Shade Structures

BEND FIRE RUNS

•I

Hogg Rock along U.S. Highway 20west of Sisters is knownfor snow slides, which may block the road.

HunterDouilas

InSuranCe ServiCeS AND RENTERS

JEFFERSON COUNTY SHERIFF'S OFFICE

BEND 541-383-1733

Theft —A theft was reported at 1:28 p.m. April 1, in the 300 block of Jefferson Avenue inMadras. Theft — A theft was reported at

REDMOND 541-504-2134

SR-22'S • SuspENSIONS DUII'S • TICKETS

Find Your Dream Home In Real Estate

there have been landslides re-

mains much the same. The agency has an online map showing where landslides have occurred, going

•

••

TheB u lletin

Qg 1K &t ppl(~

back a few thousand years. But the map is far from com-

•g~

iy+

plete. Madin said it shows about 25 percent of the historic landslide activity west

of the Cascades and about 50

Executive Ranch Retreat

percent east of the mountains.

.S~

The disparity comesfrom the old forms of data gathering

163 acres, 5000 sq. ft. custom home, 8 miles from Burns, OR. Chef's kitchen, walk in cooler, two decks, — it was easier to see where there had been slides east of hot tub. Guest home, large heated RV shop, barn, the Cascadesbecause of lesser and 1000 gal. i rrigation well. Ma ture landscapirig,' vegetation. koi pond, Steens Mt. views. Quiet, peaceful country The laser images show the ground below vegeta- -, living. Home to be open to view April 12-13, 12:00pm to 4:00pm both days. Drive 8 miles east on Hwy ZO, tion, making it possible to see where there have been landleft on Harney Ln. and follow signs.

slidesevenbelow thick woods. This will help speed up mapping landslides around the

Prieate Retreat B Country Lieing c=—

state, Madin said, but there is

the question of funding. To completely map the state would cost $1 million to $2

ard map, but it was made in 1982, according to the USGS

FREE REMODELING WORKSHOPS Enjoy a complimentary continental breakfast while you learn. Inspiration, education, and guidance to turn your vision into a reality. Wajk-ins welcome! RSVp at www.neilkelly.com/seminars

Iee

te.

. •

Saturday, April 12th at Awbrey Glen Golf Club 2500 Awbrey Glen Drive, Bend

$995,000 ~

million and then to identify

and monitor the most dangerous placescould cost about $1 million a year, Madin said. For now, that's not in the agency's budget. The U.S.Geological Survey has a national landslide haz-

IBjj---" lfl

/hW

,~, ~-c-

Kenneth Bentz, Broker • 541.647.0657:;.»-' ,::" www.BentzRealty.com • Ken@Bentzrcalty.com

=„-'.=;

9:30am ..........Inspired Kitchen Design 10:15am........Q&A with a Neil Kelly Client 10:30am .......Amazing Bathroom Makeovers

Awbrey Glen

Neil Kelly Bend Design Center • 541.382-7580 • ne|lkelly.com Presenting a few of our favorite NeilKelly partners: OR CCB tt1663 WA RegitNeLKCI 18702

ance

THURSDAY, APRIL 10, 2014 • THE BULLETIN

REGON KLAMATH FALLS

AROUND THE STATE

i sru

irine u ou •

•

r ave

• SkyWestserviceslatedto end onJune5

faced increasing challenging forward.... You just have es to maintain air service as to keep the faith." a resultof the recession and A s t a keholder g r o up The Associated Press reschedule the flights. more stringent federal rules. plans to soon discuss how "So my ticket is now more The stricter rules govern crew a $135,000 Oregon DepartKLAMATH FALLS — The recent decision by SkyWest expensive to go from Medford scheduling and have made it ment of Transportation marAirlines to d iscontinue ser- to San Francisco than from difficult for airlines to main- keting grant awarded to the vice at Crater Lake-Klamath San Francisco to Chicago," she tain profitability i n s m all airport — intended to boost Regional Airport has travel- told the Herald and News. "It markets. the passenger count — could ers scrambling to reschedule is going to be so difficult and SkyWest also is discontinu- be affected by SkyWest's deflights. costly to travel out of Klamath ing flights between Modesto, parture. The group includes Flights to and from Klam- now. It is awful that we are so Calif., and San Francisco. airport and travel officials, ath Falls will end June 5, about stuck here. It was so much nicJohn Longley, director of as well as Chamber of Coma month before Kellee Stabler er to have the choice to fly into the Klamath Falls airport, said merce E x ecutive D i r ector and her boyfriend had a ticket and out of Klamath." the timing of SkyWest's de- Charles Massie. "The thing that we don't to visit family in the Midwest. SkyWest has provided air parture was unexpected, and Instead of leaving from service to Klamath Falls since the city already has started know from this point forward Klamath Falls, the couple July 2008 and currently pro- searching for a replacement is: How many companies will now plans to drive 80 miles to vides daily flights to and from air carrier. look at Klamath Falls and de"The important thing is to Medford for a flight out of that Portland and San Francisco. cidenot to come here because airport to San Francisco. StaSmall cities like Klamath look to the future," Longley we don't have commercial air bler paid about $150 extra to Falls, population 21,000, have said. "You have to keep walk- service?" Massiesaid.

man has beenfoundontheOregoncoast.TheLincolnCountySheriff's Office saysthebody of 37-year-old Michael Lanphearewasfound Wednesdayalong the surf line in the Lost Creekarea, about 5 miles north of SealRock. Anautopsy will be donethis week. Policelast week arrested 35-year-old DonaldLawyer III in connection with the disappearanceafter hewasfound nakedand bloody along Highway101 in Seal Rock.Lawyerhasbeenchargedwithsecond-degreemanslaughter.

SledgehammeraSSault —CoosCounty Sheriff's Office deputies arrested a Lakesidemanaccused of striking his girlfriend with a sledgehammer. TheWorld newspaperreports 43-year-old Jeffery Waight has beencharged with unlawful use of aweapon, domestic assault, domestic menacingandinterfering with 911. Deputies sayWaight's girlfriend reported that theattack occurred during anargument. The woman's call to 911dispatchers was disconnected shortly before deputies arrived. 2-dOg limit — WallowaCounty Commissioner PaulCastilleja is trying to raise moneyfor acountywide dog control programthat could include a limit on thenumber of dogsallowed per household. Thecommissioner told the JosephCity Council hewants cities in the EasternOregon county to contribute to afund that would help payfor afull-time dog control officer. The La Grande Observer reports that Castilleja's list of proposals for the programincludes onethat would limit eachhousehold to a maximum oftwo dogs. Another would prohibit dogs from city and county parks.

landsman suspectsfoundto be carrying firearm By Nigel Duara The Associated Press

PORTLAND — A

t h r ee-

judge panel from the Oregon Court of

A p peals has r e-

Laviguerisa "career offender" and gave him a long prison sentence because of the

when the officers stopped

number of robberies he has

them, wanting to check their That means the officer's ages. During the check, the threat of serious physical in- safety concerns must be officers discovered Rodri- jury," Judge Lynn Nakamoto based on what they're seeing guez-Perez had a prior arrest wrote. and hearing at the moment

The Associated Press PORTLAND — A

f e deral

judge in Portland has sentenced a man to 20years in

prisonforthe robberiesoffour banks and two motels in Oregon and Washington. U.S. District Judge Robert

E. Jones determined Wednesday that 57-year-old Andrew

committed.

Laviguer robbed banks in Seattle, Tacoma and Portland last summer and also hit motels in Salem and Wilsonville.

He was arrested Sept. 9 and pleaded guilty two months later.

Earlier in l ife, Laviguer served prison sentences for

robbing a Salem bank in 1992 and a Gresham bank in 2007.

Prosecutors say he was released from prison last July and started his robbery spree the following month.

forpossession of a concealed,

— From wire reports

"Neither defendant's demeanor nor his physical actions, either individually or collectively, would support a reasonable suspicion that defendant posed an immediate threat of serious physical injury."

versed a Multnomah County man's firearm conviction, ruling that the police officers who stopped and frisked the man had no reason to do so. The judges ordered that the officers'discoveryoftheloaded pistol carried by Diego Rodriguez-Perez be suppressed as evidence and sentthe case back to trial court. Rodriguez-Perez and his brother were walking on a sidewalk after buying beer

Find It

to the subjective belief that a

appellate court judges found person may be hiding somenothing in his behavior to thing, or about to commit a merit a search. crime, according to Oregon "Neither defendant's de-

meanor nor his physical actions, either individually or collectively, would support a reasonable suspicion that defendant posed an immediate

Precedent holds that judges

Online bendbulletin.com 541-728-0321 swww.elevalioncapital.biz

Kemple

law. But they are held to a dif-

ferentstandard for searches

® I E M O • IAl

— they must show that their

actions were reasonable."

"objectively

Children's en inic

In our effort to provide dental care to children in Deschutes County who can't afford it, the Kemple Memorial Children's Dental Clinic wishes to thank the following dentists for their volunteered services in March, 2014. VOLUNTEER DENTISTS TREATING KEMPLE KIDS IN THEIR OWN OFFICES. MARCH, 2014

of the stop, not an intuition

should recognize that police or general fear that a person officers are forced to make could be a danger based on life-and-death decisions dai- other factors. "Here, the officers' subjecly, and are not to "uncharitably second-guess an officer's tive belief that defendant was him about his history with judgment," according to a armed and dangerous is not weapons. His eyes widened, 1987 state Supreme Court in dispute," Nakamoto wrote, he stepped back, took a long ruling. But the court does set "but (a subjective) belief that look over his shoulder and ap- limits on the latitude it affords defendantwas armed cannot, peared ready to flee. police who believe they're by itself, support an objectiveA trial court judge agreed acting in the interests of their ly reasonable suspicion that with the officers' belief that own safety. defendant posed an immediRodriguez-Perez's actions Police officers are entitled ate threat to officer safety." loadedfirearm. The officers believed Rodriguez-Perez was acting in a threatening manner after they specifically questioned

Dr. Scot Burgess Dr. David Bitner Dr. Karen Coe Dr. Kevin Coombe Dr. David Dunscombe Dr. Matt Falkenstein Dr. David Fuller Dr. Taylor Fowles Dr. Benjamin Grieb Dr. Brad Hester Dr. Dennis Holly Dr. Mark Jensen Dr. Brad Johnson Dr. Greggory Jones Dr. Tony Parsley Dr. Zack Porter Dr. Maureen Porter Dr. Catherine Quas Dr. Brian Rosenzweig Dr. Mehdi Salari

Klamath Basin farmers face irrigation cutbacks By Jeff Barnard The Associated Press

year.

The irrigation cutbacks also

Plae Well, Retire Well

— Judge Lynn Nakamoto

constituted a threat, but the

agriculture hasbeenformed andwill meet for the first time this week. The task force, convenedbyGov.John Kitzhaber, will examineconflicts betweengrowers of genetically engineered products andother producers, including organic growers. It will also look into theissueof labeling GMO foods for consumers. Last fall, Kitzhaberalso directed the OregonDepartment of Agriculture to mapwhere genetically engineered andnongenetically engineered crops aregrown. Healso asked the department to submit astate action planfor dealing with genetically engineeredcrops.

Bady fOund near SealROCk—Thebody ofa missing Newport

Spreeof MULTNOMAH COUNTY robberies Court: Officerdidn't havereasonto fear 20years in prison

GMOtaek feroe — Oregon'staskforce ongenetically engineered

ter as part of a plan to remove

mean water shortages for na- dams to help salmon, but it has GRANTS PASS — Farmers proved since a low point in tional wildlife refuges that been stalled in Congress beon the Klamath Reclamation the winter when water sup- serve waterfowl on the Pacific cause of opposition by House Project straddling the O r e- plies were projected to be just Flyway. Republicans. gon-California border are fac- 20 percent of what is needed, T he Klamath Basin h a s During last year's drought, ing irrigation cutbacks caused Addington said. "But it's still long struggled to meet all the off-proj ectranchersin theupby drought for the third year going to be a long dry sum- demands for water. Conflicts per basin saw their irrigation mer," he said. in a row. hit their peak in 2001, when shut off a fter th e K l amath The U.S. Bureau of ReclaT he b u reau n o ted t h a t irrigation was shut off to the Tribes exercised newly recm ation operations plan r e snowpack, the primary nat- bulk of the project to conserve ognized senior water rights to leased Wednesday shows only ural water storage system water for endangered fish. protect endangered fish. 61 percent ofthew aterneeded across the West, was just 31 The next year, full irrigation for full irrigation is available to percentofnormal and precip- was restored, but tens of thouthe 1,200 farms on the project. itation was 75 percent of nor- sands of salmon died in the G reg Addington of t h e maL As a result, the Natural lower Klamath River, where Klamath Water Users Associ- Resources Conservation Ser- flows were warmer and lower ation said that even with con- vice forecast flows into Upper than usual. Irrigation was limtracts paying farmers to leave Klamath Lake, the irrigation ited in 2010, 2012 and 2013. their land idle, and groundwa- project' s primary reservoir, Since then farmers, conserter pumping, the agency will at 46 percent of average. Two vation groups, Indian tribes have a tough time meeting smaller reservoirs serving the and others have forged an all the demand for water this project will also be low. agreement to share scarce waI ' The water outlook has im-

Dr. Anne Scott Dr. Marika Stone Dr. Andrew Timm Dr. Jeff Timm Dr. Ryan Timm Dr. Peter Yonan Dental Professionals Lana Austin RDH Cindy Baumgardner RDH Kelli Cooper EPDH Tiffany Foy EPDH Brandy Ketcher DA Dina Licitra DA Hailey Rambo EPDH Desiree Strawn EPDH Darla Thompson EPDH

At the KempleMemorial Children's DentalClinic, ourmission Is toimprovethe health and well-beingofchildren inDeschutesCounty byfacilitating critical preventative, educationalanddentaltreatment servicesfor childrenwhosefamilies cannot access basic dentalcare.Weadvocate for all childrenneedingtimely, highquality dentalcare.

' I

s ••

''•I

•

' '

• •

•'

N-LINE BIDING STARTS APRIL 6 AT 9 A.M.

www.BulletinBidnBuy.com

Springfieldmanchargedwith trying to kill officer Walker was listed in critical threatened other people at the EUGENE — An Oregon man condition after the shooting. duplex and had made threats shot by police during a con- After nine days in the hospi- to shoot police, Lane County frontation last month has been tal, he was booked into the District Attorney Alex Gardner charged with attempting to kill Lane County jail on charges SRld. the officer who woundedhim. of menacing, unlawful use of a Keetle heard what sounded B rian D . W a lker, 41, o f weapon and interfering with a like a gunshot, Gardner said. Springfield, pleaded not guilty police officer. Walker pleaded Walker then emerged fmm the Tuesday to a charge of attempt- not guilty to those charges late back door of the duplex. ed aggravated murder with a last month. A grand jury then Keetle confronted Walker, firearm, The Register-Guard decided to indict Walker on the who disregarded instructions newspaper reported. attemptedmurder charge. while facing another officer, Court records list the vicThe gunfire erupted after Gardner said. tim as officer Brian Keetle, the Keetle and other officers went Gardnersaid Keetle ordered Springfield policeman who to Walker's home after some- Walker to surrender, but the shot Walker several times af- one called 911 to say he was man reached toward a gun in ter Walker allegedly reached armed and suicidal. his waistband. Keetle fired four for a gun during the March 11 A dispatcher advised off icers shots at Walker and several hit confrontation. that Walker had r eportedly him, Gardner said.

I rli

VOU CAIII BID OIII:

The Associated Press

$10,000CONSTRUCTION CERTIFICATE

ROI

S II% •e

• E>

$5,000CONSTRUCTION CERTIFICATE $1,000 CONSTRUCTION CERTIFICATE

1•

•E

El . e

541-728-8933 chrisengels11@hotmail.com

*Restrictionsapply

• I

0 '

TH E BULLETIN• THURSDAY, APRIL 10, 2014

EDj To

The Bulletin

IS I'I

0 I'e in

xxmm,@wce,~m,wuum,~©lAS te tINoewsemew ToamWmm".

• Iill

Ons en rain

///

t's a wonderful example of real-life recycling: A beer brewer buys barley, cooks it, extracts the wort, which contains the sugars that will become alcohol, and gives or

/p' // I

/ /t

sells the cooked barley to a local cattle rancher. The rancher

///

feeds the used — spent — grain to his cattle, which in turn wind up in the hamburgers at a local restaurant. From Deschutes Brewery on down, local beer makers recycle their spent grain this way, as do brewers around the country. Unfortunately, the federal Food and Drug A d ministration, hip deep in rewriting the rules aimed at keeping the nation's food supply safe, last fall proposed new r egulations that would put a n end to the cycle. It would do so by dramatically tightening the rules governing storage and delivery of the grain. "Dramatically" hardly covers it. The Beer Institute, an industry trade association, told the FDA in a letter that the cost of putting the equipment required by the new legislation into an individual brewery couldcost as much as $13 million — a p rohibitive amount for a small craft brewer

and many large ones. The alternative, meanwhile, is simply to throw the grain away. Deschutes Brewery alone produces some 25 million pounds of the

stuffa year, and, according to a home-brew website, each pound fills about a half-gallon container. Stuff that into 65-gallon garbage cans, and you come up with almost 200,000cans of waste a year. The industry's reaction to the proposed changes was so strong that the agency has said it will redraw the rules, taking the brewers' worries into consideration. It should. Foodborne illnesses are a serious threat. But, says Gary Fish of Deschutes Brewery in a story on Oregon Public Radio recently, he's never heard of a case of illness caused by contaminated spent grain. The FDA does have good reason to be concerned about food safety. It's been barraged by critics over its inability to prevent outbreaks of disease caused by contaminated food. In the case of spent grain, however, the caution seems misplaced. Its decision to go back to the drawing board was the right one to make.

Internet freedomcould be further jeopardized

o vernments around t h e world are looking for ways to tax and control the Internet. There have been efforts to shut down Twitter and block Facebook. Censorship of the Internet in some countries is commonplace. The Obama a d ministration has announced it's looking into a change that could further jeopardize the Internet's freedom and openness. It is its "intent to transition key Internet domain name functions to the global multistakeholder community." Without getting too technical, the domain name system isa way of converting Web addresses that people can understand, such as bendbulletin.com, into something a computercan easily understand — a numeric address. One way for agovernment to control the Internet is to order Internet service providers to prohibit customers from accessing certain domain names. The U.S. government has even seized domain names to fight Internet privacy. Other governments can and try to

do much, much more. "We cannot allow institutions such as the United Nations or the International Telecommunication Union to insert themselves into the functioning of the domain name system," U.S. Rep. Greg Walden, R-Hood River, said recently."Make no mistake: Threats to the openness and freedom of the Internet are real. Leaders such as Vladimir Putin have explicitly announced their desire to gain control of the Internet." It's important to note that the Obama administration is not abandoning the Internet. It remains committed to "protecting the security, stability and resiliency of the Internet." And there isn't even a proposal yet for what the new multistakeholder body will look like. Big technology companies like Google are also cautiously supportive of the change. But the U.S. should not relinquish its control without absolute guarantees that it is not making it easier for other governments to take control.

0 0 0

M 1Vickel's Worth How many had lost care?

ulations and good luck!

The White House is patting itself on the back because more than 7

astating to private property rights. It Ed Endsley wouldn't. Bend ESA rules and regulations apply

Support Miller for court

million people have signed up for Obamacare. Really? How difficult should it be to get people to sign up for anything if you pass a law requiring them to do so, fine them if they don't and then keep extending the deadline untilyou have the numbers you want?

to public lands. Livestock opera-

tors have controlled public rangelands for over a century, but they I strongly recommend Randy actually belong to all of us. Hikers, Miller for our n ext circuit court birdwatchers, anglers, artists, sightjudge. My wife and I are retired and seers, botanists and cattlemen are have li ved in Bend for seven years, equal partners, at least in theory. during that time having the plea- Assuming most Americans would sure of knowing Miller. His charac- prefer a healthy, functioning sysWhat I would be interested to ter, integrity, experience and overall tem to the current situation created know is how many of the 7 million background as a loving father, hus- by decades of overgrazing and mispeople who signed up were people band, former combat U.S. Marine, management, a sage grouse listing who lost their health care because of police officer, accomplished lawyer is not only warranted, it makes perObamacare. and more, make himuniquely quali- fect sense. Roger Provost fied to serve the people. Sage grouse are an indicator of Redmond Moreover, Miller is an excellent rangeland health. Low sage grouse listener and problem solver. He's mo- numbers over a long period of time Exceptional engineering tivated and results oriented. In addi- indicate poor range conditions, tion to an impressive academic back- which adversely affect a vast arexpertise ground, he also possesses street ray of native plants and animals. Dear Becky Johnson, OSU vice smarts and common sense. Further, Allowing the livestock industry an president: I support your new cam- Miller has a wonderful sense of hu- unwarranted influence over Westpus location, but I never expected m or and would make afinejudge. ern rangelands has fostered the to use institution of higher learning Rarely do I ever endorse a per- invasion of exotic annual grasses, and idiocy in the same sentence. son running for any kind of public decimated riparian zones along Your decision to use Kittelson & As- office. However, in this case I am fish-bearing streams, encouraged sociates, a "national" firm, to solve proud tosupport and recommend Western juniper to overtake once the traffic problem is inspired. Their Miller for circuit court judge. productive grasslands, and conplan to limit congestion is truly couJoe Gallagher tributed heavily to the loss of sage rageous. Simply limit the number Bend grouse habitat, to name just a few. of parking spaces and there will If bluebunch wheatgrass or Idabe fewer cars! That is exceptionho fescuepossessed the majestic al engineering expertise! But I am grandeur of Douglas fir, maybe the coming to understand your greatest media would be less enamored with I'm writing in support of George livestock grazing on public land. genius in the realization that ample parking already exists within close Wuerthner's opinion piece on sage For the time being, the American walking distance in the surround- grouse. As Wuerthner points out, range is possibly the only place an ing residential areas and businesses Bulletin stories typically focus on invasive species such as the (non-nathatare required by code to have the livestock industry point of view tive) feral horse enjoys federal proample parking, such as Safeway, and therebyundervalue the greater tection, while the real indicators of and various other professional offic- public good. In reading many news rangeland health such our native es. Oh, and The Bulletin parking lot, reports, you might come to believe sage grouse struggle on the brink. which isn't as much needed in this a sage grouse listing under the EnBill Rhoades era of newspaper decline. Congrat- dangered Species Act would be devMadras

Sage grouse deserveprotection

Letters policy

In My Viewpolicy How to submit

We welcomeyour letters. Letters should be limited to one issue, contain no more than 250words and include the writer's signature, phonenumber and address for verification. Weedit letters for brevity, grammar, taste and legal reasons. Wereject poetry, personal attacks, form letters, letters submitted elsewhereandthose appropriate for other sections of TheBulletin. Writers are limited to one letter or Op-Ed pieceevery 30 days.

In My View submissions should be between 550and 650 words, signed and include the writer's phone number and address for verification. Weedit submissions for brevity, grammar, taste and legal reasons. Wereject those published elsewhere. In My View pieces run routinely in the space below, alternating withnational columnIsts. WrIters are limited to one letter or Op-Ed pieceevery 30 days.

Please address your submission to either My Nickel's Worth or In My View and send, fax or email them to The Bulletin. Email submissions are preferred. Email: letters©bendbulletin.com Write: My Nickel's Worth / In MyView P.O. Box 6020 Bend, OR 97708 Fax: 541-385-5804

Fire levy a small price to pay for safety of mmmunity By Al Dertinger he people of Bend and the De-

IN MY VIEW

T District No. 2, have an opportunity to vote and approve a five-year

50 was approved, limiting the amount

schutes Rural Fire Protection

of property taxes, the amount of income for the city operations was

operating levy that would strengthen somewhat fixed. During that same their safetyby a dedicated and profes- time, operating costs for the city and sional organization. One of the goals Bend Fire were increasing more than of the men and women of Bend Fire and the Fire Protection District No. 2

the allowable tax rates. As a result, in the next two years, the Bend Fire De-

Passing the five-year levy will be the first step in the process to insure that Bend Fire and District No. 2 meet the expected reliability of the people they serve. This will

allow Bend Fire to increase the staffin the fire stations, thus increasing the number of crews available for all cal/s.

due to the fact that there will be more than one crew per station and they

can respond to a call closer to their station instead of bringing a crew across town to respond. The next step after the levy will to begin work on a plan to secure a permanent long-term

funding solution, as asking for fiveyear levies is not a positive approach. The voters of Bend and the coun-

is to improve response times, thus sav- partment could go from operating in ing lives and property. This can only the black to operating in the red. be accomplishedby increasing fire During the past two years, there department personnel and apparatus. have been several occasions that

Last year, a feasibility study was same size, Bend fell below all others produced to review the current sta- in staffing, response times and area tus of Bend Fire and District No. 2 coverage. Over the past five years, response due to demand for fire and EMT as to current and future funding, rePassing the five-year levy will be times have been creeping up forvar- calls within the same period of time, sponse times and comparisons with the first step in the process to ensure ious reasons. As the population of response crews were tapped out other Oregon cities of comparable that Bend Fire and District No. 2 meet Central Oregon has increased, thus and backups from other fire depart- size. The study concluded that a in- the expected reliability of the peothe demand on fire and medical calls ments were on standby status for fusion of funds would be required to ple they serve. This will allow Bend has also increased. During the same time, staffing has decreased due to

possible calls into Bend and District

meet the demand of the area through

Fire to increase the staff in the fire

No. 2. Again, this was due to the rebudget cuts, increased costs and lim- ducedstaff ing brought on by budget

a levy and/or a long-term permanent stations, thus increasing the number funding. In comparing Bend Fire to of crews available for all calls. With

ited income. Back when Proposition

demands.

other departments in cities of the

that, the response times will improve

ty around Bend have approved past bonds and levies for improved roundabouts, schools and a park system that is second to none in the state. Now is the time to protect that which is most important, our lives and prop-

erty. With two retiring bonds this year, the fire protection levy will be almost cost neutral, with a slight in-

crease of .06 cents per thousand over the prior two bonds. A small price to

pay for the safety of the community. — Al Dertinger lives in Terrebonne.

THURSDAY, APRIL 10, 2014 • THE BULLETIN

WEST NEWS

Nevadapeakmaytake Reagan'sname

BITUARIES DEATH NOTICES

Baird Memorial Chapel, La Pine www.bairdmortuaries.com Services: Bill requested that there

be no services.

Contributionsmay be made to: Heart 'n Home Hospice PO Box 3540, La Pine, OR 97739 (541) 536-7399 www.gohospice.com

William Joseph Dewhurst, of Bend Dec. 29, 1959 - Mar. 9, 2014 Arrangements: Autumn Funerals of Bend 541-318-0842 www.autumnfunerals.net Services: 2 PM to 5 PM on April 12, 2014 at The Spiritual Awareness Community, 157 NW Franklin Ave., Bend.

Obituary policy Death Notices are freeand will be run for oneday, but specific guidelines must be followed. Local obituaries are paid advertisements submitted by families or funeral homes. Theymaybe submitted by phone, mail, email or fax. TheBulletin reserves the right to edit all submissions. Please include contact information in all correspondence. For information on anyof these services or about the obituary policy, contact 541-617-7825.

Deadlines: Death Notices are accepted until noon Monday through Friday for next-day publication and by 4:30 p.m. Friday for Sunday publication. Obituaries must be receivedby5p.m. Monday through Thursday for publication on the second day after submission, by1 p.m. Fridayfor Sunday publication, and by 9a.m. MondayforTuesday publication. Deadlines for display ads vary; pleasecall for details. Phone: 541-617-7825

Email: obiis©bendbulletin.com Fax: 541-322-7254

Mail:Obituaries P.O. Box6020 Bend, OR97708

DEATHS ELSEWHERE Deaths of note from around the world:

Wayne Henderson, 74: A trombonist, composer and co-founder of the Jazz Crusaders, who became a pow-

— From wire reports

Reagan, the nation's 40th president. The Assoaated Press file photo

located just east of Las Vegas, after the nation's 40th David Grunfeld / NOLA.com /The Associated Press

James Hellwig, better known as The Ultimate Warrior, performs for the audience during WWE Monday Night Raw at the Smoothie King Center in New Orleans on Monday. The WWE said Hellwig, one of pro wrestling's biggest stars in the late1980s, died Tuesday at 54.

The UltimateWarrior, one of pro wrestling's most colorful stars By Dan Gelston The Associated Press

ment empire until 1996. The Ultimate Warrior be-

The Ultimate Warrior put on came the first wrestler to dehis signature airbrushed trench feat Hogan in a WrestleMania coat, shook the w h ite r i ng match in 1990whenheused his ropes, and, for a few fleeting finishing running splash for the minutes, the wrestler billed as pin. He won the championship hailing from Parts Unknown in front of 67,678 fans at Toronwasbackhomeinthewrestling to's SkyDome in a match billed as "The Ultimate Challenge." rmg. "It's one of the great Wrestle"Speak tome, Warriors!" he bellowed on Monday night's Mania main events ever," for"Raw", back on TV

mer WWE star Sean "X-Pac" Waltman

a fter a n 1 8 -year F E A URED T absence. said Wednesday. OBIT He soaked up the T he Ultim a t e applause from a New Warrior would deOrleans crowd chanting his feat Savage the next year at name and pulledout a neon WrestleMania. mask that replicated the face Savage, who died in 2011, paint he wore in the ring for Hogan and Warrior were all every main event battle with

enormous personalities with

Hulk Hogan and Randy "Ma- gaudy costumes and memoracho Man" Savage in the 1990s. ble catchphrases. They led the

president. The House Natural Re-

sources Committee approved Heck's bill by voice ing up legislation dealing with vote Wednesday, but not global warming. beforesome Democrats on Republican members of the the committee had fun with committee played along. "If the gentleman would inthe issue. Democratic Rep. Pete De- troduce legislation, I would Fazio of Oregon said a more guarantee that he'll have a fitting tribute would be to hearing on that bill," said Rep. name Yucca Mountain af- Doc Hastings, R-Wash., the ter Reagan. Steps taken to chairman, in response to Huffdevelop Yucca Mountain as man's idea for renaming the a nuclear waste repository

accelerated during Reagan's presidency. Nevadans are overwhelmingly opposed to the proposed waste repository and members of the state's congressional delegation have worked diligently to kill it. "If we were going to name something after the president, it ought to be some-

Ronald Reagan Parkway. California has at least two parks and seven elementary schools

named after Reagan. North Dakota even hasaformer intercontinental ballistic missile site named in his honor. But a mountain'? Well, the state of New Hampshire renamed Mount Clay to Mount

Reagan, but the U.S. Board of Geographic Names, the official scorer of geographic ed DeFazio' s amendment and nomenclature, declined to go went onto pass thebill. along, citing a reluctance to Reagan's name is ubiquitous. change a long-standing historA long list of landmarks, build- ical name. ings, highways and schools In the end, however, the final bear his name. Virginia has say on geographic names goes Ronald Reagan International to Congress. Airport just outside the naHouse passage of Heck's bill tion's capital. Indiana has Ron- is expected. The Senate is anald Reagan Expressway and other story. earth. The committee then reject-

thing that actually had to do

with the president's service in office, and something the

ALL,NEW STATEOF THE ART DEALERSHIP(

president supported that

was extraordinarily significant to the state of Nevada," DeFazio said.

Rep. Jared Huffman, D-Calif., said he thought "terrific" but wanted to take it a step further and name "We may want to consider going big with this Reagan-naming enthusiasm," Huffman said. "I'm beginning to see some possibili-

how much he appreciated his

a promotion running week-

return to the WWE. Less than 24 hours later, W arrior, one of the most color-

end arena shows and Saturday

ing was that if the planet

morning TV into one booking events at the largest stadiums

were named after Reagan, then Republicans might be

ful stars in pro wrestling histo-

around the world with millions

more concerned with tak-

ry, was dead. He was 54.

watching every Monday night.

VOLVO SEDANSAHDSUV'S

the planet after Reagan.

WWE's transformation from

SUPERIO RSELKTIONOFNEW8 USEO

DeFazio's amendment was

Warrior cut a promo to show

•]

t •

•

f ]

I '

ties in this."

Huffman said his reason-

SMOLICHVOLVO.cow

"We are all grateful to have More than 5.1 million viewers had the opportunity to get the watched Warrior's final appearclosure with him, to work to ance Monday night on"Raw." get him back on that platform," The WW E s aid W a rrior, said Paul "Triple H" Levesque, who legally changed his name a wrestler and top WWE exec- from James Hellwig to his utive."Knowinghimnow, there wrestling moniker, died Tuescould have been nobetter send- day. Scottsdale, Ariz., police off, really, for him, than that. It spokesman Sgt. Mark Clark was everything he would have said he collapsed while walkdreamed of." ing with his wife to their car at After ending his estrange- a hotel and was pronounced ment with the company, War- dead at a hospital. rior was in the spotlight again There were no signs of foul earlier this week, making ap- play, Clark said. The Maricopa pearances at WrestleMania 30 County Medical Examiner's and on "Monday Night Raw," Office will conduct an autopsy and he was inducted into the today, county spokeswoman WWE Hall of Fame. Cari Gerchick said. His last promo on WWE's

flagship show seems almost eerie now with his triumphant return overshadowed by his sudden death.

Wrestling's reaction WWE Chairman Vince McMahon tweeted: "We are all so sad the Ultimate Warrior

"No WWE talent becomes has passed away. Our heart is a legend on their own," War- with his wife Dana and his two rior said. "Every man's heart daughters." "Vince said to him a couple one day beats its final beat. His lungs breathe their final breath. of days ago, 'I've always loved And if what that man did in you. Sometimes, I didn't like his life makes the blood pulse you, but I always loved you,'" through the body of others, it Levesquesaid. makes them bleed deeper and Warrior a n d M cM a h on something larger than life, then posed for a picture Monday his essence, his spirit, will be night that Stephanie McMahon immortalized." tweeted, "Never say never."

larger than life

s kyrocket the WW E i nto a mainstream phenomenon in

audience, Warrior was a per-

ation in 1987 and wrestled on and off for the sports entertain-

9th Annual

ITIQdQ

Title sponsor:

HEALTH

Waltman attended the Hall

of Fame ceremony and saw The Ultimate Warrior per- Warrior before he went on the sonified the larger-than-life stagetom ake hisspeech. "I got a sense he wasn't well," cartoon characters who helped

one of the country's most mil- fect fit with a spastic entrance, itant atheist organizations. blood-pumping music,fl owDied March 28 at his home in ing locks and always dressed Union, Ky. in electric colors from head to Peter Matthiessen, 86: Au- boots. thor and n a turalist w h ose His rambling, incoherent life of adventure and spiritual promos both energized and questing is woven throughout confused fans, and Warrior his many acclaimed books, would often stare down at his including "The Snow Leop- hands as he spoke, as if he was ard," "At Play in the Fields summoning magical powers of the Lord" and a trilogy of out ofhis fingertips. novels set in the wilds of FlorHe made his debut with the ida. Died Saturday at a hospi- promotion when it was known tal near his home in Sagapo- as the World Wrestling Federnack, N.Y.

name a part of Frenchman Mountain in Nevada after Ronald

of Frenchman Mountain,

erful force for merging the the late 1980s and early 1990s. sound of jazz with elements W arrior dressedin facepaint, of funk, soul and R&B. Died had tassels dangling from his Friday at a hospital in Culver super-si zed biceps and sprintCity, Calif. ed to the ring when his theme Edwin Kagin, 73: The son music hit. He'd shake the ropes, of one minister and father of grunt and howl, and thump his another, who saw religiosity chest while the crowd went wild creeping into the public do- for the popular good guy. main and fought against it In an era when the WWE in a dual role as head lawyer targeted kids as its primary a nd j ester-provocateur f o r

bill that would

recognized by the federal government anyway. Now, Republican Rep. Joe Heckof Nevadais pushinga bill that would name a part

Scanlon, of La Pine Arrangements:

is pushing a

him is a mountain, not one

be no services.

Sept. 2, 1936 - Dec. 30, 2014

Heck, R-Nev.,

About the only thing former President Ronald Reagan doesn't have named after

April 22, 1931 - Mar. 29, 2014 Arrangements: Baird Memorial Chapel, La Pine www.bairdmortuaries.com Services: Bob requested that there

www.gohospice.com William "Bill" Lee

Rep. Joe

The Associated Press

WASHINGTON

Robert "Bob a S. Hoblitzell, of La Pine

Contributions may bemade to: Heart 'n Home Hospice PO Box 3540, La Pine, OR 97739 (541) 536-7399

By Kevin Freking

Waltman said. "It was sad to me. He was kind of hunched

Scoreboard Sponsor:

•

BEND RESEARCH' ACHIEVE VALUE THROUGH SCIENCE

Dining Sponsor:

over. He used to have such great posture. You just had this sense that he wasn't well. But

he was ingreat spirits. He came up to (other wrestlers) and gave them hugs." The Ultimate Warrior had a falling out with the WWE over

Round Sponsors:

•

various issues, including money, and did not appear on its TV shows after July 8, 1996, until last weekend.

Levesque said he spent 18

•

months getting to know War-

•• •

•

I •

rior and both sides put hard feelings aside to bring himback

into the WWE fold. He said

Warrior was like a"kid reborn" to headline Saturday night's

•

Media Sponsors:

Hall of Fame dass.

•I •

Warrior was the only Hall

••

•

of Famer feted with his own moment on Monday. His final

words to the crowd are ones wrestling's fanatics will surely take to heart. "The spirit of The Ultimate

Warrior will run forever," he sald.

•

C ••• •

FOol 'l'IDe/nl lgeN

TH E BULLETIN• THURSDAY, APRIL 10, 2014

'''

• B'

eg h

I Today:l~

Tonight:I

Sunny

Mostly clear

LOW

FORECAST:5TATE Hood River

QPOrtland 67740 The Dages• 67/40

Lincoln Ci 54/40

FV 66/

Warm 7/36 Camp Sherman

eW cp

e 67/4

6 8

Ruggs

6/31 • Grande • . Unio I/34 36

• 65/40 on

• Spray

Granite • 61/34

67/36

• Madras

58/ I

Ashland

•

Joseph 58/31

' Baker City 65/32

Mitchell

•

• Lakeview 68/34

CENTRAL

70/36

4 v~ancouver ~calgary . '

(in the 48 contiguous states):

• 101'

Asroria Baker City Brpokings Bums

Death Valley, CA • 7

': -

. . .

. .

;

La Pine lakeriew Medfprd Newport North llend Ontario Pendleton Portland PrineviBe

Redmond Roseburg Sah

Sisters Lakeview AWSThe DaBes

[gg5] ~9 QS ~]OO ~ euebe«

• 44P/32 Bis marck 59/30 • St l paugi Green Bay 6135" Detroit .... Rapid1City--------',59'/42

Mt. Washington, N

SanlFrancisco

, Cheyenne,

" . . .

lHa lifax

• p rtl d Teionto' Bosfon'. ""' ew York

•

' . ' : -

-' )Philadelphia

'-• Chihago Omhha ' :. Columbus' "-:f '4 ": 67/44 •:,......-----;62/40; r ) 'c ShltlLake City j O / 49r/ Washington, DC Lras y~egas, / g k /Stl,: L Denver Ka nsas City ', e'"5t.ILouis.Ke Louisvill'e Charloge 68/42 i 6 9/49 "yt/51 Bt/661•,, , i 75754 • cys/49 -'c-Leklaho~ma City LTos' An ~ geles : Nhs vi e„ ' • 69/52~ : . " 7 ' I... "7'6/'53 ' A't l allta o 5770/66 • H Albuquesquo L 73/47 80/55 • : lPhoenix.' LBL/248 Tijuana ". B)sminghaini 98/69 7 LDa'Has 84/53 L Orlando

• 0.36u

•

Portland, OR

. .

' "

Honolulu 6.D 74I67

•

'Chihualiuai n 86'/53,

HAWAII

: pL — '

•

wl59 '

: -

~ Houston

Mazatlan' 4

A'nehorage

82/59'

[Mpntenr ey

-":~

73749

New 0'rleans 75/58

79761

79t61

80/70

837/573

LaJPaz

38/16

Juneau 4'4'/32

89/62

ALASKA

COCC Continued from B1 The second involved cutting spending instead of raising tuition, a move that would likely affect instructional staff.

lOi

EKI REPORT

ULTRAVIOLET INDEX

56/42 f 65/30 pc 58/41 s 69/31 s 65/38 f 70/36 s 65/27 s 68/34 s 78I45 s 55/41 pc 61/4O s 69/4O s 65/38 pc 64/42 f 65/31 s 65/31 s 72/40 pc 64/4O f 63/31 s 68/41 pc

Ski report from around the state, representing conditions at 5 p.m. yesterday: Snow accumulati ons in inches Ski area Last 24 hours Base Depth Anthony Lakes....................... N/A (closed) Hoodoo................................ 0" ...............48 - 55" Mt. Ashland.........................NIA(closed) Mt. Bachelor........................ 0" ...........120 -160" Mt. Hood Meadows............. 0" ...........124 -160" Mt.HoodSkiBowl...............0"...............26-37" Timberline............................1" ............. 73 - 123" Willamette Pass................... N/A (closed)

54/43 pc LOW M E DIUM HIG H IGH 67/32 pc 59/42 s 0 2 4 6 8 10 6881 pc 65/40 pc 72/34 s Snow level and road conditions representing condi65/29 pc tions at 5 p.m. yesterday. Key: T.T. = Traction Tires. 7086 s Pass Conditions 78/44 s 55/41 pc 1-5 at Siskiyou Summit.................. Carry chains / TT. 61/43 s 1-84 at CabbageHill......................Carry chains/T.T. 73/42 Hwy. 20 at Santiam Pass.............. Carry chains / T.T. 69/38 pc Hwy.26 atGovernment Camp.....Carrychains/T.T. 63/43 pc 67/32 pc Hwy. 26 at OchocoDivide.............Carry chains / T.T. 67/32 pc Hwy. 58 at Wigamette Pass.......... Carry chains / T.T. 74/4O s Hwy. 138 at Diamond Lake...........Carry chains / T.T. 64/40 pc Hwy.242 atMcKenziePass..........Closedforseason 67/32 pc For up-to-minute conditions turn to: 7IV40 pc

ROAD CONDITIONS

Aspen, CO............................O".............66-111" Mammoth Mtn., CA.............O"...............45-75" ParkCity, UT........................O"...............85-85" Squaw Valley, CA.................O"...............24- 81" Sun Valley, ID.......................0"...............29-57"

Taos, NM............................... N/A (closed) Vail, CO................................O"...............73-73"

For links to the latest ski conditions visit: www.tripcheck.com or call 511 www.onthesnow.com Lnlend:W-weather,Pcp-precipitation,s-sun, pc-partialclouds,c-cluds, o h-haze,shehpwers,r-rain,t-thunderstorms,sf-snowflurries,snsnow, i-ice, rs-rain-snowmix,w-wind,f-fog, dr-drizzle, tr-trace

0 ' "

56/38 0.07 59/41 61/46 66/31 63/50 0.02 67/46 60/29 66/34 76/45 53/42 -I7$53 63/50 62/44 0.36 61/39 62/34 6$50 64/47 0.04 60/42 66748

Eugene KlamathFalls

Thunder h d Bay

lBigings 62/38

,'*

Firs t

Yesterday Thursday Friday The higher the UVIndex number, the greater City Hi/Lo/Pcp Hi/Lo/W Hi/Lo/W the need for eyeand skin protection. Index is for solar at noon. Precipitationvaluesare24-hourtotaIs through 4 p.m

5 0/30) • 5'askat'oon 50/30

,/ I

/ Portlandl

New

TEMPERATURE PRECIPITATION

Tomorrow Rise Set Yesterday through 4 p.m. at BendMunicipal Airport Mercury..... 8:58 p.m..... 9:14 a.m High/Low.............. 59'/33' 24 hoursending4 p.m.*.. 0.00" Venus......... 7:40 p.m..... 6:37 a.m Remrdhigh....... 82'in1985 Monthlodate.......... 0.14" Mars.........10:01 a.m..... 9:28 p.m Remrdlow.........12' in 2010 Average monthto dale... 0.20" Jupiter........ I:50 a.m..... 5:11 p.m Averagehigh.............. 58' Yeartodate............ 3.68" Saturn.......12:58 p.m....10:55 p.m Averagelow............... 28' Averageyeartodate..... 2.48" Uranus....... 9:04p.m..... 9:51 a.m Barometricpressure4 p.m. 30.10" Remrd 24hours .. 0.18 in 1992 *Melted liquid equivalent

TRAVELERS' FORECAST NATIONAL

p g ~ 05 ~] Q S ~)05 ~30 ~ 0 5 ~ 5QS 6p5 ~ 7 5 Iss/at

L as t

REGON CITIES

Mostly sunny. Highs 59 to 64. Southwest wind 5 to 10 mph.

McDermitt • 67/43

Fields 65743

PLANET WATCH

Apr15 Apr 22 Apr29 May 6

NATIONAL WEATHER SYSTEMS

Yesterday's extremes

58 34

Moonrisetoday....3:23 p.m.

nrty 65/34

Klamath Fal

72740

4 O5 ~35 ~2 5

HIGH LOW

67 36

• 59/29

•

HIGH LOW

63 32

Sunsettomorrow... 7:44 p.m.

Ontario EAST e 65/31 Paulina a 63/31 edmond d Vale 68/40 Florence Eunene • 63/29 •• Mostly sunny. 65/32 68/41 • 63/41 g/38 Highs 65 to 71. • Sunriver • Ben e rpthen Burns Nyssa 63/34 /31 West winds up to 67/34 eluntura Cottage Grove Oakridge 63/27 68/41 65/36 10 mph. 70/36 67/ scent Lake• • Hampton • Riley goos y 63/40 6 7734 rescent 61/ 67/31• Fo Rock Yesterday's echristmas Valley • Bandon Roseburg Jordan Valley • 58 /41 70/29 Chemult 72MO 65/38 • stateextremes Ilver Lake 65/25 Frenchglen Po~edor 70/29 • 72/36 • SB I43 • Paisley Rome • 76' ass Chiloquin 70/38 65/38 7940 Medford Gold 8 h 67/31 Medford ' 59/ • 74/41 ' 30' rS •

Broo ngs

HIGH LOW

Sunsettoday...... 7:43 p.m. Full Sunrise tomorrow 6:28 a.m

agowa

Partly d-dy

65 34

Sunrise tpday...... 6:30 a.m. MOOh phaSeS

Partly sunny becoming mostly Pendl e to sunny. Patchy • 65OB morning fog. Me cham • Enterprise

A,gn ton

Willow le

Albany Alban

55/4

•

Maupj Government amp 54/34

63/40

Newport PI • Yachats~ 56/43

64 / 4 2

Umatiga 67/38 Hermiston • 67/38

Sunny

HIGH LOW

SUN AND MOON SCHEDULE

WEST

> boro Q Tillamppk • H P3/38 e 52/36 Mdhli nville 61/40

Sunny

BEND ALMANAC

• Astoria

56/42 Seaside 56/41 • Cannonheach i

Partly i-dy

•

FRONTS Cold W arm Stationary

CONDITIONS *** * * 4 d 4 ' * *** * *

c4 x

: a c ch

+er+er+

Showers T-storms Rain Flurries Snow

Ic e

"t have a big concern about student debt. It's a drag on the economy; these students can't go out and buy cars."

City

YesterdayThursday Friday Hi/Lo/Pcp Hi/Lo/WHi/Lo/W City

Abilene, TX

88/48

SCISBpc 87/60 pc 68/ce sh 57/40 sh 61/43 pc 63/37 pc 81/48 pc 79/SZpc 3707 s anr24 s 73/47 s 75/52 s AehmcCay,m 65/36 61/Sp pc 68/45 sh Austin, TX 84/45 83/61 pc 83I65 pc Baltimore, MP 66I36 7OIS1 pc68ISOIs Billings, hrr 73IS1 62/38 pc 67/39 pc Birmingham,AL 7PI47 73/49 s 75/53 pc Blsllwrck No 78I32 59I30 pc 6SI35 pc Boise, IO 70/44 68/44 pc 71/43 pc Bostorx MA 59/43 SS/45 pc 61I44sh Bupalo, NY 4!I32 62/38 pc 56/38 pc 46I36 0.05 Ss/38 pcSBI35 pc Burii~,Vr Caribou, 646 42/34 0.05 46/35 pc 5$34 pc Casper,WT 71/43 63/34 pc 69I38 pc Charleshvs SC 76IS3 76IS2 s 78/56 pc Charloue, NC 68/46 75/49 s 77/53 pc Chauarooga,TN 68I47 75/49 pc 76IS1 pc Cheyenne,WT 73/49 64/37 pc 78742pc Chicago, IL 62I33 62I4P sh 63/43pc cincinnati, OH 62/48 P.02 7451 pc 62/45 ts Cleveland, PR SZ/40 67/38 sh 51/41 sh Colo. Spps,CP 77/38 6$40 pc 72/43 pc Columbia, hto 69/37 72/47 pc 71/52 Is Columbia, SC 73/47 76I48 s 80/52 pc Columbus,6A 72/Sp 75/49 s 7852 s Columbus,Oa 60/44 70/49 pc 60/43 sh Conmrd, NC SZ/31 0.02 6PI37 pc 67/38 pc CorpusChnsri, 1X 85/49 83/65 s BCI68 pc Dallas, TX 81/44 83/59 pc 79I62 pc 6$38 68/Sp pc 62/45 sh phrlorc pu Denver,Cp 76/47 68/42 pc 78/49 pc Pes Moines,IA 76I32 67/43 pc 72/SZ pc Detroit, Ml 57/36 67/38 sh 6OI41 pc Duluth, tun 55/30 51/32 pc 54/33 sh 8 Paso, TX 87/50 Srrsz pcBSI61 pc Fallbhhkc AK 18/-12 31/4 pc 37/5 pc Fargo, NP 78I37 57/34 pc SS/39 pc Flagstaff, AZ 71/27 71/34 pc 68/34 pc

Akron,On

5437 Albany, NV 5187 Albuquerque,NM 81/44 Anchorage,AK 314 6 Arhhta, 6A 67/48

YestenlayThursday Friday Hi/Lo/Pcp Hi/Lo/WHi/Lo/W City

YesterdayThursday Friday Hi/Lo/Pcp Hi/Lo/W Hi/Lo/W City

Grand Rhpids,IA SBI34 57I36 sh 62/41 pc Rapid Chr, SO 79/40 owm Bhr,ru 56/31 6OI33 sh 61/38 a R eno, NV 77 / 4 7 Greensboro,NC 68I47 73/48 s 75/51 pc Richmond, VA 69/51 Hamsbvrg, PA 63/37 68I49 pc 65/44 sh Rochester, NY 49/31 Hanrord CT 59/38 62/44pc 63/42 sh Saaammhx CA 81/SS Helena, MT 61 /47 62/37 pc 6$35 pc Salt LakeCity, UT 79/55 Honolulu, nr 88/70 74/67 pc 82/67 pc ShhAntOniOTX , 87746 HovshvsTX 81/44 79/61 pc 79/64 pc Shn Diego, Ch 82/61 Huntsville, AL 66/39 75/49 s 75/SZ pc Sap Francisco, CA 64/52 Indianapolis, IN 61/36 7$47 Is au45 sh Ssp Jose, CA 75/56 Jackson,MS 78/41 7861 s 78/58 pc Sapta re, Ntu 75/30 Jacksonville, FL 74I51 77/51 s 78/SS pc Savannah, 64 75/SP Juneau,AX 39/33 P.14 44/32 sh 4Sna s KansasCity, Mp 7SI33 68I47 pc 72/53 pc lansing, Ml 57/31 SS/36 sh 63/41 pc Amshvdem 5 5 / 44 Las Vegas,NV 92/64 91/66 pc 89I64 pc Athens 69/44 Lexinplpn, XY 64/41 0.06 74I52 pc 66/52 rs A uckland 73I 6 4 Lincoln, NE 84/33 67/43 pc 73/52 pc B aghdad BO 6 2 Liule Rock, AR 72/39 88/SS pc 7SIS7 pc Bangkok se / 80 tps Angeles,CA 76I57 70/56 f 67/SS I Beijinp 89I53 Louisville, XY 65/41 0.03 75/54 pc 66IS3 rs Beirut 69I60 Madison, Wl 64/28 62/37 sh 64/44 pc Berlin 53/41 Memphis,TN 68/43 78IS9 pc 77/61 pc Bogota 68/48 Miami, FL 787670.12 80/70 pc 82I72 pc B udapest 57/ 4 2 Milwaukee,Va 62/30 O.PZ SS/38 sh 61/43 pc BuenosAires 75/60 Minneapolis,MN 71/35 SBI42 pc 65/42 sh CaboSanWcas 91/71 Nashville, TN 69/44 0.04 76IS3 pc 75/SS pc Cairo 75/59 Ncw Priemc LA71/48 75/58 s 76I63 pc Calgary 51/32 New YomNY 61/45 63/50 pc 65749sh chhcuh 78/57 Newark, NI 65/44 63/49 pc 65/49 4 Dublin SS/44 Norfolk, VA 6ZIS1 7OIS2 s 75/SS pc E dinburgh 55 / 46 Okla. Orr, PK 82/39 83I56 pc 82/SS pc Geneva 60/39 Omaha, NE 80/34 67/44 pc 73/51 pc Harare 68/55 priahdo, FL 75/58 0.32 79I57 pc 8061 pc Hong Kong 8 0 /69 PalmSprings,CA BBI67 97/69 pc 91/62 pc I stanbul 62/4 6 Peoria, IL 65/37 66I41 sh 66I47 pc J erusalem 73 / 59 -IPhiladelphia, PA 66I42 67/52 pc 69I49 sh Johannesburg Phoenix, Az 95/65 88/69 p< 97/68 pc lima 75/62 Pirlsburgh,PA 58/38 68/46pc 62/40 sh Lisbon 73/60 Pprshhd, 146 53/32 49/40 pc SBI40 pc London 62I41 npvtdench Rl 61/39 Suac s 6PI43 sh Madrid BQ I48 Raleigh, NC srv48 0.06 74/48 s 77/53 pc Manila 93/78

YesterdayThursday Friday Hi/Lo/Pcp Hi/Lo/WHi/Lo/W

61/37 Is 72/43 pc Shhere, Wa 58/44 O.P1 58/44 pc 6$45 pc 76I42 pc 76/44 pc Sioux Falls,SO 81/38 6 2 /41 pc 7rr47 pc 74/St s 78IS4 pc Spokarw,WA SBI40 6 C/43 pc 63/37 pc 68lap pc 59I37 pc Springfield,hzo 71/33 7S I53 pc72/55 rs BSIS2 pc 82ISO pc St. Ipvis, Mp 69/38 75 / 49 pc70/52 Is 7151 pc 77/54 pc Tampa, FL 71I600.06 79/60 pc 82/64 pc 85/60 pc 8$67 pc Thcsoh, AZ 92I55 9 4 I60 pc 92/59 pc 68/59 I 68ISB I Tulsa, PK 88/34 B SI53 pc 79IS9 pc 63/51 f 59IST I WashIpphvx pC 69/44 7 1 IS3 pc 71/53 rs 77/51 I 72I49 Wichita, KS 82/36 75 / 49 pc76ISS pc 78/37 pc 76I42 pc Yakima, WA 69/44 66 / 36pc 69/38 pc 77/51 s 79/55 pc Vuma, AZ + SS / 69 pc 97/62 pc

INTERNATIONAL 59/42 pc Mecca 66lsp pc Mexico Cicr 73/60 Is Montreal 87/62 pc hzoschw 86/78 pc 36IBP pcNhirha 8453 s 68/41 pc Nassau 71/57 s 73/53 pc New Delhi 53/41 r Sp/37 pc Osaka 68/46 rs 68/46pc Oslo 57/41 pc Ottawa 71/60 s 69ISS pcParis 86I73 s 89I73 s Rro deIaneiro 78/SS s 77/59 cd Rome 50/30 r 51/32 s Sapehgo 78I68 pc BQI71 pcshp Pahlh 37/41 pc 51/37 pc Sapporo 53/44 pc 53/37 pc Seoul 62/39pc 6$41 s Shanghai 71/53 Is 69ISS Is Singapore 75I69 pc 77/68 pc Stockholm 66ISI s 62ISO s Sydhcy 75/SS s 71ISP pcTaipei 68I48 pc 68IS1 s Tel Aviv 73I62 pc 73/64 s Tokyo 71/53 pc 69/51 s Vancouver 59/42 s 60/44 s Vienna 78ISO pc80/51 s Warsaw 96I75 Is Stna p 57/44 s 68/57 s 73/60 Is 87/64 s

102/82 7SIS1 41/32 41l24

10OI84 s 1PM!Z s 75/46 pc KIS3 pc 39/32 s 64739pc 41/22 pc 39/22 pc BPIS7 pc 7759 pc 80/68 pc Be/69 pc 88/68 s 91/64 s 71/37 s 62I37 pc 44/41 r 46/46 r 41/32 s SS/JS pc

88/st 78/71 91/64 71/46

sc/44 41/30

SS/42 cd su46 s 87/73 pc 86I71 Cs

sc/41 84/75 71ISS 77/44 86/69 48I48 53/42 75/55 95/73 41/30 75/60 73/68 73IS9 64IS3 51/44 SS/48 St/42

71/4i s 6$42 s 75748pc 73/46 pc 89/68 pc 86%8 pc 39/3P r 35/32 r 6IV46 s 64/48 pc 73/51 pc 77IS1 s 91/73 rs 93/71 s 41/28 r 44/33 s 68I66 r 80/64 Is 75I66 Is 75/66 pc 73ISS pc 71/51 r 71/44 s srr44 pc SS/41 pc 53/44 pc SSI42 pc 51/35 r 51/37 r 31/33 r

PREMIUM HEARING AIDS ' Fwf Iy rinnw

— Charley Miller, COCC board member

The third option involved l e s s c o nservative terizing the second as the least attractive. The board had i n dicated positive balances for the next last summer it was consid-

would happen following an unexpectedly high decrease

two years or so. "I have a big concern about

ering a tuition increase, but the state increased funding to

a later tuition rate hike then would have to be more dras-

student debt," said Charley Miller, a board member. "It's

community colleges during the 2013 special session.

tic than if a minor raise was passed now.

taking a

approach with the college's reserves while still projecting

a drag on the economy; these students can't go out and buy

I n-district tuition had i n -

in revenue, due to an enroll-

ment dip or less state funding;

cars." The board and committee before then, it was held flat. we need it," said board memmembers largely supported The major reservation exber Laura Craska Cooper. the third option, which ulti- pressedby budget committee — Reporter: 541-633-216(), mately passed, while charac- m embers c oncerned w h a t tleedsibertdbulletin.com

Commission

Throop said he is running for the board of commission-

Continued from B1

ers becausehe is interested Brown is in his second term in being involved in county on the Madras City Council. government. "I think I have a wide range Huston works i n c u stomer service at Hfl'cR Block in Ma- ofli fe experience to do a good dras. The three canjob," he said. didates are vying for Brown, w h o has the seat held by John owned Coach Works ColH atfield, w h o

i s n't

running for re-election after two terms.

Brown said he of- Brown fers voters the most

local government experienceofthe candidates. Before joining the City Council he was on th e M adras

Planning C ommis- Huston sion for seven years. "I think m oving into the county (government) would be kind of a natural progression,n he said.

Huston, formerly a Throop licensed tax preparer, said when she found out

Hatfield wasn't running for re-election she went on a per-

STAY CONNECTED

"It is true that if we don't

creased every year going back raise it this year, we will have to 2009-10. For the three years to make a bigger raise later if

at Factory Direct, Retail Outlet Prices! Freedom SIE

$399

$400 REBATE!

(Madras),n she said. Jefferson County is bouncing back from the economic downturn, an d

5799 due at time of purchase. Rebate processed30 days after invoicing. Offers Trolid through April 30, 20 74 or while supplies last.

t h e c a n di-

dates offer differing takes on the role they would play in the recovery if elected.

Throop said he'd become educated on the situation by meeting with leaders iri other

cities and counties. "Arid find out what we can since 1976 and Deschutes Adjusting Co., also in do to help business already Madras, since 1986, said here to maintain and how do he would rely on his on we encourage other businessbusiness management es to come to Jefferson Counexperiences if elected to ty," he said. county leadership. Brown said he would try to "This really is a busi- build on recent development ness," he said. and new businesses at the W hile Throop h a s Madras Airport. "It will give us more of a been in Jefferson County since 1983 and Brown chance to be discovered," he nearly his whole life, sard. lisiori Repair in Madras

All Hearing Aids lnclude FREE: Hearing Test, 3 Year Repair Warranty, 1 Year Loss & Damage Coverage, Start-Up Accessories and ln-Oflice Adjustments -

•

mine how to attract and keep jobs in Jefferson County. "I don't h ave a n

ax t o

grind," she said. "I just want to serve everyone in the county."

sonal mission to find a fiscal T he nonpartisan vote i s conservative to replace him. "outsider," but embraces that May 20. Throop, Brown and As she did people asked her, said it gives voters a chance Huston are vying for county N Why dOn't yOu run? n SO She to bring some "new blood" to commissioner position No. l. decided to. the board of commissioners. The winner will serve a four"I would like to see contin"I want to work for all the year team, starting Jan 1. ued sensible money manage- residents of Jefferson County — RePorter: 541-617-7812, ment at the county," she said. not just the people in the city ddarling@bendbulletift.com

Get ATaste For Food, Home & Garden EveryNesday In AT HOME

•

A•

•

H uston m o ve d t h e r e H uston said s h e w o u l d from Gresham in 2005. work with the other commisShe and her husband sionerson the board to deter-

bought a house in Culver in 1998 and spent weekends there until moving over completely seven years later. Huston acknowledges that she may be seen as an

O'.

•

Ameriea Hears HEARING AIDS Helpiny People Hear Better

5 41-213-22 9 4 Monday through Friday 9:00 am to 6:00 pm Saturday by appointment 547 NE Bellevue Drive Suite ¹10 5 B e nd, Oregon

vheeree

+at so

www.americahears.com

IN THE BACK BUSINESS Ee MARIKT NEWS W Scoreboard, C2 M LB, C3 Sports in brief, C2 Preps, C4 NHL, C2 NBA, C4 THE BULLETIN • THURSDAY, APRIL 10, 2014

LOCAL GOLF

O www.bendbulletin.com/sports

PREP TRACK & FIELD

GOLF: MASTERS

Readers can take C. Oregonsurvey

Mickelson a legitimate threat this week and beyond

The Bulletin would like to know what golfers think about golfing in Central Oregon. Go to www.bendbulletin.com/golfsurvey, and take afew minutes to complete our annual survey. Results will be published in our annual Central OregonGolf Preview on Sunday, May11. — Bulletin staff report

BASKETBALL

Girl defriendeddy hoops star dies

Barry Svrluga The Washington Post

AUGUSTA, Ga.— When Phil Mickelson watched the seminal Masters of his youth,

DETROIT — When

Michigan State was fighting to stay afloat despite a succession of injuries to key players, Lacey Holsworth was there. When the team

Jack Nicklaus' rousing triumph in 1986, he was a 15-year-old amateur with a looping left-handed swing and a future filled with e

Photos by Andy TullieI The Bulletin

Bend High sprinter Braden Bell, center, gets the handoff from Joel Johnson on their way to winning the boys 400-meter

relay during Wednesday's track and field dual meet against RedmondHigh in Bend.

Holswortll rebounded to win the

Big Ten tournament, the 8-year-old from St. Johns, Mich., was there. Andasthe cold-shooting Spartans bowed out of the NCAA tournament at the hands of eventual champion Connecticut one win short of the Final Four, she was there. Now, Lacey is gone. The little girl affectionately known as "Princess Lacey" finally succumbed to the cancer that she battled since 2011. Herfather, Matt Holsworth, said

Lacey died at their home late Tuesday "with her mommy anddaddy holding her in their arms." Lacey met Michigan State star Adreian Payne during oneof her hospital stays, and their friendship quickly blossomed. Thelittle girl became knownto legions of basketball fans, cheering on Payne and the Spartans on Twitter as they became a popular pick to win it all this season. When it was Payne's turn to be honored during Senior Night, the 6-foot-10 center scooped up Laceyand carried her around the court. And there shewas at the Michigan State

basketball banquetlast month, standing next to coach TomIzzo. Hismessage:W hat Lacey was going through put his team's injury woes in perspective. "I've learned they're minor injuries when you look at life," said an emotional Izzo, who paused to gather himself. "One of the greatest things I've done in my 30 years here" wasseeing Payne interact with Lacey during a hospital

promise. At that time, to a teenager, Nicklaus just seemed

so old, a 46-year-old outlier, an established legend merely adding to the lore. Today, Mickelson will tee it up in his 22nd Masters, a lead- Mickelson ing contender in what is wide-

ly considered to be a wideopen tournament. At 43, he is coming off a year in which he won his first British Open, further rounding out his re-

• The BendHighboysandgirls claim several events in avictory over Redmond

sume. He has won three times

gggtei g Wh

Today first round'

boththe 800and the300hurdles to lead the Bend High boys. Hoffmann logged a time of 1:59 in the 800 and ran the 300 hurdles in 41.5

at Augusta National Golf Club 'rV ESPN — the first 10 years ago — and there is no one in the field who inSide believes he cannot win again, • Tee times himself included. In discussing all these toPics Fr~dayC2 earlier this week, Mickelson

a 118-25 victory, and the Lava Bear boys completed the track and field

seconds.

turned the conversation, un-

dual-meet sweep with 12 different

onds in the 200 not only won the event on Wednesday but ranked as the third-fastest time in 5A. Blake

Bulletin staff report The Bend High girls boasted winners in all 15 individual events

on Wednesday afternoon to claim

Logan Blake's time of 20.94 sec-

winners in a 113-31 win over visit-

ing Redmond High. Ali Laborin took the discus and the javelin to pace the Bend High girls, while Sarah Curran (800-meter run and high jump) and Sarah Perkins (1,500 and 3,000) each post-

four times a Masters winner, out indefinitely

after back surgery. See Mickelson /C2

100, Austin Jewsbury was first in

the 3,000 and second in the 1,500, and Steffan Kearsley contributed with a win in the discus and a sec-

CAPTURE THE FLAG

ond-place showing in the shot put behind teammate Jaylin Robinson. Remington Williams completed

ed two victories.

Also logging a win for the Bears was Samantha McGee, who cleared 9 feet, 6 inches in the pole vault for

the 3,000 in 10:27.41 to win the event for the Panthers, one of two victo-

the fifth-best mark in Class 5A this season.

ries for Redmond on Wednesday, Donnie Pate posted the other first-

Vanessa Guerrero led the way for

Redmond with a second-place finish in the discus, third-place showings

Redmond sprinter Sia Sibley accelerates away from the competition on

in the shot put and the javelin, and

her way to winning the girls 400-me-

a fourth-place performance in the long jump. Brittany Smith was sec-

ter relay on Wednesday.

ond in the 100 hurdles and fourth

in the 300 hurdles, while Chelsea Whitley added a second-place finish in the long jump and a fourth-place

solicited, to the man whose absence helps shape the tournament, too: Tiger Woods-

added a runner-up finish in the

showing in the 200. Caleb Hoffmann posted the fourth-best times in Class 5A in

place finish with a throw of 122 feet in the javelin.

Pate was also fourth in the 100, Alani Troutman took second in both the 110 hurdles and the high

jump, and Gabe Brauchler was runner-up in the discus to go along with a fourth-place finish in the

shotput.

Late hit leadsBendHigh past Dallas Bulletin staff report

PREP BASEBALL

DALLAS — Dalton Hurd pitched

four innings, allowed just three hits, and helped his own cause by going 3 for 3 at the plate to lead Bend High to a 4-1 nonconference baseball win

over Dallas on Wednesday. With the Lava Bears clinging to a 2-1 lead in the top of the seventh in-

ning, Hurd belted a two-run single to give Bend some breathing room

Keenan Seidel was 1 for 2 with a run scored to help the Lava Bears

and eventually the three-run non-

league win. J.J. Spitler pitched the last three innings for the Lava Bears, giving up just one hit. Elliot Willy was 2 for 3 with a

single and a double for Bend High, which picked up its fifth straight win to improve to 8-3 overall.

escape with a win despite stranding 11 runners on base. "But we were pretty productive,"

Bend coach Bret Bailey said. "We played well defensively and we hit the ball well." The Lava Bears travel to Hood

River Valley on Saturday for a Class 5A nonconference doubleheader.

Matt Slocum i The Associated Press

Scott Stallings's son, Finn, looks at the flag on the fourth green during the par 3-competition at the Masters on Wednesday in Augusta, Ga.

MAJOR LEAGUE BASEBALL

visit.

"Watching that moment, I could never teach that. I could never coach that. I learned from him," said Izzo, who said Lacey became the team's inspiration.

Players start to move on

— The Associated Press

NBA

• Cruz, Braun and Peralta return to the field after serving drugsuspensions

He couldnothaveasked formore. The sellout crowd collectively yelled, "Cruuuuuuz!" as the slugger ran across the orange carpet. And after Cruz hit the tiebreaking home run to propel Baltimore past the defending cham-

By David Ginsburg

pion Boston Red Sox, the chant was even louder.

The Associated Press

BALTIMORE — Nelson Cruz was

"It was very, very nice to have that kind of reception," Cruz said.

duced on his first opening day in Baltimore, the former All-Star wondered

alta each served hefty suspensions in

LaMarcus Aldridge on

how Orioles fans would react in the

Wednesday.

Milwaukee's Ryan Braun gets a standing ovation from the home crowd during open-

aftermath of the 50-game suspension he received last year for using performance-enhancing drugs. "As a new player, you don't know what to expect," Cruz said. "You hope

ing day on March 31 inMilwaukee.

for the best."

Blazers hangon Jeffrey Phelps/The Associated Press

All was forgiven.

accordingly. As he waited to be intro-

branded a cheater and punished

Sacramento's rally falls short in Portland's 10099 victory,C4

The

Cruz, Ryan Braun and Jhonny Per2013 for violations of baseball's drug agreement following the sport's investigation of Biogenesis of America, a now-defunct rejuvenation clinic. At home games, it seems all is forgiven. SeeSuspensions/C3

TH E BULLETIN• THURSDAY, APRIL 10, 2014

ON THE AIR

COHKBOARD

TODAY SOCCER UEFAEuropa League, quarterfinal, Juventus vsOlympique Lyonnais UEFAEuropa League, quarterfinal, SL Benfica vs AZAlkmaar

Time TV/Radio noon

FS1

noon

FS2

n oon

ESP N

GOLF

Masters HOCKEY

College, NCAA Tournament, Boston College vs. Union (N.Y) NHL, St. Louis at Minnesota College, NCAA Tournament, Minnesota vs. North Dakota

2 p.m. E SPN2 5 p.m. NBCSN 5:30 p.m. ESPN2

BASEBALL

College, Tennessee atGeorgia

4:30 p.m. ESPNU

BASKETBALL

NBA, SanAntonio at Dallas NBA, Denver atGoldenState

5 p.m. TNT 7:30 p.m. T NT

FRIDAY AUTO RACING NASCAR,Sprint Cup, Bojangles' Southern 500, practice NASCAR,Sprint Cup, Bojangles' Southern 500, final practice NASCAR,Nationwide Series, VFW Sport Clips Help AHero 200, qualifying NASCAR,Sprint Cup, Bojangles' Southern 500, qualifying NASCAR,Nationwide Series, VFW Sport Clips Help AHero 200

Time TV/Radio 8 :30 a.m.

FS 1

11 a.m.

FS1

1 p.m.

FS2

3 p.m.

FS1

5 p.m.

E SPN2

n oon

ESP N

4 p.m. 7 p.m. 7 p.m.

MLB P a c-12 Roo t

GOLF

Masters BASEBALL

MLB, Boston at NewYork Yankees College, UCLA at Arizona MLB, Oakland atSeattle HOCKEY

NHL, Carolina at Detroit NHL, Colorado at SanJose

4:30 p.m. NBCSN 7 p.m. NBCSN

BOXING

Boxing, Gilberto Ramirez vs. Giovanni Lorenzo 7 p.m.

E SPN2

ON DECK Today Boys tennis: Bend at CrookCounty, 4 p,mcRidgeviewat Summit, 4 p.m.; Redmondat Mountain View, 4p.m. Girls tennis: Crook Countyat Bend, 4p.mcSummit at Ridgeview,4p.m.; Mountain Viewat Redmond, 4p.m. Girls golf:Bend,MountainView,Summit, Redmond, Ridgeview,CrookCounty, Trinity LutheranatMeadow Lakes,noon Friday Baseball: Sistersat Elmira,4:30p.m.; SouthMedford atRedmond, 3 p,m4Summit vs. SouthMedford atRedmond, 5 p.m.; Sweet Homeat LaPine, 4:30 p.m.;Estacadaat Ridgeview(DH),3 p.m. SoflbaU:HoodRiverValley at MountainView,4:30 p.m.;Redmondat South Medford(DH),3p.m.; Elmira atSisters,4:30p.m.; LaPineatSweet Home, 4:30 p.m.;CrookCountyatEstacada,TBD; Central Linn atCulver4:30p.m. Boys golf: Bend,MountainView, Summit, Redmond, Ridgeview,CrookCountyat BrokenTop, 10a.m. Boys tennis: SummiTourna t m ent at Athletic Club of Bend:Bendvs. Marist,1 p.mcSummit vs. Ashland, 1p.m.;MountainViewvs. Churchill, 4 p.m.; CrescentValleyvs.Ridgeview,4 p.mcAshlandvs. Bend, 7p.m.; Summit vs. Marist, 7 p.mcBlanchet Catholic atMadras,4 p.m. Girls tennis: BendInvitational: AtJuniperPark:Jesuit vs. Sisters, 11 a.m.; Jesuit vs. Summit, 1:30 p.m4Sistersvs.Summit, 4 p.m4At Summit High: Ridgeview vs. St. Mary's,11a.mcRidgeviewvs. OregonEpiscopal,4 p.mcAtBendHigh:Beavertonvs. Bend,11a.m.; Bendvs. West Salem, 4 p.m.; AtMountainViewHigh: Central Catholic vs. MountainView,11a.m.; Mountain Viewvs. Tualatin, 4p.m.

Boyslacrosse:RoseburgatSummit,8p.m. Saturday Baseball:BendatHood River Valley (DH), noon SoflbalhHoodRiverValleyat Bend(DH),noon Boys tennis: SummiTo t urnament atAthletic Clubof Bend:Marist vs.Mountain View,8a.m.; Crescent Valleyvs.Summit,11 a.m.;Ashlandvs. Ridgeview, 11 am4Summit vs.Churchill, 2 pmcAshlandvs. MountainView,2p.m4Bendvs.Ridgeview,5p.m. Girls tennis: Bend, Mountain View,Summit, Sisters, Ridgeview,CrookCountyat Bend Invite, TBD Track andfield: Bend,Summ it at Jim Robinson Twilight Invitational inRoseburg,10 a.m.;Sisters, Culyerat Meetof ChampionsatWilamette University in Salem,10:30a.mcMadrasatBurns Lions/ OsterMem orial Invitational, noon;CrookCounty at Lower ColumbiaInvite in St.Helens,12;30 p.m. Boys lacrosse: Roseburg at Bend,11a.m.; Sisters atWestSalem,4 p.m4Thurston at Summit, 1 p.m. Girls lacrosse:Bendvs. Beavertonat University of Oregon,10a.mu Bendvs.Carlsbad(calif.) at University ofOregon,2p.m.

BASEBALL

FOOTBALL

AFL Premiership, Carlton vs. Melbourne AFL Premiership, Gold Coast vs. Hawthorn

College

8 :30 p.m. F S 2 2 :30 a.m. F S 2

Listings are the most accurate available. TheBulletin is not responsible for late changesmadeby TV or radio stations.

Pac-12 Standings All TimesPDT Washington

Conferenc e Overall 10-2 9-3 6-3 6-3 7-5 7-5 4-7 3-6 3-6 4-8 1-11

Oregon State

UCLA WashingtonState

Oregon Arizona State Arizona California Stanford USC Utah

SPORTS IN BRIEF BASEBALL OregOn takeS anather frOm UP — BrandonTessar struck out eight overseveninningsand ledacombinedshutoutWednesdayas the Oregon Ducksbeat Portland 3-0 at the Pilots' Joe Etzel Stadium. The win was thesecond in as many daysfor Oregon over Portland; the Ducks took a15-10 decision from the Pilots on Tuesday inEugene. Wednesday's vvas a much different game, which took only 2 hours and12 minutes to complete asTessar combined with relievers Garrett Cleavinger andJake Reedfor11 strikeouts in a five-hitter. A run-scoring double by Mitchell Tolmangot Oregon onthe scoreboard in the fourth inning. Mark Karaviotis hit a tvvo-run single in the fifth to round out the scoring for the Ducks (24-10). CalebWhalen hadthree hits for the Pilots (7-27). Oregon plays athree-game nonconference home series with UCRiverside starting Friday at PK Park, where game time for the opener is set for 6 p.m.

BASKETBALL UMass dasketball playerGordoncomes out asgayUMass guard Derrick Gordon hasbecomethe first openly gay player in Division I men's basketball. Gordon madethe announcement in interviews with ESPNandOutsports on Wednesday. Thesophomore was the Minutemen's fourth-leading scorer with 9.4 points per game last season, whenUMass reachedthe NCAAtournament for the first time since1998."I want to be myself," Gordon saidin the interview televised on ESPN. "I don't want to hide and be someone I'm not."

22-6 25-6 18-13 15-14 23-10 17-13 15-19 14-15 11-15 15-16 10-19

Wednesday'sGames Oregon 3, Portland 0 Arizona10,ArizonaState9 Friday's Games StanfordatWashington, 5p.m. UC RiversideatOregon,6p.m. OregonStateatWashington State, 6p.m. UtahatUSC,6p.m. Californiaat ArizonaState, 6;30p.m. UCLAatArizona, 7p.m. Saturday'sGames UC RiversideatOregon,2p.m. OregonStateatWashingtonState, 2p.m. UtahatUSC,2p.m. StanfordatWashington, 6p.m. Californiaat ArizonaState, 6:30p.m. UCLAatArizona, 7;30p.m.

BASKETBALL Wo m en's college Poll

USATodayW omen'sTop25Poll Thetop25teamsintheUSATodaywomen' scollege basketballpoll, with first-placevotes in parentheses,final records,pointsbasedon25 points for a first-place votethroughonepoint for a25th-placevote and previous ranking: Reconl Pts Pvs 1. Connecticut(32) 4 0 - 0 800 1 2. NotreDame 37-1 76 8 2 3. Stanford 33-4 73 0 5 4. Maryland 28-7 69 0 9 5. Louisville 33-5 66 0 4 6. Baylor 32-5 64 9 6 7. NorthCarolina 27 - 1 0 5 6 8 13 8. Tennesse e 29-6 56 6 3 9. SouthCarolina 29-5 54 3 8 10. TexasA&M 27-9 516 14

11. Kentucky 26-9 47 1 11 12. WestVirginia 30- 5 395 7 13. Duke 28-7 39 4 10 14. Penn State 24-8 36 0 15 15. Oklahoma State 2 5- 9 3 3 5 18 16. DePa ul 29-7 313 21 17. Nebraska 26-7 30 1 12 18.Brigham Young 2 8- 7 2 0 3 NR 19. Purdue 22-9 19 4 19 20. California 22-10 152 22 21. N.C.State 25-8 14 5 17 22.Gonzaga 29-5 11 9 16 23. MichiganState 2 3 -10 99 24 24. LSU 21-13 9 2 NR 25. Oregon State 24-11 5 7 NR Othersreceivingvotes:lowa53; James Madison 50; Texas 38; ArizonaState30; Syracuse25; Middle Tennessee19; lowaState11; St.John's9;Florida State 8; FloridaGulfCoast7; Rutgers 7;Tennessee-Martin 6; WichitaState5; SouthernCalifornia 4; Florida3; Dayton2; SouthFlorida 2;Bowling Green1.

GOLF Masters Tee Times At AugustaNational Golf Club Augusta, Ga. AU TimesPDT a-amateur Today-Friday 4:45 a.m.-7:52a.m.—StewartCink,TimClark. 4:56 a.m.-8:03a.m.— IanWoosnam,JohnHuh, KevinStadler 5:07 a.m.-8:14a.m.— BenCrenshaw, Y.E. Yang, JonasBlixt 5;18 a.m.-8;25a.m.— Mark O'Meara,Steven Bowditch,a-JordanNiebrugge 5:29 a.m.-8:36a.m.—JohnSenden,BooWeekley, DavidLynn 5:40 a.m.-8;47a.m.— CraigStadler, ScottStallings, Martin Kaymer 5:51 a.m.-9:09 a.m.— Tom Wats on, Bigy HorschelBren , dondeJonge 6:02 a.m.-9:20a.m.— Mike WeirMatt , Every, RobertCastro 6:13a.m.-9:31a.m.—AngelCabrera,GaryWoodland, lanPoulter Couples,WebbSimp6:24a.m.-9:42a.m.— Fred son, a-Cha ng-wooLee McDowell, Rickie 6:35 a.m.-9:53a.m. —Graeme Fowler,JimmyWalker 6:57 a.m.-f0:04a.m.—ZachJohnson,KJ. Choi, SteveStricker 7:08 a.m.-10:15a.m. — MiguelAngelJimenez, Bill Haas,Mateo Manassero 719a m.-1026am.—HidekiMatsuyama,Brandt Snedeker,JamieDonaldson 7:30 a.m.-10:37a.m. — Charl SchwartzelJi, m Furyk,ThorbjornOlesen 7:41 a.m.-10:48a.m.—Adam Scott, JasonDufner, a-Matthew Fitzpatrick 7:52 a.m.-10:59a.m. — JordanSpieth, Patrick Reed,RoryMcgroy 8;03 a.m.-5:45a.m.— Kevin Streelman, D.A. Points 8:14 a.m.-5:56a.m.— LarryMize,BrandenGrace, a-Mic haelMccoy 8:25 a.m.-5:07a.m.— Sandy Lyle,MattJones, KenDuke 8:36 a.m.-5:18a.m. —JoseMariaOlazabal, Lucas Glover,a-Garrick Porteous 8:47 a.m.-5:29a.m.—NickWatney, StephenGallacher,DarrenClarke 9:09 a.m.-5:40a.m.—VijaySingh,ThomasBjorn, RyanMoore 9:20 a.m.-5:51a.m. —Matt Kuchar,Louis Oosthuizen,ThongchaiJaidee 9:31 a.m.-6:02a.m.—TrevorImmelman, Graham DeLaet,a-OliverGoss 9:42 a.m.-6:13a.m.—GonzaloFernandez-Castano, DerekErnst,Sang-MoonBae 9:53 a.m.-6:24 a.m.—BernhardLanger, Francesco Molinari,ChrisKirk Day,Dustin John10:04a.m.-6:35a.m.— Jason son, HenrikStenson — Bubba W atson,LukeDon10:15a.m.-6:57a.m. ald, SergioGarcia 10:26a.m.-7:08a.m.—JoostLuiten,MarcLeishman,HunterMahan 10:37 a.m.-7:19a.m. — KeeganBradley, Victor Dubuisson,Peter Hanson 10:48a.m.-7:30a.m.— Phil Mickelson,ErnieEls, JustinRose 10:59a.m.-7:41a.m.— HarrisEnglish,LeeWestwood,Russell Henley

HOCKEY NHL NATIONALHOCKEY LEAGUE All TimesPDT

EasternConference Atlantic Division GP W L OT Pts GFGA z-Boston 7 9 5 3 1 8 8 114 254 171 x-Montreal 80 45 27 8 9 8 214 202

WesternConference CentralDivision

GP W L OT PtsGF GA x-St. Louis 79 52 20 7 111 246 181 x-Colorado 79 51 21 7 109 243 210 x-Chicago 80 46 19 15 107262 209 x-Minnesota 80 42 26 12 96 200 197 Dallas 80 39 30 11 89 231 226 Nashyile 79 35 32 12 82 200 234 Winnipeg 80 35 35 10 80 220 233

PacificDivision

GP W L OT PtsGF GA x-Anaheim 80 52 20 8 112 259 204 x-SanJose 80 49 22 9 107 241 197 x-LosAngeles 80 45 28 7 97 200 170 Phoenix 7 9 3 6 2 8 15 87212 225 Vancouver 79 3 5 33 11 81 187 213 C algary 80 3 5 3 8 7 7 7205 231 E dmonton 80 28 43 9 6 5198 265

FedericoDelbonis (6), Argentina,def.Filip Peliwo, Canada,6-2,6-7(5), 6-4. Victor Hane scu,Romania, def. Kevin Anderson(1), SouthAfrica 6-4 6-4

SOCCER MLS MAJORLEAGUESOCCER All Times PDT

Saturday'sGames

RealSaltLakeat Philadelphia,1 p.m. ColoradoatTorontoFC,1p.m. ChicagoatMontreal,1 p.m. Housto natNewEngland,2p.m. NewYorkat D.C. United, 4p.m. Seattle FC atFCDallas,5:30 p.m. NOTE: Two points for a win, onepoint for overtime ChivasUSAat Portland,7:30 p.m. loss. Vancouverat LosAngeles,7:30p.m. x-clinched playoffspot Sunday'sGame y-clinched division ColumbusatSanJose,noon

z-clinched conference Wednesday'sGames Pittsburgh4, Detroit 3, SO Calgary4,LosAngeles 3, SO Chicago 3, Montreal 2, OT Columbus3, Dagas1 Anaheim 5, SanJose2 Today'sGames Buff aloatN.Y.Rangers,4p.m. WashingtonatCarolina, 4p.m. N.Y.Islandersat Montreal,4:30 p.m. NewJerseyatOttawa,4:30p.m. PhiladelphiaatTampaBay,4;30p.m. TorontoatFlonda,4:30p.m. PhoenixatNashvile, 5 p.m. St. Louiat s Minnesota,5 p.m. Bostonat Winnipeg, 5 p.m. LosAngelesatEdmonton,6:30p.m. ColoradoatVancouver, 7p.m.

TENNIS Professional U.S. Men'sClayCourl Championships Wednesday At River OaksCountry Club Houston Purse:S539,730(WT250) Surface: Clay-Outdoor Singles First Round SantiagoGiraldo, Colombia,def. MatthewEbden, Australia,6-1,6-2. JuanMonaco(6), Argentina, def. SomdevDevvarman,India,7-6 (4), 6-2. SecondRound SamQuerrey,UnitedStates, def.LleytonHewitt(7), Australia,6-3,6-4. DustinBrown,Germany,def.JohnIsner(1), United States,6-4,6-7(7),7-6(4).

Claro Open Wednesday At ClubCampestre elRancho Bogota, Colombia Purse: $26O,O OO (Intl.) Surface:Clay-Outdoor Singles First Round JelenaJankovic (1), Serbia,def.Mathilde Johansson, France, 7-5,7-5. SecondRound ChanelleScheepers, SouthAfrica, def.Alexandra Panova,Russia,6-3, 6-2. LourdesDom inguezLino (8), Spain,def.Yuliana Lizarazo, Colombia,6-2, 6-3. VaniaKing(6), UnitedStates, def. MariaIrigoyen, Argentina,6-4,3-6,6-0. MarianaDuque-MarIno, Colombia,def. IrinaKhromacheva, Russia,6-2, 6-4. Paribas KatowiceOpen Wednesday At Spodetr Katowice, Poland Purse:S250,000(Intl.) Surface:Clay-Indoor Singles First Round MagdalenaRybarikova (7), Slovakia,def. Claire FeuersteinFran , ce,6-2,7-5. MirjanaLucic-Baroni, Croatia,def.JovanaJaksic, Serbia,6-3, 6-4. SecondRound KlaraKoukalova(5), CzechRepublic, def.Annika Beck,Germany,4-6, 6-3, 6-1. ShaharPeer,Israel, def.Tsvetana Pironkova(8), Bulgaria,6-2,6-1. Carla SuarezNavarro (3), Spain, def.Alexandra Cadantu,Romania,2-6, 6-46-4. CamilaGiorgi, Italy, def.RobertaVinci (2), Italy, 6-3, 6-7(7),6-0.

DEALS Transactions BASEBAL L

AmericanLeague

BOSTONREDSO X — Activated LHP Craig Breslowfromthe 15-day DL Optioned RH PBrandon Workman to Pawtucket. CLEVEL ANDINDIANS — Optioned RHPVinnie Pestanoto Columbus(IL). Recaled RHPTrevor Bauer andRHPChen-ChangLeefrom Columbus. KANSASCITY ROYALS — Activated RHP Louis Colemanfromthe15-day DL.Recalled 2BJohnny GiavotellafromOmaha(PCL). Optioned LHPDonnie Joseph andRHPAaronBrooksto Omaha. LOSANGELESANGELS—Placed OFJosh Hamilton onthe15-dayDL.Recalled OFJ.B.Shuckfrom Salt Lake (PCL). MINNES OTATWINS— Placed OFOswaldo Arcia on the15-day DL,retroactive to April 5. NEW YORKYANKEES— OptionedCAustinRomine to Scranton/Wilkes-Barre(IL). Recalled RHP Shane GreenefromScranton/Wilkes-Barre. SEATTLE MARINERS— RecalledLHPLucasLuetge fromTacoma (PCL). PlacedLHPJames Paxton onthe 15-day DL. TEXAS RANGERS—Purchasedthecontract of INF Kevin Kouzmanoff from RoundRock(PCL). TORONTOBLUEJAYS— RecalledRHPNeilWagner fromBuffalo (IL). OptionedRHPMarcusWalden to Buffalo.

National League

ATLANTABRAVES — Optioned RHP PedroBeato

to Gwinnett(IL). COLORADOROCKIES— RecalledINFJoshRutledge fromColoradoSprings (PCL). OptionedRHP WiltonLopezto ColoradoSprings. LOS ANGELESDODGERS — Reinstated RHP JoshBeckettfromthe15-day DL.OptionedRHPJose Dominguez to Albuquerque(PCL). MIAMIMARLINS—PlacedRHPJacobTurneron the15-dayDLRecalled RHPArquimedesCaminero from New Orleans(PCL). BASKETB ALL National Basketball Association GOLDENSTATE WARRIORS — Signed C Hil ton Armstrongfortheremainderof theseason. HOUSTONROCKETS— RecalledFRobertCovington and G TroyDaniels fromRioGrandeValley(NBADL). FOOTBAL L National Football League BOSTONBRUINS — Recalled F RyanSpooner from Providence (AHL). BUFFALOBILLS— SignedPJakeDombrowski. CAROLINAPANTHERS — Re-signed DT Colin Cole toaone-year contract. NEWYOR KJETS—Re-signedLBGarrett Mclntyre. SANDIEG OCHARGERS— Agreed to termswith OL Rich Ohrnbergeronaone-yearcontract. HOCKEY National HockeyLeague NEW YORKISLANDERS — Recalled F Johan Sundstrom fromBridgeport (AHL). TAMPABAYLIGHTNING— Recalled GKristers GudlevskisfromSyracuse(AHL). VANCO UVERCANUCKS—NamedTrevor Linden presidentofhockeyoperations. COLLEGE ARIZONA STATE— NamedZekeJones wrestling coach. AUBURN —NamedToddGoldendirector ofbasketball operations. FLORIDA A&M—NamedKegenWinslow Sr.athletic director. JACKSONVI LLE— NamedTonyJasickmen' sbasketbagcoach. KANSAS— Announcedfreshman CJoelEmbiid will entertheNBAdraft. MARQU ETTE— Announced Terri Mitchell women'sbasketballwil notreturnnextseason. PROVIDE NCE— NamedDanaEikenbergwomen' s assistantbasketballcoach.

Grand Prix HassanII

Wednesday At ComplexeSportif al Amal x-Tampa Bay 79 43 27 9 95 232 211 Casablanca,Morocco x-Detroit 80 3 8 2 7 15 91 218 228 Purse: S665,600(WT250) Surlace: Clay-Outdoor Toronto 80 3 8 3 4 8 8 4 229 251 Singles Ottawa 79 3 4 3 1 14 82 230 262 First Round Florida 80 28 4 4 8 6 4 190 263 Buffalo 79 2 1 4 9 9 5 1 152 238 Aleks andrNedovyesov,Kazakhstan,def.Robin Metropolitan Division Haase (7), Netherlands, 7-6(6), 6-4. GP W L OT Pts GFGA Guigermo Garcia-Lopez (8), Spain, def. Mikhail y-Pittsburgh 80 51 24 5 107 244 200 KukushkinKa , zakhstan, 7-6(5}, 7-6(6). x-N.Y.Rangers 80 44 31 5 93 216 191 PabloCarrenoBusta, Spain, def.TobiasKamke, x-Philadelphia 79 41 29 9 91 225 222 Germany, 6-1,6-2. x-Columbus 80 42 31 7 9 1 226 211 Jiri VeselyCzech , Republic, def.LeonardoMayer, Washington 79 36 30 13 85 226 237 Argentina,6-4,6-3. NewJersey 79 34 29 16 84 191 201 Albert Montanes,Spain, def. KennyDeSchepper, Carolina 79 3 4 3 4 11 79 197 219 France,6-2,6-3. N.Y.lslanders 79 31 37 11 73 216 262 SecondRound

FISH COUNT Upstream daily movement of adult chinook,jack chinook,steelheadandwild steelheadat selected ColumbiaRiver damslast updated onTuesday. Cbnk Jcbnk Stlhd Wsllhd Bonneville 24 3 1 59 20 The Daffes 7 2 1 19 3 John Day 6 2 1 5 1 McNary 10 1 21 12 Upstream year-to-date movement ofadult chinook, jack chinook,steelheadand wild steelheadat selected ColumbiaRiverdamslast updatedonTuesday. Cbnk Jcbnk Stlhd Wstlhd B onneville 1,717 1 6 2 , 929 9 3 9 The Daffes 544 2 100 37 J ohn Day 31 0 15 2, 4 8 6 92 9 McNary 42 1 159 94

Jayhawks center Embiiddeclares for NBAdraftKansas freshmanJoel Embiid will enter the NBAdraft after a breakthrough season that endedwith a stress fracture in his backthat kept the 7-footer out of the NCAA tournament. He said during a news conference Wednesday atAllen Fieldhouse that he reachedhis decision Sunday. Thenative of Cameroon is still ravv, having only picked upthe game a fewyears ago. But his natural athleticism made abeliever out of NBA scouts, and manybelieve Embiid will join teammateAndrew Wiggins among the first fevvpicks in the Junedraft. — From wire reports

Jackets makeplayoffs NHL ROUNDUP

The Associated Press DALLAS — Artem Anisimov and Mark Letestu add-

nen scored in regulation and ed goals to the one Colum- then got the game-winner bus already had when the in the shootout, lifting Pittsmakeup game started, and burgh past playoff-bound the Blue Jackets clinched Detroit. the second playoff berth irt Blackhawks 3, Canadiens franchise history with a 3-1 2: CHICAGO — P a t r ick victory over the Dallas Stars Sharp set up Marian Hossa's on Wednesday night. tying goal irt the final minute The Blue Jackets had a 1-0 of regulation and then scored lead when the puck dropped the game-winner 43 seconds because that was the score

March 10, the night the original game was postponed after Dallas forward Rich

Peverley collapsed on the bench because of an irregular heartbeat.

The Blue Jackets set a

into overtime to lift Chicago. Ducks 5, Sharks 2: ANAHEIM, Calif. — Patrick Maroon scored two goals, John Gibson made 36 saves irt his second NHL start, and Anaheim clinched its second straight Pacific Division title.

Flames 4, Kings 3: CAL-

wins, beating the previous mark from their only other playoffseasonin2008-09. Also on Wednesday:

GARY, Alberta — Sean Mo-

f ranchise record w it h

nahan scored his 21st goal and then got the shootout winner as surging Calgary PengtJifTS 4, Red WingS 3: beat Los Angeles for its PITTSBURGH — Jussi Joki- fourth straight victory.

Mickelson Continued from C1 "It's a weird feeling not having him here, isn't it'?" Mickelson asked before anyone could even bring up the question. "He's been such a mainstay in professional golf and in the majors. It's awkward to not have him here. I hope he gets back soon." But Woods' absence, too, points to a divide that has already developed between the

one."

than that, and dating back to window

careersofWoods and Mickelson, one that could shape not 2004 Masters, he was winless only this Masters but those in 41 tries as a pro at majors. "There was an amount of going forward. Woods, without a major title since he was pressure that became relief 32, is now the textbook exam- that I won, as opposed to joy," ple of how age and injuries Mickelson said. "Now, whencart wear down golfers, even in their late 30s. Mickelson,

ever I win — when I won the

who has won all five of his

felt so ecstatic and such great

majors since he turned 33,

joy to have had that accomplishment, and there was real-

provides the opposite model, an example of the possibility that exists for players into their 40s.

Nicklaus, to this point, is

British Open last year, I just

ly no sense of relief in there."

That is because, even two decadesinto his career,he is comfortable both with what

he has accomplished in the pion. But even as Woods con- past and what he might actinues to break down — this is complish in the future. Woods' the fifth major he has missed pursuit of Nicklaus' record with injuries in the past seven 18 major titles could easily be years — Mickelson and others seen as a burden. Mickelson would hardly be surprised if is not worried about any such someone closer to 50 than 40 thing. More significantly, he is eventually won here. not worried about his health. "I think everyone gets a He withdrew from the Valero window," defending Masters Texas Open two weeks ago champion Adam Scott said. with a pulled muscle in his "And you might get more than side. But it was nothing more still the oldest Masters cham-

"It is an awkward motion,"

the 1993 PGA Championship, said former U.S. Open champ opened more than 20 years he has missed only one ma- Jim Furyk, also 43. "Guys are ago, at age 23, when he first jor — the 2009 British Open, good athletes now and they recorded a top-10 finish at a when his wife, Amy, was un- are bigger and stronger and major, a tie for sixth place at dergoing treatment for breast swinging a lot faster, and over the 1993 PGA Championship. cancer. the course of time, it takes its In the nine Masters from 1995 Mickelson attributes this tolL" to 2003, he finished in the top run, in large part, to his long, So even as Mickelson push10 seven times and was third smooth golf swing, one he es the outer limits of what can four times. It is hard to resaid is modeled more on that be achieved by a golfer in his member now, but in the ear- of the late Bobby Jones, one of 40s, a group of contenders ly 2000s, just as we counted Augusta National's founders. here this week looks at the Woods' major titles, we ticked He uses a wide arc to create landscape differently. Scott off Mickelson's failures. When speed through the ball, and and Justin Rose, the winners he arrived at Augusta for the he takes a massive cut each of the most recent Masters Mickelson's

time. "What this has allowed me

and U.S. Opens, have not

to do is play 20-plus years fairly injury-free," he said. "Because my swing is based on length and leverage and I haven't had the injuries, I feel like

their time.

shied away from saying this is

"7wenty to 30, you can always put things down to experience, you can put things down to learning, you can I'm able to compete at a much chalk things up to, 'Well, older age or later age than a lot that's going to help me in the of the players that have such a future,'" said Rose, who like short, violent, high-torque golf Scott is 33. "But from 30 to swing." 40, that really is the time to do H e did

not say it , b ut

it. You don't want to be look-

Woods' swing — p articu- ing too much into your late larly when he was in his 20s 30s, early 40s, to be trying to — would fit that description. achieve your career goals. But back injuries are not lim-

... The time is now for me. I

ited to players who attack the think I am in the prime of my ball. Steve Stricker, a 47-year- career." old once ranked third in the

That is, no doubt, true. But

world, said this week he has it is also true that Mickelson dealt with herniated discs in couldcontend here this year, both his neck and back. Even next year — for the forethe languid Fred Couples, the seeable future, to the point 1992 Masters champ with a where Nicklaus in 1986 may buttery swing, has battled no longer seem an anomaly, backissuesforthebetterpart but something approaching of two decades. normal.

THURSDAY, APRIL 10, 2014 • THE BULLETIN

OR LEAGUE BASEBALL Los Angeles RichardsW,2-0 7

AMcctcf 4 0 0 0 Rugginrf Roinsnrf I 0 0 0 StreetS,3-3 1 I 0 0 1 0 PAlvrz3b 4 2 2 2 RizzoIb Totals 36 4 104 Totals 2 8 0 4 0 Cleveland RMartnc 4 2 2 2 Olt3b C incinnati 000 2 1 0 001 — 4 BauerL,0-1 6 4 2 I 2 8 NWalkr2b 3 0 0 0 Lakelf S t. Louis 000 0 0 0 000 — 0 Shaw 1 I 0 0 0 1 AMERICANLEAGUE Houston Toronto Seattle Ishikaw1b 4 0 0 0 Castilloc E—Jh.Peralta (2). DP—Cincinnati 3, St. Louis1. Rzepczynski 1 0 0 0 0 1 East Division ab r h bi ab r hbi Elias L,O-I 5 4 2 2 1 2 Mercerss 3 0 0 0 Barney 2b LOB—Cincinnati 9, St. Louis2. 28—Ma.Adams(4). Atchison 1 0 0 0 0 0 W L Pci GB Leone 1 1-3 0 0 0 0 1 F owlercf 3 I I 0 Mecarrlf 5 I 2 0 WRdrgp 1 0 0 0 Hammlp 38 — B.Hamilton (1). HR—Mesoraco (I). SB—B. HBP —byBauer (S.Smith). WP —Erlin. Toronto 5 4 .556 Beimel 1-3 2 0 0 0 1 Presleyrf 4 I I 2 Izturis2b 3 2 2 I JHrrsnph 1 0 0 0 Kalishph Hamilton2(2), Heisey(1). SF—Bruce. T—2:51. A—9,930(42,487). '/r Tampa Bay 5 5 .500 Medina 1 1-3 0 0 0 0 1 J castroc 4 0 I 0 Diazss I 0 0 0 JGomzp 0 0 0 0 HRndnp IP H R E R BBSO Baltimore 4 5 .444 I Furbush 1 I 0 0 0 1 A ltuve2b 4 I I 0 Bautistrf 4 2 I I Tabataph 1 0 I 0 Stropp Cincinnati 4 Boston 4 5 .444 I HBP —byElias (Jo.McDonald). Carterdh 4 0 0 I EncrncIb 4 0 0 0 JuWlsnp 0 0 0 0 LeakeW,1-1 8 4 0 0 I 3 Rockies10, White Sox NewYork 4 5 .444 I T—2:53. A—16,437(47,476). K raussIb 4 0 2 0 Linddh 3 0 I I Totals 33 5 6 5 Totals 3 6 7 147 M.Parra I 0 0 0 0 0 Central Division M Dmn3b 4 0 0 0 Navarrc 4 I 2 I P ittsburgh 0 0 0 0 1 0 202 — 6 St. Louis DENVER — D.J. LeMahieu's twoW L Pd GB rssmnlf 3 0 0 0 Lawrie3b 4 I I 2 Chicago 100 033 Ogx — 7 S.Miller L,0-2 6 7 3 3 3 5 run single broke a tie in a six-run Athletics 7, Twins 4 (11 innings) VGillarss Detroit 4 2 .667 3 0 0 0 Rasmscf 3 0 I 0 DP — Pitsburgh1. LOB—Pittsburgh 2, Chicago Choate I 0 0 0 0 0 Cleveland 5 4 .556 '/r eighth inning, sending Colorado to Goinsss-2b 3 0 0 0 10. 2B —Bonifacio(3), Ruggiano(1), Rizzo2(2), Cas- Maness I 1 0 0 0 I Kansas City 4 4 .500 I MINNEAPOLIS — Derek Norris Totals 33 3 6 3 Totals 3 4 7 106 tillo (1). HR —Snider (I), PAlvarez2 (4), R.Martin 2 Neshek I 2 I I 0 I a win over the ChicagoWhite Sox. Chicago 4 5 .444 D/z Houston 000 003 000 — 3 T—2:19.A—41,137 (45,399). (2), Ol(2), t Lake(1). S—Hammel. hit a three-run homer in the11th Minnesota 3 5 .375 2 Toronto 200 030 20x — 7 IP H R E R BBSO Chicago Colorado West Division inning, andOakland bounced E—M.Dominguez2 (2). DP—Houston1. LDBPittsburgh ab r hbi ab r hbi W L Pct GB back from another blown save Houston4, Toronto 8. 28—Bautista(I), Navarro(4), W.RodriguezL,0-2 5 9 4 4 3 6 Nationals10, Marlins 7 by Eatoncf 4 I 2 I Blckmncf-rf 5 2 3 1 Oakland 5 3 .625 Rasmus (3). 3B—Altuve(1). HR —Presley(2), Lawrie J.Gomez 2 4 3 3 I I Semien2b 4 I I 0 Cuddyrrf-1b 4 I 1 2 newcloser Jim Johnson to beat Seattle 5 3 .625 WASHINGTON —JaysonWerth (1). SB —Me.cabrera(1), Navarro(1). Ju.Wilson I 1 0 0 0 I A breu1b 4 0 2 0 CGnzlzlf 5 I 3 2 Los Angeles 4 5 .444 D/r IP H R E R BBSO Chicago Minnesota. hit a go-ahead grand slam in the Viciedolf-rf 4 0 0 0 Rosarioc 5 0 1 0 Texas 4 5 .444 D/r Houston HammelW,2-0 7 3 3 3 I 6 Gillaspi3b 4 0 I 2 Mornea1b 2 I 2 0 Houston 3 6 333 21/2 Harrell L,0-2 41- 3 7 5 4 3 2 H.Rondon I 1 0 0 0 2 eighth inning off Carlos Marmol Oakland Minuesota AGarcirf I I 0 0 Stubbspr-cf I I 0 0 Williams I 1-3 0 0 0 2 1 Strop I 2 2 2 0 2 after Bryce Harper' s upper-deck, ab r hbi ab r hbi DeAzalf I 0 0 0 Arenad3b 4 I 2 1 Wednesday'sGames Zeid 2I 3 3 2 2 0 3 T—2:41. A—28,247(41,072). F uldcf 4 I 0 0 Dozier2b 5 I 1 2 three-run homer started a comeAIRmrzss 4 I I 0 Culersnss 3 0 0 0 Cleveland2,SanDiego0,1st game Toronto Lowriess 3 I 0 0 MauerIb 4 0 2 0 Flowrsc 4 0 I 1 LeMahi2b 4 2 3 3 Oakland 7, Minnesota4, 11innings MorrowW,1-1 6 5 3 3 1 9 backfrom an earlydeficit, and Dnldsn3b 5 I 2 I Plouffe3b 6 0 2 0 ErJhnsp 3 0 0 0 Nicasiop 2 0 0 0 KansasCity7,TampaBay3 WagnerH,I 2 0 0 0 0 3 Moss1b 4 I I 2 Colaelldh 5 0 0 0 Washington beat Miami. Cletop 0 0 0 0 Belislep 0 0 0 0 Colorado10,ChicagoWhite Sox4 Delabar 1-3 0 0 0 0 0 Brewers 9, Phillies 4 B artonIb 0 I 0 0 Kubellf 5 2 4 1 Downsp 0 0 0 0 Barnesph I 0 0 0 SanDiego2,Cleveland1,2ndgame 2-3 I 0 0 0 1 Rogers C espdsIf 5 0 I 0 KSuzuk c 4 I 0 0 Belisarip 0 0 0 0 Ottavinp 0 0 0 0 Miami Washington Boston 4, Texas2 T—3;09.A—I3,569(49,282). PHILADELPHIA — Ryan Braun hit Callaspdh 4 I 2 I Hrmnnrf 5 0 1 0 Petrickp 0 0 0 0 Brothrsp 0 0 0 0 Baltimore 5, N.Y.Yankees4 ab r hbi ab r hbi Jasoc 3 0 0 0 A.Hickscf 4 0 1 0 a two-run triple during a four-run Y elichlf 4 3 3 1 Spancf 4 1 2 0 Konerkph I 0 0 0 Rutledgph I I 1 1 Toronto7, Houston3 DNorrsph-c 2 I I 3 Flormnss 2 0 0 0 Orioles 5, Yankees 4 Hwknsp 0 0 0 0 L.A. Angel2, s Seattle 0 eighth inning rally to lead Milwau- Dietrch2b-3b4 2 1 2 Rendon2b 4 2 2 0 R eddckrf 5 0 0 0 Pintoph I 0 0 0 Logan p 0 0 0 0 S tantonrf 4 0 1 1 Werthrf 5 1 I 5 Detroit atLA.Dodgers, lategame Sogard2b 2 0 0 0 EEscorss 2 0 2 1 kee to its fifth straight win. Today'sGames GJonesIb 4 03 2 LaRochIb 5 1 I 0 Totals 34 4 8 4 Totals 3 7 10 1610 NEW YORK — Nick Markakis had Puntoph-2b 2 0 0 0 Chicago 0 20 020 000 — 4 McGeh3b 4 0 1 0Zmrmn3b 4 2 2 0 Oakland (Straily 0-1)atMinnesota(Pelfrey 0-1),10:10 Totals 39 7 7 7 Totals 4 3 4 13 4 an RBI single in the ninth inning Milwaukee Philadelphia Colorado 111 001 06x — 10 Caminrp 0 0 0 0 Dsmndss 4 1 I I a.m. Oakland 400 000 000 03 — 7 ab r hbi ab r hbi E — Vi c i e do (1). DP —Colorado 1. LOB—ChiD obbsph I 0 0 0 Harperlf 4 1 2 3 Boston(Buchholz0-0) at N.Y.Yankees (Pineda0-1), Minnesota against fill-in closer ShawnKelley, CGomzcf 5 2 3 I Reverecf 4 0 2 0 0 1 0 000 012 00 — 4 cago 5,Colorado7. 28—Abreu (3), C.Gonzalez (3), Marmlp 0 0 0 0Loa tonc 3 0 0 0 4:05 p.m. DP — O a kland 1, Mi n nesota1. LOB — O a klan d 5, and Baltimore rallied for a victory Segurass 4 2 2 I Rollinsss 4 I 0 0 Morneau(2), LeMahieu(1). 38—Blackmon (1). Sltlmchc 4 1 1 1 Zmrmnp 0 0 0 0 Houston(Keuchel0-1) atToronto(Dickey 1-1), 7:07 Minnesota11.28—Donaldson2 (3), Ce spedes (3). over the New B raunrf 4 1 I 2 Ruizc 5 2 2 0 SB — Semien(2), LeMahieu (1). CS —Blackmon(2). York Yankees after Dzunacf 4 0 1 0St mmnp 2 0 0 0 p.m. H R — D .N or ri s (2), Doz i e r (2), Kubel (I). SF — D ozie r. ArRmr3b 5 0 3 I HowardIb 3 I 0 0 S—Culberson. Hchvrrss 5 1 2 0 Detwilrp 0 0 0 0 Cleveland(Salazar0-0) at ChicagoWhite Sox(Danks wasting a three-run lead agai n st IP H R E R BBSO Lucroyc 5 1 I 0 Byrdrf 40I 2 IP H R E R BBSO Handp 2 0 0 0 Frndsnph I 0 0 0 0-0),5:10p.m. Oakland Masahiro Tanaka. K Davislf 4 0 I 0 DBrwnlf 4 0 I I Chicago Sloweyp I 0 0 0 Storenp 0 0 0 0 Friday's Games J.chavez 7 6 I I 0 9 Thrnrgp 0 0 0 0 CHrndz2b 4 0 0 0 Er.Johnson 52-3 9 4 4 1 4 DJnngsp 0 0 0 0 Clipprdp 0 0 0 0 Bostonat N.Y.Yankees, 7:05p.m. Doolittle H,3 1-3 2 I I 0 1 Overayph-Ib1 0 0 0 DeFrtsp 0 0 0 0 Cleto 11-3 0 0 0 1 3 Solano2b 2 0 1 0 McLoth ph 0 1 0 0 TorontoatBaltimore,7:05p.m. Baltimore New York G regerson H,2 23 0 0 0 0 0 MrRynlIb 4 2 I 2 Nix3b-2b 4 0 I 0 DownsL,0-2 0 I I I 0 0 RSorinp 0 0 0 0 Tampa Bayat Cincinnati, 7:10p.m. ab r hbi ab r hbi Ji.Johnson H,1 13 2 2 2 2 0 Hndrsnp 0 0 0 0 RHrndzp 1 0 0 0 1-3 5 5 5 0 0 Totals 3 9 7 147 Totals 3 6 10119 Belisario Houston at Texas,8:05 p.m. OteroW,1-0BS,I-I 22-3 3 0 0 2 1 Markksrf 5 0 I I Gardnrcf 4 0 2 0 t2b 4 0 0 0 Manshpp 0 0 0 0 Petricka 2-3 I 0 0 0 0 Miami 230 000 110 — 7 ClevelandatChicagoWhite Sox, 8:10p.m. D Yongdh 5 0 3 0 Jeterss 3 0 I 0 Gennet Minuesota Garzap 3 0 0 0 GwynJph 1 0 I 0 Washington 0 0 0 3 1 2 04x — 10 Colorado KansasCityatMinnesota, 8:10p.m. Hughes 5 5 4 4 3 3 C.Davis1b 4 0 I I Ellsurydh 4 0 0 0 LSchfrlf 2 1 0 I Diekmnp 0 0 0 0 E—Stanton (I), Dietrich (3), Da.Jennings(I). Nicasio 5 8 4 4 2 6 N.Y.MetsatL,ArAngels,10:05 p.m. Thielbar 2 0 0 0 0 3 A.Jonescf 5 0 2 0 Beltranrf 3 2 3 I B astrdp 0 0 0 0 LOB —Miami 12, Washington 7. 28—Yelich (2), G. Belisle 1 0 0 0 0 0 Detroit atSanDiego,10:10 p.m. Swarzak 11-3 0 0 0 1 1 Wietersc 3 I I 0 Mccnnc 4 0 0 0 Asche3b 1 0 I 0 11-3 0 0 0 0 1 Jones(2), Dzuna(2), Zimmerman(2). 38—Hechavar- Ottavino Oakland atSeatle,10:10 p.m. Duensing 2-3 0 0 0 0 1 N .cruzlf 4 0 0 0 ASorinlf 4 I I I Totals 41 9 128 Totals 3 5 4 9 3 B rothers W , 1 -0 23 0 0 0 0 0 LoughIf 0 0 0 0 KJhnsn Ib 4 I 2 I ria (1),Rendon(1). HR —Dietrich(I), Saltalamacchia Perkins 1 0 0 0 1 2 M ilwaukee 2 1 0 1 0 0 032 — 9 (I), Werth(I), Harper(I). SB—Yelich (2). SF—G. Hawkins 2-3 0 0 0 0 0 NATIONALLEAGUE 4 0 I 0 ISuzukipr 0 0 0 0 BurtonL,0-1 1 2 3 3 1 2 Lmrdzz2b P hiladelphia 3 0 0 0 1 0 000 — 4 Jones. 1-3 0 0 0 0 0 Logan East Oivision Flahrtyss 4 2 I 0 BRorts2b 2 0 0 I T—3:41. A—22,973(39,021). E — G e nne t (1), Rol l i ns (I), Howard (I). DPIP H R E R BBSO Downspitchedto 1batterin the8th. W L Pct GB Schoop3b 4 2 2 3 Solarte3b 4 0 I 0 H BP—by E r .John son(Morne a u). Milwaukee 1. LOB — M ilw a uke e 9, Phi l a del p hi a 8. Miami Washington 6 2 .750 Totals 3 8 5 125 Totals 3 2 4 104 C.Gomez (3), Segura (1), Ruiz2 (3), D.Brown Hand 31-3 4 3 3 2 4 T—3:23. A—22,745(50,480). Atlanta Red Sox 4, Rangers 2 5 3 .625 I B altimore 030 0 0 0 002 — 5 28 — Slowey I 2-3 3 3 2 0 I Miami 5 4 .556 tr/r N ew York 020 1 0 0 001 — 4 (2), Asche(2). 3B—Braun (I). HR—C.Gomez (3), Da.Jennings 1 3- 2 0 0 0 0 E—K.Johnson(I). DP—Baltimore3. LDB—Bal- Mar.Reynolds(2). SB—Segura(3), Ar.Ramirez (I), NewYork 3 5 .375 3 BOSTON — David Ortiz hit a Leaders Caminero I 2-3 0 0 0 I 2 Philadelphia 3 5 .375 3 timore 9,NewYork5. 28—D.Young(I), Flaherly(2), Mar.Reynolds(2).S—Gennett, R.Hernandez. three-run homer high over the IP H R E R BBSO M armol L,O-I BS,1-1 I 2 4 4 I 0 ThroughWednesday's Games Central Division Gardner(I), Beltran(3), A.Soriano(2). HR—Schoop Washington NATIONALLEAGUE W L Pct GB Pesky Pole in the eighth inning, (1), Beltran (1), K.Johnson(2). S—Jeter. SF—C.Da- Milwaukee Garza 6 8 4 3 2 4 Zimmermann 12 - 3 7 5 5 2 I BATTING —Bonifacio, Chicago,.500; Blackmon, Milwaukee 6 2 .750 vis B.Roberts. helping Boston rally for a victory T hornburg W, 2 -0 2 0 0 0 0 2 Stammen 3 1-3 2 0 0 I 4 Colorado,.471; Pagan, SanFrancisco, .462; Utley, Pittsburgh 5 3 .625 I IP H R E R BBSO Henderson I 1 0 0 I 2 Detwiler I 1 0 0 I 0 Philadelphia,.458;Rendon,Washington, .419; CudSt. Louis 5 4 .556 tr/r Baltimore overTexas. StorenBS,1-1 I 1 I I 0 2 dyer,Colorado,.415;Freeman, Atlanta, .407;TulowChicago 3 5 .375 3 M.Gonzalez 6 7 3 3 1 3 Philadelphia 7 4 3 I 9 ClippardW,1-1 I 1 I I 2 2 itzki, Colorado,.407. Cincinnati 3 6 .333 3'/z Texas Meek I 1-3 I 0 0 0 2 R.Hernandez 5 Boston I 1 0 0 0 I R.SorianoS,2-2 I 2 0 0 0 2 RUNS —Cuddyer, Colorado,10; Belt, SanFrancisWest Division MatuszW,1-0 2 - 3 0 0 0 1 0 Manship ab r hbi ab r hbi Diekman I 1 0 0 0 3 Slowey pi t ched to 2 ba tt e rs i n the 6th. W L Pct GB C hoolf 2 0 I 0 JGomslf 2 0 0 0 Tom.HunterS,3-3 I 2 I 1 0 0 co, 9; CGo nzalez, Colorado, 9; Ruiz, Philadelphia,9; B astardo L, O -I I 1 3 I I 0 HBP — by M ar m ol (M cLo ut h ). Bonifacio, Chicago,8; Mcarpenter,St. Louis, 8; LaLosAngeles 6 3 .667 New York Andrusss 4 I I 0 Przynsph I 0 1 0 De Fratus I 2 2 2 0 0 T — 3: 5 6. A — 21,19 0 (41, 4 08). R oche, Wa s hington,8;LeMahieu,Colorado,8;Prado, SanFrancisco 6 3 .667 Tanaka 7 7 3 3 1 10 Fielderdh 4 0 0 0 Sizemrpr-cf 0 0 0 0 —by Bastardo(Segura). WP —Garza, R.HernanArizona,8;Yelich,Miami,8. Colorado 5 5 .500 1r/r Riosrf 2 0 0 I Pedroia2b 4 I 1 0 Thornton 1-3 0 0 0 0 1 HBP dez 2. Bal k — G a rz a. RBI — S tanton, Miami,13;Trumbo,Arizona, 13; SanDiego 3 6 .333 3 Warren 2-3 I 0 0 1 0 Morlnd1b 4 I I I D.crtizdh 4 I 2 3 Interteague CGonzalez,Colorado, 11; Cuddyer,Colorado, 10; Arizona 3 8 .273 4 KelleyL,0-1 I 4 2 2 0 1 T—3:24. A—31,168(43,651). DMrph2b 4 0 0 0 NapoliIb 3 0 0 0 Miami,10; Belt, SanFrancisco, 9; Braun, PB — Mccann. LMartncf 4 0 I 0 Bogartsss 2 0 0 0 Indians 2, Padres 0(First Game) McGehee, Milwau kee,9;LaRoche,Washington,9. Wednesday'sGames T—3:06.A—39,412 (49,642). Braves 4, Mets 3 Chirinsc 2 0 0 0 Navarf-If 3 0 0 0 HITS—Bon ifacio, Chicago, 19; Pagan, SanFranCleveland2,SanDiego0,1st game Adduciph I 0 0 0 RRorts3b 2 0 0 0 Cincinnati 4,St. Louis0 CLEVELAND — Robbie Erlin cisco,18;Cuddyer, Colorado, 17;Blackmon,Colorado, J oWilsn3b 2 0 0 0 Carpph I 0 0 0 ATLANTA —Ervin Santana alColorado10,ChicagoWhite Sox4 Goldschmidt,Arizona,16; CG onzalez,Colorado, Kzmnffph-3b I 0 I 0 JHerrr3b 0 0 0 0 allowed one run in six innings and 16; National League SanDiego2,Cleveland1,2ndgame 14; Hecha varria, Miami,14;ArRamirez,Milwaukee,14. lowed only three hits over eight D.Rossc 3 0 0 0 Chase Headl e y' s single in the sixth Washington 10, Miami7 DOUBLES —Goldschmidt, Arizona, 5; Lucroy, BrdlyJrcf-rf 0 2 0 0 scoreless innings in his Atlanta de- drove in the go-ahead run, leading Milwaukee, Diamondbacks 7,Giants3 Milwaukee 9,Philadelphia 4 5; UriberLosAngeles,5; 9tied at4. Totals 30 2 5 2 Totals 2 5 4 4 3 Atlanta4, N.Y.Mets 3 TRIPLES — 25tiedat1. but, Jason Heyward homered and Texas 0 00 000 110 — 2 San Diego to awin over Cleveland. Chicago Cubs7, Pittsburgh5 HOMERUNS —Belt, SanFrancisco, 5; Trumbo, — 4 SAN FRANCISCO — Paul Gol d Boston 001 000 03x drove in two runs and the Braves Detroit atLA.Dodgers, lategame Cleveland's pitching dominated a Arizona,5;PAlvarez,Pittsburgh,4; Braun,Milwaukee, E—R.Ross(1).DP—Texas3. LOB—Texas6,Bos- schmidt hit a three-run homer held off the New York Mets. Arizona 7,SanFrancisco 3 3 ; Cud d y e r , C o l o rado,3;CGomez,Mil waukee,3; ton 4. 28—C hoo(2), Andrus(2), D.crtiz (2). HR 2-0 victory in the first game. Zach CGonzalez,Colorado, Today'sGames 3; YMolina, St. Louis, 3; Posey, and a sacrifice fly to pound Tim M orel a nd (I), D.Orti z (2). SB — R i o s (2). CS —C h oo Pittsburgh (Cole1-0) at ChicagoCubs(TWood0-1), pitched 7/s scoreless SanFrancisco,3. (I), Bogaerts (I). SF—Rios. Lincecum again, andArizona beat New York ab r hbi Atlanta ab r hbi McAllister STOLEN BASES—Bonifacio, Chicago,5; Revere, 11:20a.m. IP H R E R BBSO innings and Jason Kipnis hit a San Francisco. Gerardo Parra hit Philadelphia5; , Amarista, SanDiego, 3; Ccrawford, Miami (Koehle1-0) r at Washington (Strasburg0-1), Texas EYongIf 3 1 0 0 Heywrdrf 4 2 3 2 two-run homer in the sixth. Los Angel e s,3; DGordon, LosAngeles, 3; Dwings, I:05 p.m. DnMrp2b 4 0 I 0 S mmnsss 4 0 2 0 51-3 2 I 0 6 4 a two-run homer andEric Chavez R.Ross Milwaukee (Estrada 0-0) at Philadelphia(Lee2-0), OgandoL,0-1 2 Arizona,3; Segura, Milwaukee,3. DWrght3b 4 1 2 0 FremnIb 4 0 2 2 I 2 2 1 4 added an RBI triple for his first San Diego Cleveland PITCHING —13tiedat2. 4:05 p.m. Grndrsrf 3 1 0 0 CJhnsn3b 4 0 0 0 Cotts BS,2-2 2-3 I I I 0 1 ab r hbi ab r hbi ERA —Gallardo,Milwaukee,0.00; Harang,Atlanta, N.Y.Mets(Mejia1-0) atAtlanta(Hale0-0), 4:10p.m. hit in his first start of the year for DudaIb 4 0 I 0 J.uptonlf 4 0 0 0 Boston Ecarerss 4 0 1 0 Acarerss 4 0 0 0 0.71; Fernan ez, d Miami, 0.71; Wacha,St. Louis,0.71; Arizona(Delgado0-1) at SanFrancisco (Vogelsong Peavy 62-3 3 I I 4 8 Arizona. Lagarscf 4 0 I 2 uggla2b 4 0 0 0 lez,Washington,0.75;Haren,Los Angeles, 0-0), 7:15 p.m. S.Smithlf 4 0 1 0 Swisher1b 4 1 0 0 GGonza 1-3 I 0 0 0 0 dArnadc 4 0 I I Gattisc 3110 Tazawa AlonsoIb 4 0 1 0 Kipnis2b 4 1 I 2 0.75;Hudson,SanFrancisco,1.15. Friday's Games Tejadass 4 0 0 0 JSchafrcf 3 0 0 0 A.MillerW,1-0 1 I I I 0 0 sco Grandldh 4 0 00 Santandh 2 0 I 0 STRIKEOUT S—Fernandez, Miami, 17; Cueto, Miami atPhiladelphia,4:05 p.m. Wheelrp 1 0 0 0 ESantnp 3 1 1 0 uehara S,2-2 1 0 0 0 0 1 Arizona ab r hbi San Franciab r hbi Cincinnati,17;Strasburg,Washington,16; Wainwright, Tampa Bayat Cincinnati,4:10 p.m. Gyorko2b 3 0 0 0 Raburnlf 4 0 2 0 T—2:57. A—33,585(37,071). Satinph 1 0 0 0 JWaldnp 0 0 0 0 GParrarf 5 3 3 2 Pagancf 5 0 3 0 Venal ecf 4 0 0 0 Morgancf 0 0 0 0 St. Louis,16;Miley,Arizona,15;Eovaldi, Miami,14; Washington atAtlanta, 4:35p.m. Familip 0 0 0 0 Kimrelp 0 0 0 0 Prado2b 4 2 2 0 BeltIb 5 0 I 0 I.Davisph 1 0 0 0 PittsburghatMilwaukee,5:10 p.m. Nadyrf 4 0 0 0 Brantlycf-If 3 0 I 0 Ryu,LosAngeles,14;Cingrani,Cincinnati,14; Liriano, Royals 7, Rays 3 Gldsch1b 3 I I 4 Sandovl3b 4 I 0 0 Pittsburgh,14;RH ernandez, Philadelphia, 14. ChicagoCubsatSt. Louis, 5:15p.m. Hundlyc 3 0 1 0 YGomsc 2 0 0 0 Lannan p 0 0 0 0 E chavz3b 5 0 I I Poseyc 3 I 2 I Amarst3b 3 0 20 Aviles3b 3 0 0 0 SAVES —Kimbrel, Atlanta, 4; Street,SanDiego, L.A. Dodgers atArizona,6:40 p.m. Germnp 0 0 0 0 T rumolf 5 0 0 0 Pencerf 4 0 0 I DvMrprf 3 0 0 0 N.Y.MetsatLA. Angels, 7:05 p.m. 3; RosenthalSt. , Louis,3; Grili, Pittsburgh, 2; Romo, Totals 33 3 6 3 Totals 33 4 9 4 KANSAS CITY, Mo.— Alex GorC ampnlf 0 0 0 0 Morself 3 I I I SanFrancisco,2;FRodriguez,Milwaukee,2;Jansen, Detroit atSanDiego, 7:10p.m. Totals 33 0 6 0 Totals 2 9 2 5 2 N ew York 000 0 0 0 003 — 3 don hit a three-run homer and Monterc 4 0 I 0 Bcrwfrss 3 0 I 0 L os A n g e l e s , 2 ;AReed,Arizona,2;Cishek,Miami,2; Coloradoat San Francisco, 7:15p.m. S an Diego 000 0 0 0 000 — 0 Atlanta 100 030 Ogx — 4 O wingsss 4 0 0 0 Arias2b 4 0 I 0 LOB —NewYork 5, Atlanta 5. 28—Dan.Murphy Cleveland 000 0 0 2 Ogx— 2 RSoriano,Washington, 2. matched a career high with four Poll ockcf 4 0 2 0 Linccmp 0 0 0 0 E—Amarista (I). DP—San Diego1. LDB—San (1), Gatti(1). s HR—Heyward(2). RBls, leading KansasCity to a rout Arroyo American League p 2 I I 0 Adrianz ph I 0 0 0 AMERICANLEAGUE Cleveland6.28—S.Smith (1), Hundley(2), I P H R ER BBSO Diego 7, H ill ph 1 0 I 0 Petit p 0 0 0 0 Amari sta (I), Rab urn(1). HR —Kipnis(1). of TampaBay intheir series finale. BATTING —Kubel,Minnesota, .462;SPerez,KanNew York Angels 2, Mariners 0 Cllmntrp 1 0 0 0 Blancoph I 0 0 0 IP H R E R BBSO sas Ci t y,.458; Fl owers,Chicago,.444;JHamilton, Los WheelerL,0-2 5 8 4 4 0 6 JGutrrzp 0 0 0 0 San Diego Angeles, .444;Solarte,NewYork, .429; AIRamirez, Familia 2 0 0 0 0 I TampaBay KansasCity M achip 0 0 0 0 52- 3 5 2 I 2 I Chicago,.412;Longoria,TampaBay,.371. SEATTLE — Albert Pujols homLannan 0 1 0 0 0 0 Stults L,0-2 ab r hbi ab r hbi 2-3 0 0 0 0 I RUNS —Bautista, Toronto,9; Dozier,Minnesota, H uffp 0 0 0 0 Germen Vincent I 0 0 0 0 I eJesslf 4 0 0 0 Aokirf 4I 1 1 ered for the second straight game D I 2-3 0 0 0 I 2 HSnchzph I 0 0 0 A.Torres 8; Eaton,Chicago,8; Beltre, Texas, 7; CD avis, BaltiAtlanta Z obrist2b 4 0 I 0 Giavtll2b 3 I 1 1 while Garrett Richards andtwo Totals 3 8 7 127 Totals 3 4 3 9 3 more,7;JHamilton, LosAngeles,y; Plouffe,MinnesoE .San tanaW,I-O 8 3 0 0 0 6 Cleveland Joycedh 3 0 I 0 HosmerIb 4 2 2 0 Arizona 302 200 000 — 7 McAllisterW,1-0 72-3 5 0 0 0 7 ta, 7;AIRamirez, Chicago,7. J.Walden 1 -3 1 2 2 I I Longori3b 2 0 I 0 BButlerdh 4 I 1 1 relievers combined on aone-hitter 1-3 0 0 0 0 I San Francisco 011 010 000 — 3 RBI—Abreu,Chicago,11; Colabello, MinnesoKimbrelS,4-4 2 - 3 2 1 I I 2 Allen H,I G uyerph I I I 0 AGordnlf 4 I 2 4 astheLosAngelesAngelsbeat DP — A ri z ona1. LDB — A riz ona 7, San Fr a n ci s co A xford S,4-4 I 1 0 0 I 2 ta, 11; AGordon,KansasCity, 9; Moss,Oakland,9; Lannanpitchedto I batterinthe8th. LoneyIb 4 0 0 0 S.Perezc 3 0 1 0 8. 28 — P oll o ck (3). 38 — G .P arr a (I), E.chavez (1). WP — Ax ford. Smoak, Seattle,9; Napoli,Boston,8; Ortiz, Boston, 8. W P — W h eele r. Seattle. On thedaythe Angels lost DJnngscf 4 2 2 2 Mostks3b 4 0 0 0 HR—G.Parra (1), Goldschmidt (2), Posey(3), Morse T—2;30.A—0(42,487). HITS—AIR amirez, Chicago, 14;Mecabrera,ToT—2:40. A—I9,608(49,586). M yersrf 4 0 2 0 L.caincf 3 I 1 0 Josh Hamilton for potentially up (2). SB — Pagan (2). S —Lincecum. SF—Goldronto,13;Longoria,TampaBay,13; 9tiedat12. Hanignc 4 0 0 I AEscorss 3 0 1 0 schmi d t. DOUBLES — DeJennings,TampaBay,6;Solarte, to two months to injury, Pujols YEscorss 4 0 0 0 Padres 2, indians1 IP H R E R BBSO Reds 4, Cardinals 0 NewYork,6; Carter,Houston,4; Colabello,Minnesota, Totals 34 3 8 3 Totals 3 2 7 10 7 provided the biggest blow. Hehit 4; Kubel,Minnesota,4; Navarro, Toronto,4; SPerez, (Second Game) T ampa Bay 0 0 0 1 0 0 002 — 3 Arizona a two-run homer in the third off ArroyoW,1-0 5 6 3 3 1 2 ST. LOUIS —Billy Hamilton had Kansas City, 4; Pujols, LosAngeles, 4. Kansas Cit y 0 0 0 2 6 0 Bgx— 7 C ollmenter S,I-I 4 3 0 0 1 4 TRIPLES —Aoki, KansasCity, 2; Fuld,Oakland, E—Zobrist(2). DP—TampaBay1, KansasCity1. Seattle starter Roenis Elias (0-1). LOB three hits and his first two steals, San Diegoab r hbi Clevelandab r hbi 2; 25 tiedat1. —TampaBay6, Kansas City 4. 2B—Guyer (1), San Francisco That was all the offense theAngels De.Jennings(6). 38—Aoki (2). HR—De.Jennings Lincecum L,0-1 4 7 7 7 1 5 and scored easily after tagging HOME RUNS—Bautista, Toronto, 4; Mecabrera, Ecarerss 4 2 2 0 EIJhnsrf 4 0 0 0 2 2 0 0 0 4 Toronto, 4; De Aza, Chicago, 3; Hart, Seatle, 3;ToDenorfirf-If 4 0 1 0 Swisher1b 4 0 I 0 (I), A.Gordon(1). CS—A.Gordon (I), A.Escobar(1). Petit got, but all they neededwith how up on a shallowoutfield pop flyto J Gutierrez I 0 0 0 0 1 rHunter, Detroi t, 3;20tiedat 2. SF — Giavotela. S.Smithdh 3 0 0 1 Kipnis2b 4 0 0 0 Richards was pitching. Machi I 2 0 0 0 1 support a strong outing from Mike STOLEN B A SES—Ellsbury,NewYork,4; Altuve, AlonsoIb 3 0 0 0 CSantnc 4 0 0 0 IP H R E R BBSO Huff I I 0 0 1 0 Leake in Cincinnati's victory over H eadly3b 4 0 1 1 Raburnlf 4 0 I 0 Houston,3;Dozier,Minnesota,3; Kipnis,Cleveland,3; TampaBay Los Angeles Seattle —byArroyo(B.crawford). WP—Arroyo. Villar, Houston,3; 15tiedat 2. Gyorko2b 4 0 0 0 Morganpr 0 0 0 0 OdorizziL,1-1 5 10 7 7 1 4 HBP St. Louis. PITCHING —Paxton, Seattle, 2-0; Feldman, ab r hbi ab r hbi Medicalf 2 0 0 0 Brantlycf 3 0 0 0 B.Gomes 1 0 0 0 1 1 T—2:52.A—41,157(41,915). C owgilllf 4 0 1 0 Almontcf 3 0 I 0 Grandlph I 0 0 0 YGomsdh 3 1 I 0 Houston,2-0; Allen, Cleveland,2-0; Guthrie, Kansas Beliveau 1 0 0 0 0 1 Troutcf 4 1 0 0 BMillerss 4 0 0 0 Cincinnati St. Louis Venalerf I 0 0 0 Acarerss 4 0 2 0 City, 2-0;Buehrle,Toronto, 2-0; Kazmir, Oakland, 2-0; C.Ramos 1 0 0 0 0 0 Cnbs 7, Pirates 5 ab r hbi ab r hbi Pujolsdh 4 1 2 2 Cano2b 4 0 0 0 A marst cf 3 0 1 0 Aviles 3b 2 0 I I Lackey,Boston, 2-0; Sale,Chicago, 2-0; FHernandez, KansasCity BHmltn cf Freese3b 3 0 0 0 Smoak1b 2 0 0 0 4 2 3 0 Mcrpnt3b 4 0 0 0 Rivera c 2 0 0 0 Seattle,2-0;Richards,LosAngeles,2-0. GuthrieW,2-0 7 4 I I 1 4 ERA —Buehrle, Toronto, 0.64; Feldman, Houston, H Kndrc2b 4 0 1 0 Hartdh 3 0 0 0 Crow CHICAGO — Jason Hammel threw Phillips 2b 5 0 2 I Wong2b 4 0 1 0 Totals 31 2 5 2 Totals 3 2 1 6 I 1 I 0 0 0 0 Calhonrf 4 0 1 0 Seager3b 4 0 0 0 Votto 1b 4 0 0 0 Hollidylf 3 0 1 0 S an Diego 100 0 0 1 000 — 2 0.66; Richards,LosAngeles, 0.75; Gray,Oakland, K.Herrera 1 3 2 2 0 0 seven strong innings, Anthony lannettc 4 0 0 0 Morrsnrf 3 0 0 0 Brucerf 3 0 0 I MAdms1b 3 0 1 0 C leveland 001 0 0 0 000 — 1 0.75; Scherzer,Detroit, 1.20;Vargas,KansasCity, HBP —byGuthrie (Longoria). Rizzo had four hits, and theChica- Frazier3b 4 0 0 0 YMolinc 3 0 1 0 E—A.cabrera (I). LDB—SanDiego 6, Cleveland 1.20; Tilman,Baltimore,1.35; Porcello,Detroit,1.35. I Stewrt1b 4 0 0 0 Ackleylf 3 0 0 0 T—2:46. A—13,612(37,903). J McDnlss 3 0 2 0 Zuninoc 3 0 0 0 HeiseyIf 4 1 2 0 JhPerltss 2 0 0 0 7 . 28 — D e n o rfi a (I), A.cabrera (2). SB—E.cabrera STRIKEOUT S—FHernandez, Seattle, 19;Tanaka, go Cubs beat Pittsburgh despite T otals 3 4 2 7 2 Totals 2 90 I 0 Mesorcc 4 1 2 2 Jayrf 3000 (I), Amarista(3), Morgan(2). CS—E.Cabrera(2). NewYork, 18;Scherzer, Detroit, 15; CWilson,Los Blue Jays 7, Astros 3 allowing five solo home runs. S—Rivera.SF—Aviles. L os Angeles 00 2 000 000 — 2 RSantg ss 4 0 I 0 Neshekp 0 0 0 0 Angeles,15;Sale,Chicago,14; Buehrle, Toronto, 14; Seattle 0 00 000 000 — 0 Leake p 3 0 0 0 Bourjoscf 3 0 0 0 IP H R E R BBSO Lester,Boston,14. E—Jo.McDonald (2), H.Kendrick (2). DP—Los TORONTO Pitlsburgh Chicago Berndn ph 1 0 0 0 SMillerp 1 0 0 0 San Di e go SAVES—A xford, Cleveland, 4; Santos,Toronto, — Brett Lawrie hit a Angeles1.LOB —LosAngeles7, Seattle 6. HR —Pu- two-run homer, Brandon Morrow ab r hbi ab r hbi MParrp 0 0 0 0 Descalsph 1 0 0 0 Erlin W,1-0 6 4 I I 0 6 3; TomH unter, Baltimore, 3; Holland, Kansas City, 3; jols (2). SB —Calhoun(2). Martelf 4 0 0 0 Bonifaccf 5 2 2 0 Choate p 0000 ThayerH,2 2-3 0 0 0 I 0 Rodney,Seattle,2; Balfour,TampaBay, 2;uehara,BosIP H R E R BBSO won for the first time in almost11 Sniderrf 4 I I I S castross 5 0 I 0 Maness p 0000 BenoitH,2 I 1-3 1 0 0 0 2 ton,2; Robertson, NewY

entandtngs All TimesPDT

J.SmithH,I Frieri S,1-1

Suspensions Continued from C1 On the road, opposing fans will not let them forget. "All I can do is focus on things I can control," BraLI said.

He responded to jeering Philadelphia fans Tuesday by hitting three homers and drivingin seven runs. Aided by the support of his new teammates, Cruz easily made the transition into the next stage of his ca-

reerafter leaving the Texas Rangers forBaltimore.

"It was a hard decision. You had a chance to be in one place for a long time," Cruz said. "But I made the right

calL I'm happy I made it." Braun, who stayed with Milwaukee aftera 65-game suspension, was

cheered by Brewers fans at the home opener and jeered later that week in

1 1

0 0 3 0 0 0 0 0 0 0 1

6 2 1

months andTorontobeatHouston.

"It's going to be hostile everywhere after serving a 50-game suspension he goes," Brewers manager Ron Roewith Detroit, heard boos in Cincinnati nicke said. "We've talked. He knows and Pittsburgh before getting a warm what's going to happen. He's been reception from Cardinals fans in his going through this thing for (a while). home debut Monday. Really, any great player goes into cer"When we're playing Cincinnati tain cities and they get booed. Alex and Pittsburgh, fans are going to talk Rodriguez got booed in every city no matter what," Peralta said. "But he went just because he signed a big I don't try to pay attention to people contract." when they say a lot of stuff. I try to On his way to hitting a major play the game and try to forget about league-leading 53 home runs last the past." year, Orioles first baseman Chris DaThat is what's great about baseball, vis openly criticized those who use Cruz said. performance-enhancing drugs. But "What you do in the past is over, he welcomed Cruz to Baltimore and is whether you have good or bad mo- one of his most vocal supporters. "Obviously, when a guy tests posiments," he said.

"In today's world, none of us would Or did he stand up and say: 'I'm going like to have our lives judged by our to serve my suspension. I'm going to worst decision, including me," Orioles come back and rebound from it.' " manager Buck Showalter said."I can't After explaining that he used a speak for otherpeople, but I think Nelbanned substance to treat a gastroin- son is pretty sincere about trying to testinal infection in 2012, Cruz accept- go forward instead of looking back. It ed the suspension with the words, "I doesn't surprise me with our fans." made an error in judgment that I deepPeralta was batting .074 through ly regret, and I accept full responsibili- 'Ttzesday, but Cardinals fans are treatty for that error." ing him as one of their own. "They (Orioles fans) supported not "The fans here, they're pretty good only him, but what he stands for," Da- with me," he said. "What's happened vis said. "The guy plays hard. He has is in the past and I'm trying to put this a good time. He's going to give you away and trying to focus on 2014." everything he's got. I think the fans As with Cruz and the Orioles, Perappreciate that, and seeing them get alta made peace with his Cardinals behind him was pretty awesome." teammates soon after his arrival. "Everybody around here had their The reception BraLI has received tive, you're not happy about it. But at Cruz was cheered again when he on the road is not surprising, even the same time, there has to be some homeredinBaltimore'ssecond game. conversations, and he had the ones though he apologized several times point in time when we forgive and He received no reaction, positive or he needed to have around here," St. this offseason after accepting his sus- move on," Davis said. "The biggest negative, during the Orioles' opening Louis manager Mike Matheny said. "After that, we just moved forward." pension on July 22. thing to remember is: How did he han- road series in Detroit. Boston. Peralta, now with St. Louis

dle it? Did he try to rktn away from it?

TH E BULLETIN• THURSDAY, APRIL 10, 2014

Outlawssnuff rallyfor leaguewin PREP ROUNDUP

Bulletin staff report SISTERS — Safe to say Sisters

coach Steve Hodges got a little nervous on Wednesday. The Outlaws led 6-0 heading into the top of the seventh inning, but Sweet Home tacked on five

runs, but onlythree were earned in

tunately for Sisters, Joey Morgan shut down the Huskies' come-

a Class 2A/1A nonconference loss, snapping Culver's six-game winning streak. Adam Knepp started on the mound for the Bulldogs (73), striking out six in three innings and allowing just one run. Butnine Culver errors opened the door

back, striking out the final batter

for Dufur/South Wasco County,

runs to trim the deficit to one. For-

with the tying run on third base to which tagged the Bulldogs for 13 secure the Outlaws' 6-5 Sky-Em runs in a five-inning victory. Wyatt League baseball victory. Rufener paced Culver with a 2-for"This makes them realize that 2 day at the plate. they have to stay intense for all sevSOFTBALL en innings, not just think, 'Oh, this Cottage Grove 8, La Pine 0:LA one's over,'" Hodges said."We defi- PINE — The host Hawks held their nitely learned something from it." own with 12 hits, but they could Morgan went the distance for not push anything across the plate Sisters (2-0 Sky-Em, 8-2 overall), in a Sky-Em League setback. Kestriking out eight while going 2 for ara Parrish and Kinsey Pinckney 4 at the plate. Jardon Weems was 3 for 3 with three RBIs for the Outlaws, and Justin Harrer was 1 for 3.

In other Wednesday action:

had three hits apiece for La Pine

PREP SCOREBOARD

Gage's victory in the discus and Jill Roshak's first-place finish in the javelin. The Summit boys completed the sweep with a 7669 win over the Cougars. Calvin Aylward (javelin), Kyle Heimuller (shot put) and Michael Menefee (high jump) led the way with wins in their respective events. Chris Adamo took the 100 and the triple jump for Mountain View, while Dantly Wilcox claimed wins in

Bend Dallas

Class 4A Tri-VaNey Conference

Tep threeplacers 400-meter relay —1, Bend(Gitbert, Neelon ,Johnson,Bell),44.83.2,Redmond, 46.82.1,500 — 1, Austin Jewshury,8, 4:45.86. 2,JordanIrwin, B, 4:46.19.3, Matt Stewart, R,4:48.99. 3,000 — 1, Remington Class4A Williams, R,10:27.41. 2, Austin Jewsbury, Sky-EmLeague 8, 10:27.69. 3,AlecCarter, R, 10:40.01. 100 (0 innings) — 1, BradeBell, 8, 11.73. 2, LoganBlake, CottageGrove611 40 — 12 114 8, 11.81. 3, MaxWegner, 8, 11.86. 400 La Pine 002 00 — 2 5 10 — 1, JackArmstrong,B, 55.53.2, Westley Kessinger,B, 56.84. 3, BrandonBenson, R, Class2A/1A 56.95.110h —1, BrandonGilbert, B,16.18. Noncenference 2, AlaniTroutman, R, 17.00. 3, NoahHaines, (5 innings) 8, 18.24.800— 1, CalebHoffman, 8, 1:59. Dnfnr/SWC 043 42 — 13 0 1 2, GavinJohnson,R,2:21.74. 3, AndrewVaCulver 0 0 0 00 — 0 4 9 nasen, 8,2:23.91.200—1, LoganBlake, 8, 22.94. 2,CodyMaguire, B,23.94. 3, Jacoby McNamara ,R,24.21.300h— 1,CalebHoff Softball mann, 8,41.50.2, NoahHaines,8, 42.14. 3, Class4A Sam Nelson,8, 43.23. 1,600 relay — 1, Sky-EmLeague Bend (Blake,Maguire, Haines,Hoffmann ), Cett. Grove 004 031 0 — 0 16 0 3:36.12. 2,Redmond,3;56.21. La Pine 000 000 0 — 0 12 3 HJ —1, MaxMeade,8, 5-10. 2, SamEdwards, 8, 5-8.3, AlaniTroutman,R,5-8. Discus — 1,Spencer Dorricott, R,87-1.2, Jake Track and field Brauchler,R,104-6.3, LoganJohnson,B,973.PV —1, Montgomery Cowlbeck, B,11-6. BOYS Summit76, MountainView69 2, Joshua Zachem, 8,11-0. Shot— 1,Jaylin At SummitHighSchool Robinson,8, 42-11.25.2, SteffanKearsley, 8, 42-1. 3,JakeBrauchler, R,40-9.75.Javelin Top threeptacers 400-meter relay —1, Summ it (Isaac —1, DonniePate, R,122-0. 2, SamEdwards, Derman, Jacob Allen, Marc Hasenoehrl, 8,115-11. 3,BradyBarker,R,115-9. TJ—1, AustinSandsness), 44.96. 2, Mountain View, ConnorScott, B, 40-3. 2, DavidBarajas, R, 45.37. 3,MountainView,47.10. 1,500 —1, 36-7.5. 3,TorrentCannon, 8, 36-2. LI — 1, MatthewMaton, S, 4:45.48. 2, Travis Mar- JordanNeelon, B,19-8.5. 2, MaxWegner, 8, tin,MV, 4:52.44.3,Camden Hammer , S, 18-3.5. 3,KylerWilkerson,R,18-3.5. 4:57.55.3,000 —1, Nathanael Benson, MV, 10:16.50. 2, Scott Kinkade, S, 10:17.90. 3, GIRLS TomSchoderbek,S, 10:19.100 —1, Chris Summit100, Mountain View43 Adamo,MV,11.64. 2, lanLyharger, S,11.72. At SummitHighSchool 3, Austin Sandsne ss, S, 11.75.400 — 1, Tep threeplacers ThomasBrown,S, 54.84. 2, NoahHall, S, 400-meter relay — 1, Summi(Stet 58.54. 3,DylanSmellzer, MV,60.16.110hvenson,Buzzas,Cochran, Thomas), 48.80. 1, DantlyWilcox, MV,15.73.2, Thomas Car- 2, MountainView,52.27. 3, Summit, 53.53. ter, S, 17.63.3, OtmarBorchard III, S, 18.43. 1,500— 1, SageHasseg, MV,5:19.02. 2, 800 —1, GabeWyllie, MV,1:57.76.2, Sam MeganO'Neil,S,5:58.42.3,000— 1,Mary King, MV,1:58.82.3,EthanAxten,S,2:09.89. HadleySchoderbek,S, 11:14.20.2, Madison 200 —1, lan Lybarger,S,24.21. 2, Jacob Leapaldt,MV,11:18.30. 100 — 1, Hannah Allen, S,24.41.3, Chris Adamo,MV,24.73. Cochran,S,13.05.2, AlexaThomas,S,13.20. 300h —1, DantlyWilcox, MV,42.33. 2, 3, Emma Stevenson, S,13.28. 400—1, HilCameron Weaver,S,44.21. 3, ThomasCarter, ary Wyllie,MV,1:03.16.2, MeganBuzzas, S, S,44.52.1r600relay —1, Mountain View 10373.3,HalleGlanvige,MV10566.100h (GabeWygie,ChristianVanSise, DanlyWil— 1, CamilleWeaver, S, 16.35. 2, Megan cox, Sam King), 3:29.61. 2, Summit, 3:43.12. Cornett, S,17.17.3, KyleeRoberts, S,18.58. 2, Summit3:52.21. , 3, Summit, 3:51.44. 800 —1, EmmaStevenson, S, 2:24.13. 2, HJ —1, MichaelMenefee,S, 6-02. 2, Ciara Jones,MV,2:25.24. 3, Tia Haton, MV, JoshCherry,S,5-10.T3,ZachEmerson, MV, 2:27.88.200 — 1, HannahCochran, S, 5-06. T3,AndreJackson, MV,5-06. Discus 26.35. 2,AlexaThomas,S,26.60.3,Miranda —1, BlakeKnirk, MV,139-11. 2, RileyShelBrown,S, 26.75.300h —1, Camile Weavton, S,131-05.3, Kyle Heimuller, S, 128-02. er, S, 50.02. 2,KyleeRoberts, S, 55.15. 3, PV —1, TreyBracelin, S, 10-06.2, Tanner Mackenzie Jeffcott, MV,56.85. 1,600 relay Chauncey,MV,9-00. 3, Tristan Scott, MV, —1, Summi(Morgan, t Ellington, Reininger,

North Marion 8, Madras 0:AURORA — A l though the W hite Buffaloes were swept i n t h eir

Class 4A/3A/2A/1A Special District 2 matchup, the No. 1 doubles team of Oved Felix and Jered

Pichette put on their best performance of the season, according to Madras coach Margaret Kincaid, BOYSLACROSSE

less game with four runs in the North Medford 19, Mountain third inning. View 6: MEDFORD — The Class Sweet Home 11, Sisters 1: 5A Cougars dropped their sixth SWEET HOME — With a five-instraight and fell to 2-6 overall in a ning Sky-Em League defeat to

Bend 17, Harney 3:Nine different players scored for the Lava Bears in their High Desert League

five-inning nonconference loss to 6A North Medford.

Sweet Home, the Outlaws drop to

with four goals and two assists,

PINE — Tristan Cox was 2 for 2 at the plate to lead the Hawks in the

STONE — The White Buffaloes struck out 18 times against the

opener at 15th Street Field. Eli Pite

led Bend (1-0 HDL, 5-1 overall)

0-2 in league play and 0-10 overall. James Rockett recorded four Cottage Grove 12, La Pine 2: LA Gladstone 4, Madras 0: GLAD- goals and one assist, and Cohl

Sky-Em League loss. La Pine (0-2 Gladiators' Megan Kirchem, dropSky-Em, 1-11overall) committed 10 ping Madras to 0-2 in Tri-Valley errorsinthegame, which ended af- Conference action and 4-8 overall. ter five innings via the 10-run rule. TRACK AND FIELD La Salle 14, Madras 4: MASummit sweeps dual: Behind DRAS — Austin Rauschenburg three wins by Camille Weaver, was 2 for 2 with an RBI and a run the Storm cruised to a 100-43 scored for the White Buffaloes,

who fell to 0-2 in Tri-Valley Conference play and 4-8 overall. Ethan Short paced Madras with a 2-for-3

performance that included an RBI. Dufur/South Wasco County 13, Culver 0: CULVER — The Bull-

dogs gave up a season-high 13

Bend113, Redmond31 At Bend HighSchool

Class4A Sky-EmLeague SweetHome 000 0000 — 0 7 3 Sislers 103 020 x — 0 8 3

the 110- and 300-meter hurdles. BOYS TENNIS

Cottage Grove broke open a score-

Class5A Noncenference 020 000 2 — 4 7 0 000 010 0 — 1 4 1

LaSalle 203 701 1 — 140 4 Madras 081 000 0 — 4 011

(0-2 Sky-Em, 6-6 overall), while falling in a competitive three-set BaileyWood smacked a double. match 6-2, 3-6, 7-5.

BASEBALL

9-00.Shot— 1, KyleHeimuger, S,43-08. 2, Riley Shelton, S, 42-07. 3, BlakeKnirk, MV,41-02.Javelin —1, Calvin Aylward,S, 174-02. 2,BlakeKnirk, MV,163-00r 3, Uriahs Smith, MV,148-11. TJ — 1, Chris Adamo, MV, 40-02. 2,Justin Wiley,MV,38-08.5. 3, Eli Warme nhoven, S, 38-05. IJ — 1, Jace Johns,MV,19-09.2, WalkerMittnacht, MV, 19-06.5. 3,Cameron McCormick, S,19-03.5.

Baseball

Johnston dished out two assists

and scored twice. GIRLS LACROSSE

Central Oregon Lacrosse 13, Marist 12 (OT): Annie Beaver scoredwith 24seconds remaining in the second overtime period to

give Central Oregon the victory over the Spartans of Eugene. Beavictory over v isiting Mountain ver finished with four goals and View. Weaver posted victories in one assist to lead Central Oregon the 100- and 300-meter hurdles (5-0), and Cayley Allan had five as well as the triple jump, while goals. Kyra Hajovsky added three Hannah Cochran (100 and 200) scores, including the tying goal in and Emma Stevenson (800 and regulation to force overtime. Goallong jump) each added two wins. ie Kelsey Norby finished with five The Cougars were led by Wendi saves for Central Oregon.

Wicker),4:14.74.2, MountainView,4:17.45. 3,MountainView,4:37.59. HJ —1, DanieleTaylor, S,5-02. 2, Kara Meeuwsen,S,5-00. 3, JadeDanek, S, 4-10. Discus —1, WendiGage,MV,95-09. 2, EmileeSweider, MV,90-09. 3, Molly Rygg, S, 90-03.PV— 1, MelanieNachtmann,MV, 7-06. 2,NicoleHinz,S, 7-06.3, TrinleySherpa, S,7-00.Shot— 1,BriannaMarderos, S, 35-01.5. 2,ClaireHaley,S,32-02.5r3, Megan Cornett, S, 29-05.Javelin —1, Jil Roshak, MV, 95-07. 2,HageGlanvige, MV,86-06. 3, EmilyHase noehrl, S,85-05.TJ— 1,Camille Weaver,S,33-11.75. 2, AijahRandolph, MV, 32-06.75. 3,AlexReininger,S,30-06. IJ —1, EmmaStevenson,S,17-02.2,MirandaBrown, S,16-06.75. 3, Camile Weaver, S,15-09.50.

Bend118, Redmond25 At BendHighSchool Topthreeplacers 400-meter relay — 1, Redmond (Naughter,Sibley,Conley, Ochsnerj, 54.81. 1,500— 1, SarahPerkins, 8, 5:23.03.2, Rylee King, 8, 5:45.02. 3, AndreaBroyles, R, 5:53.59.3,000 — 1, SarahPerkins, B, 11:52.31. 2, RyleeKing, 8, 12:30.63. 100 —1, Macey Burgess, 8,13.35. 2,SiaSibley, R, 14.10. 3,Jennepher Velasquez, 8, 14.17. 400 —1, SophiaCunningham,8, 1:03.70. 2, MaceyBurgess, 8, 1:04.10. 3, Makenn a Conley,R,1:04.33.110h—1,AlexaEvert, B, 17.37. 2,BrittanySmith, R,18.12.3, Meagan Bakker, B,18.46.800 — 1, SarahCurran, B. 2:44.19. 2,MyKenzie Gabriel, R, 2:57.30. 3, Alison Sumerlin, R,2:57.91. 200 — 1, MarvelLuzell, B,30.14.2, KaylieNelson,8, 30.45. 3,JasmineChapman, 8, 30.50. 300h —1, Meagan Bakker, 8,49.78. 2,AlexaEvert, B. 52.48. 3, KateHodson, B,54.79. 1,600 relay — 1, Bend(Burgess, Curran,Vu,Cunningham),4:26.61.2, Redmond, 4:58.83. HJ — 1,SarahCurran, 8, 52-2. 2, Sydni Williams, 8,4-6. 3,JesslynMurphy,B, 4-6. Discus — 1,Ali Laborin, B,101-4. 2,Vanessa Guerrero,R,84-10.3, MaddisonSumrag, 8,79-4. PV— 1,SamanthaMcGee,8,9-6.2, AspenPeterman,8, 7-6. Shot— 1, Maddison Sumrall, B, 32-11.2,Ali Laborin,8,29-5. 3, Vanessa Guerrero,R,28-5.5. Javelin —1, AliLaborin,B,99-1.2, SarahWavers, B,97-4. 3, Vanessa Guerrero, R,71-8.TJ—1,Amanda Mahaney, 8, 27-11. 2, Sydni Wiliams,B, 27-3.5. 3, ChristaMyers, 8, 25-7. LJ— 1, Sydni Williams,8,14-2.5. 2, AlexaEvert, B, 13-10.5. 3,AspenPeterman,B.13-7.5.

Girls tennis Class4A/SA/2A/1A Special District2 Madras 7,NerlhMarion1 At Madras Singles — ttzelRomero,M,def. E.Snyder, NM,6-3,6-0;MeganForistag,M,def.N.Neharaze,NM,7-5,6-3; JessicaGonzalez,M,def.R. Dahlke,NM,6-3, 6-0;E.Snyder,NM,def. Pali KaloiJordan,M,6-1,6-2. Doubles—Wendy Gatan/Lorena Alonso, M,def. K.Parkinson/J. Suchanski,NM,7-5, 6-1;JessicaAlaver/JasmineIke-Lopez,M, defr T.Kacoby/L. Grigorieff, NM, 6-1,6-3; StephanieOlivera/Milissa Olivera, M,def.R.Brumen/C. Christiansen,NM,7-5, 6-0; DaniSchmaltz/Tyra Thomas, M, def. M. Bolello/C.Studer,NM,6-2,6-2.

Late three byWright leads Blazers tovictory over Kings NBA ROUNDUP

The Associated Press

Also on Wednesday: Pacers 104, Bucks 102:MILWAUKEE — Chris Copeland's driving layup with 1.2 seconds remaining late-charging Sacramento Kings 100- gave Indiana a victory over Milwau99 on Wednesday night. kee that moved them back into first Ray McCallum missed a 21-foot place in the Eastern Conference.

over Boston.

Raptors125, 76ers 114: TORONTO Jonas Valanciunas had 26 points a nd 12 rebounds to lift Toronto over

Bulls 102, Timberwolves 87:MIN-

PORTLAND — Dorell Wright hit a 3-pointer with 7.9 seconds left and the Portland Trail Blazers beat the

the only field goal for either team in N EAPOLIS — D.J. Augustin scored overtime, and Charlotte won its fifth 21 points and Joakim Noah posted Ph iladelphia. straight. his league-leading fourth triple-douMagic 115, Nets 111: ORLANCavaliers122, Pistons100:CLEVE- ble of the season, leading Chicago D 0, Fla. — Arron Afflalo scored 25 LAND — Dion Waiters scored 22 over Minnesota. points, E'Twaun Moore added 17 and jumper as time ran out for the Kings Grizzlies 107, Heat102: MEMPHIS, points and Cleveland played one of Suns 94, Pelicans 88: NEW OR- 0 rlando held off a late rally to beat and Portland's Robin Lopez grabbed Tenn. — Zach Randolph had 25 its best games this season, routing L EANS — Gerald Green scored 21 Brooklyn. the rebound and held it tight for the points and 11 rebounds, Marc Gasol Detroit before being eliminated from points, and Phoenix won its third Thunder 107, Clippers 101: LOS victory. It was Wright's only basket of added 20 points and 14 rebounds and theplayoffchase. straight game. A NGELES — R ussell Westbrook the game. Memphis kept its playoff hopes alive Hawks 105, Celtics 97: ATLANTA Nuggets 123, Rockets 116:DEN- sc ored 30 points in his return to the LaMarcus Aldridge had 22 points with a victory over Miami. — Jeff Teague scored 19 points, Kyle VER — Randy Foye scored 24 of his lin eup, Kevin Durant added 27, and to lead the Blazers, who have won six

of their past seven games.

Bobcats 94, Wizards 88: WASHINGTON — Kemba Walker made

Korver added 17 and Atlanta helped

30 points in the second half, and Den- 0 klahoma City held off the Los An-

its playoff chances with a victory

ver hung on to beat Houston.

geles Clippers.

Find Your Dream Home In Real Estate ••

NBA SCOREBOARD 12), Portland51(Lopez, Robinson9). Assists—Sacramento19(McCagum8), Portland 26Nttard10). Total Fouls—Sacramento 19, Portland 19. Technicals-

lntandings AN TimesPDT

EasternConference W L 54 25 53 25 46 32 46 32 43 35 40 38 40 38 35 43 33 45 32 47 29 50 23 55 23 55 17 61 14 64

Pcf GB .684 .679 'Ir

y-Indiana y-Miami x-Toronto .590 7'/2 x-Chicago 590 71/2 x-Brooklyn 551 10rd x-Charlotte .513 13'/r x-Washington .513 13'/r Atlanta .449 18'Ir NewYork .423 20'/r .405 22 Cleveland .367 25 Detroit .295 30'/r Boston Orlando .295 30'/r Philadelphia .218 36'Ir Milwaukee .179 39'/r WesternConference W L Pct GB y-SanAntonio 60 18 .769 y-Oklahoma City 57 21 .731 3 y-L.A.Clippers 55 24 .696 5'Ir x-Houston 52 26 .667 8 x-Portland 51 28 .646 9r/r 48 29 .623 11'N Golden State Dallas 48 31 .608 12'/r Phoenix 47 31 .603 13 Memphis 46 32 .590 14 Minnesota 39 39 .500 21 Denver 34 44 .436 26 NewOrleans 32 46 .410 28 27 52 .342 33'/r Sacramen to L.A. Lakers 25 53 .321 35 Utah 24 54 .308 36 x-clinched playoffspot y-clinched division

Wednesday'sGames Orlando115,Brooklyn111 Charlotte94,Washington 88,OT Cleveland122,Detroit100 Toronto125,Philadelphia114 Atlanta105,Boston97 Chicago102,Minnesota87 Indiana104,Milwaukee102 Memphis107,Miami102 Phoenix94,NewOrleans88 Denver123,Houston116 Portland100,Sacramento99 Oklahoma City107, L.A.Clippers101

Today'sGam es SanAntonioatDalas, 5p.m. Denverat GoldenState, 7:30p.m.

Summaries Wednesday'sGames

Blazers100, Kings99 SACRAM ENTO(00) Outl aw2-81-25,Thompson4-60-28,Cousins14292-330, McCallum 7-155-523,McLemore6-133-4 16, Evans2-40-04,D.Wiliams2-93-47, Acy1-1 2-2 4,Cunningham1-60-02.Totals39-9116-2209. PORTLAND (100) Batum 5-80-011, Aldridge9-204-622, Lopez4-7 5-6 13, Litlard6-11 4-519, Matthews7-123-3 19, Robin son4-50-08,Watson0-10-00,Barton2-6 1-25, Wright1-50-03.Totals38-7517-22100. Sacramento 20 2 6 20 28 — 90 Perlland 27 29 23 21 — 100 3-PointGoals—Sacramento 5-11(McCagum4-4, McLemore1-3, DWigiams0-1, Cunningham0-1,Outlaw 0-2),Portland7-23(Lglard 3-7, Mathews2-7, Batum1-3,Wright1-4,Barton0-1,Watson0-1). Fouled Out — None. Rebounds— Sacramento 49 (Cousins

Sacrame nto defensivethreesecond, Lopez,Portland defensivethreesecond2.A—20,002(19,980).

1-2 13,Teague6-124-419, Korver5-83-317, Scott6-9 0-113, Mack2-60-05, Wiliams3-43-39, Muscala 1-1 0-02,Martin0-00-00. Totals 40-7616-22105. Boston 28 28 26 20 — 07 Atlanta 82 24 14 35 — 105

Griulies107, Heat102

Magic115, Nets111

MIAMI (102) James14-236-737, Batier 3-60-0 9, Bosh6-14 0-013, Chalmers 5-10 2-212, Douglas0-2 0-00, Lewis5-8 3-317, R.Allen2-40-0 6, Cole1-4 0-03, Hamil ton2-20-05.Totals30-7311-12102. MEMPHIS I107) Johnson1-5 3-45, Randolph 12-150-1 25, Gasol 8-164-720,Conley10-183-426,Lee7-111-1 18,TAIlen 3-70-06,Koufos0-1 2-22, Calathes 1-10-02, Miler 0 2000,Davis1-21-23. Tulals48 7814 21107. Miami 32 26 22 22 — 102 Memphis 31 23 26 27 — 107

BROOK LYN(111) Johnson11-19 7-831, Teletovic5-172-4 17, Garnett 2-2 1-1 5,Wiliams3-14 4-6 11,Anderson 3-4 2-4 9,Plumlee7-82-316, Thornton3-86-613, Gutierrez 2-4 0-04, Kirilenko 2-31-2 5, Collins 0-0 0-00.Totals38-79 25-34111. ORLANDO (116) Harkl ess2-73-48,O'Quinn6-91-213,Dedmon 2-3 0-1 4, Nelson 4-9 4-414, Afflalo 9-16 5-8 25, Harris 6-103-516,Nicholson4-71-29, Oladipo4-8 1-49, Moore660017,Lamb02000.Totals487718-30 110. Brooklyn 22 21 36 33 — 111 Orlando 20 35 28 32 — 115

Pacers104, Bucks102 INDIANA (104) Butler 3-142-410,Scola11-172-224, Mahinmi 1-1 1-23,Sloan4-110-28, Turner9-182-323, SHil 0-22-22,Allen3-92-48,Watson3-50-08,Copeland7-80-018.Totals41-8511-10104. MILWAUKE E(102) Middleton6-143-316, Adrien6-141-213, Pachulia 6-103-415, Knight8-21 8-1225, Sessions 6-15 6-720,Henson3-51-1 7,Antetokounmpo1-4 0-02, Wright2-40-04.Totals38-8722-29102. Indiana 25 28 19 32 — 104 Milwaukee 25 25 17 36 — 102

Suns 94, pelicans88 PHOENIX (04) Tucker6-93-415, Frye2-80-04, Plumlee1-20-0 2, Bledsoe7-131-216, Dragic 8-14 2-2 20,Mark. Morris 5-120-010,Green8-141-221, Randolph0-0 0-00, Marc.Morris2-80-06, I.Smith0-00-00. Tetals 39-807-10 94. NEWORLEANS(BB) Miller 5-93-314,Aminu2-80-05, Stiemsm a2-6 0-0 4, Roberts1-80-0 2,Evans4-111-210, Rivers 4122 410, Morrow 5 83 314,Withey7-103 317, Babbitt 4-82-212.Totals34-8014-1788. Phoenix 23 24 24 23 — 94 Newerleans 14 3 2 18 24 — 88

Biills102, Timbenttfolves 87 CHICAGO (1 02) Dunleayy4-75515,Boozer3-130 06, Noah7-13 1-2 15, Hinrich7-90-0 16, Butler 5-111-2 14, Augustin 8-141-121,Gibson6-141-213, Mohammed 1-1 0-0 2,Snell0-00-00.Totals 41-82 9-12102. MINNESOT A(07) Hummel3-61-1 7, Love7-201-1 17,Dieng3-8 3-3 9, Rubio5-144-415, C.Brewer4-91-2 9, Mbah aMoute1-10-02, Cunningham3-70-06, Turiaf5-7 1-1 11,Jeffers0-1 2-2 2, Shved3-7 2-2 9. Totals 34-0015-10 87. Chicago 26 22 27 27 — 102 Minnesota 25 20 17 17 — 87

Hawks105, Celtics97 BOSTON (97)

Green 5-151-213, Bass3-70-06, Sullinger6-15 2-215, Rondo 8-151-319, Bradley8-164-424, Bayless 2-50-05,Olynyk2-50-05,Johnson3-63-310, Pressey 0-00-0 0, Anthony0-00-00. Totals37-84 11-1497. ATLANTA I105) Carroll 6-131-213,Milsap5-114-714,Brand6-12

Raptors125, 76ers114 PHIULDEL PHIA(114) Thompson 3-6HB, Young7-172-216, Sims10-15 2 222,CarterWiliams7125 519,Anderson6140 0 17, Wroten 4-73-311, Varnado2-32-46, Wiliams4-9 2-211,Davies1-22-34. Totals44-8518 21114. TORONTO (125) Ross3-7 2-211, Patterson7-110-217, Valanciunas10146 826,Lowry9199 929,DeRozan414 9-1017, Salmons 3-4 0-07, Hansbrough2-4 3-47, Novak 0 0 1 00, Vasquez2 32 28, DeColo1-5 0 0 3, Hayes 0-00-00. Totals 41-8231-37126. Philadelphia 20 3 2 29 25 — 114 Toronto 84 34 30 27 — 125

Bobcats94, Wizards88(OT)

HOUSTON (116)

Parsons5-13 4-416, Jones5-8 0-1 11,Asik5-8 2-212, Harden1-98-810, Lin6-112-218, Garcia

DENVER (128) Miller 4-150-0 9,Faried11-171-2 23,Mozgov 9-13 4-422, Foye10-174-430, Brooks5-15 2-213, Fournier5-91-214, Vesely3-50-06, Randolph 1-3 0-02, Arthur2-70-04. Totals 50-10112-14123. Houston 18 40 80 20 — 116 Denver 30 38 87 10 — 128

SUPERIO RSELKTIONOFNEW8 USEO

VOLVO SEDANSAHDSC IV'S

Thunder107, Clippers101 OKLAHOM ACITYI107) Durant8-2610-1127, Ihaka5-124-415, Perkins 3-3 0-06,Westbrook12-246-830, Sefolosha1-30-0 3, N,Cogison1-10-0 2, Adam s 2-2 3-5 7, Jackson 3-81-2 9,Butler2-50-04, Fisher1-62-24. Totals 38-90 26-32107. L.A. CLIPPERS (101) Barnes3-9 0-0 7, Griffin 11-23 8-1130, Jordan 4-62-810, Paul8-176-925, Redick1-71-1 4,Bullock 0-0 0-0 0,D.Collison 4-113-3 12, Dudley0-2 0-0 0, Davis2-4 0-0 4, Turkoglu3-7 1-2 9. Totals 36-86 21-34101. Oklahoma City 2 9 30 26 22 — 107 LA. Clippers 22 3 2 19 28 — 101

•] r

• v

I /

•

SMOLlt:HVOLVO.cow

'.R Join theDESCHUTESRIVERCONSERVANCYfor afestive eveningol great

///r f jj/I '

food, spirin anrl fishing lore. Bid onexclusive rly fishing parkares and trips throughout the world, unique experiences, and other wonderful items. - >, y',"",'>' V% „ Comeearly to castthe newest rodsfromWinston andEcho.

' • ' „

• • •

e'r*

Cavaliers122, Pistons100

Nilggets123, Rockets116

ALL,NEW STATEOF — THE ART DEALERSHIP!

1-2 0-0 2,Motiejunas4-93-411, Casspi1-40-02, Canaan 2-101-26, Hamilton4-91-211, Daniels4-6 0-012, Covington2-30-05.Totals40-92 21-25 116.

CHARLO TTEI94) Kidd-Gilchrist 2-30-04, McRoherts 5-12 0-012, Jefferson9-202-220,Walker 6-212-217, Henderson 4-9 2-213,Zeger1-52-44, Neal5-145-516, Douglas-Roberts2-5 0-0 6, Ridnour0-20-0 0, Biyombo 1-1 0-02.Totals85-9218-1594. WASHING TON(88) Artza 0-60-2 0, Booker4-58-816, Gortat13-18 1-1 27,Wall6-182-314, Beal4-150-08, Webster 2-5 2-2 7,Nene5-90-410, Miler 2-40-04, Gooden1-2 002,Temple00000.Totals87 82182088. Charlotte 82 22 17 16 7 — 94 Washington 1 8 2 3 20 21 1 — BS

DETROIT (100) Singler3-60 08,Monroe7-181-1 15, Drummond 5-101-711,Jennings5-176-817, Stuckey4-147-7 15, Jerebko 5-11 3-3 17,Caldwell-Pope1-7 0-0 2, Siva 2-80-05,Datome2-34-49, Mitchell0-21-21. Totals 34-9623-32100. CLEVEL AND(122) Deng6-121-1 13,Thompson5-60-1 10, Hawes 6-8 0-0 15, Irving3-62-2 8, Waiters9-18 0-1 22, Jack 3-61-2 7,Varejao5-81-211, Zeller9-11 0-0 18, Dellavedova 5-80-014, Gee2-50-04, Karasev 0-1 0-00,Hopson0-40-00.Totals63-935-0122. Detroit 18 19 33 30 — 100 Cleveland 31 38 29 24 — 122

Th e Bulletm

7' •

85OaseSSIv 01NNE R0DRINKS

(..)g

SD500 PE I TABH INNE R0 BRtNttSFOREtBNT

It Dues BoedThings.

nunEFITTING

DESCfeIITEB RIVER CONSERVANCY

0 I II I

~ "+ 4 ~~~

'I ~lHc

' 0' c - ---'fgf"-

srnrrrNRR

C5 THE BULLETIN • THURSDAY, APRIL 10, 2014

N ASDAQ ~ 7 9 9

16,437.18

4,183.90

O» To look upindividual stocks, goto bendbugetin.com/business. Also seearecap in Sunday's Businesssection.

S&P 500

TOdap

10 YRTNOTE ~ 2.69% ~

1,872.18

16,640"

58$P 500

Thursday, April 10, 2014

Ally'8 IPO

1,660

Investors could get a chance to buy shares in Ally Financial as early as today. That's when the global auto finance company and former unit of General Motors is expected to make its market debut. Ally's shares have priced between $25 and $28each. Uncle Sam willbe among the sellers. The U.S. government owns stock in Ally, which received a $17.2 billion bailout during the financial crisis.

... Close: 1,872.18 Change: 20.22 (1.1%)

16,800" 16,400"

16,000"

1,750

15,600

1,700

15,200

1 650

StocksRecap NYSE NASD

Vol. (in mil.) 3,250 1,909 Pvs. Volume 3,633 2,143 Advanced 2256 1934 Declined 8 28 6 5 7 New Highs 87 39 New Lows 10 25

$19.76

14 800

Alcoa D

HIGH LOW CLOSE CHG. 16438.82 16256.37 16437.18 +181.04 DOW Trans. 7591.22 7468.87 7590.78 +122.35 DOW Util. 539.22 531.89 537.35 -1.06 NYSE Comp. 10555.42 10455.06 10554.93 +102.91 NASDAQ 4185.19 4121.17 4183.90 +70.91 S&P 500 1872.43 1852.38 1872.18 +20.22 S&P 400 1365.28 1351.18 1365.11 +1 3.30 Wilshire 5000 19964.47 19733.34 19962.05 +228.71 Russell 2000 1160.42 1144.77 1159.96 +1 5.72

DOW

+.0059

1.3853

StoryStocks

+1.04 '

The stock market turned in its best day in a month Wednesday after investors found reassuring words in the minutes from the latest Federal Reserve meeting. The minutes showed some Fed officials were concerned about hiking interest rates sooner than expected. Shares of Alcoa surged after its earnings beat analysts' estimates. Technology companies like Facebook and biotech stocks rallied to helpthe Nasdaq composite index posta second day ofgains on the heels of a three-day sell-off. Eight of 10 sectors in the Standard & Poor's 500 index rose. Health care stocks led with a rise of more than 2 percent. Utilities and telecom companies lost ground.

Dow jonesIndustnals

%CHG. WK MO QTR YTD $.1.11% L -0.84% $.1.64% L L +2.57% -0.20% L L L +9.54% +0.98% L L +1.49% +1.72% L +0.17% +1.09% L L +1.29% +0.98% L +1.68% $.1.16% L +1.30% $.1.37% -0.32% L

NorthwestStocks

Close:$13.00%0.47 or 3.8% Industry analysts upped their price targets for the aluminum maker after it weathered a rough patch in the recent quarter. $14 12

Harman Int'I

HAR

Close:$107.26af.81 or 1.7% After a sharp sell-off of its shares, Raymond James upgraded the lighting and audio company to "Strong Buy" from "Outperform." $120 100

F M A 52-week range $7.63~ $13 .18

F M 52-week range

$49.79~

$ 112 37

Vol.:49.9m (1.7x avg.) PE: . . . Vol.:883.6k (1.0x avg.) PE: 47.3 Mkt. Cap:$14.01b Yie l d: 0.9% Mkt. Cap:$7.27 b Yie l d : 1.1%

C onstellation Brands

52-WK RANGE e CLOSE Y TD 1YR V O L TICKER LO Hl C LOSE CHG%CHG WK MO QTR %CHG %RTN (Thous)P/E DIV

NAME

$1 03.60

Close: 16,437.18 Change: 181.04 (1.1%)

16,160" ""' 10 DAYS "

1,850 "

1,800 "

16,400 "

1,800' " ""'10 DAYS

1,900 "

+ -.28

GOLD ~ $1,385.50 ~

S T Z General Motors

Close:$80.64 V-0.84 or -1.0% The wine, beer and liquor company posted big fourth-quarter profits, fueled by its recent acquisition of Corona beer. $90

GM Close:$33.62T-0.91 or -2.6% Automakers came under pressure after another recall, this from Toyota, and a downgrade from Morgan Stanley for the Detroit automaker. $45

Alaska Air Group A LK 50.31 ~ 95.98 95. 0 4 + 4.23+4.7 L L L + 29. 5 +5 1 .9 1 259 13 1 .00f T +8.1 +17. 8 72 4 16 1. 2 7f Avista Corp A VA 25.55 ~ 31.29 3 0. 4 7 -.39 -1.3 T L Bank of America B AC 11. 23 ~ 18.03 16. 6 2 +. 1 8 +1.1 T T T +6.7 +34 . 9 75662 16 0 .20f Barrett Business BB S I 4 8 .08 ~ 102. 2 0 62. 20 + . 5 3 +0.9 L T L - 32.9 +19.1 79 26 0. 7 2 85 40 Boeing Co BA 8 5 .38 ~ 144. 5 7 12 6.88 +2.73 +2.2 T L L -7.0 +45.6 3599 21 2.92f Spotlight on Rite Aid T 80 35 Cascade Bancorp C A C B4 .31 ~ 6.95 5.10 -.13 -2.5 T T -2.5 -21.4 30 5 Wall Street predicts that Rite Aid T T +1.7 +34 . 5 15 6 2 3 0 . 48f ColumbiaBnkg COL B 19.85 ~ 3 0.3 6 27.97 -.04 -0.1 T made a profit for the fiscal fourth J F M A J F M A Columbia Sportswear COLM 55.58 ~ 88. 25 81.81 -.50 -0.6 T T T +3.9 +41 . 1 84 30 1.1 2 f 52-week range 52-week range quarter. CostcoWholesale CO ST 103.20 ~ 1 26 .12113.65 +.39 $.0.3L T L -5.0 + 6 . 4 2 846 2 5 1 . 24 $46.83~ $86 .91 $27.68 ~ $41.85 It would be the drugstore Craft Brew Alliance B R EW 7.13 ~ 18.70 14. 4 1 +. 0 7 +0.5 T T T -12.2 + 90.2 1 0 7 c c Vol.:6.8m ( 4.5x avg.) P E:8. 5 Vol.:32.9m (1.2x avg.) PE : 1 5.0 chain's sixth consecutive quarter FLIR Systems F LIR 23.00 ~ 37.35 35. 5 1 +. 6 1 +1.7 T L T + 18. 0 +3 7 .6 97 9 2 3 0 . 40f Mkt. Cap:$13.44 b Yield: ... Mkt.Cap:$53.45 b Yield: 0.9% in the black. Financial analysts Hewlett Packard HPQ 19 . 07 — 0 33.66 32 .72 + . 2 7 +0.8 L L L + 16.9 +50 .6 12390 12 0 .64f expect Rite Aid will report today HomeFederal Bncp ID HOME 11.54 ~ 1 6.03 1 5. 6 1 -.12 -0.8 T T T +0.7 +27 . 6 43 dd 0.2 4 ETFC Intuitive Surgical ISRG E-Trade Financial that earnings declined from a year Intel Corp INTC 20.80 — 0 27.12 26 .98 + . 07 +0.3 L L L +3.9 +31. 9 33953 14 0 . 9 0 Close: $456.64T-33.20 or -6.8% Close: $21.18 L1.20 or 6.0% ago. The company lowered its Keycorp K EY 9 .29 ~ 14.70 14. 0 1 +. 0 7 +0.5 T L T +4.4 +44 . 3 8 5 72 1 4 0 . 2 2 The medical company warned that After a bruising week due to quesKroger Co KR 3 1 .52 — 0 45.47 44 .72 + . 4 1 + 0.9 L L L +13.1 +41 .0 3 9 53 1 5 0. 6 6 quarterly revenue would be weak, 2014 earnings forecast in tions about possible new market regLattice Semi LSCC 4.17 — o 8.52 8 . 1 5 + . 2 8 +3.6 L L L +48. 5 +4 7 .1 1 286 c c December, citing drug cost citing less revenue from its da Vinci ulations, Bank of America upgraded LA Pacific L PX 14.51 ~ 20.80 16 .5 9 +. 1 3 +0 .8 T T T -10.4 -20.0 2396 14 robotics division. the online trading plafform. increases and lower profits from — o MDU Resources MDU 23 .40 35.60 34 .98 + . 32 +0.9 T L L +14. 5 +4 4 .7 52 5 2 4 0. 7 1 $600 $30 new generic drugs. MentorG raphics M EN T 1 7.06 ~ 24.31 21. 4 0 +. 3 6 +1.7 T T T -11.1 +21.6 3 2 4 1 7 0 . 20f 500 25 Microsoft Corp MSFT 2 8.47 — o 41.66 40 .47 + . 6 5 +1 .6 L L T +8.2 +42. 8 26576 15 1 . 1 2 RAD $6.4 400 20 $7 Nike Inc 8 N KE 58.82 ~ 80.26 73.5 6 +. 6 4 +0 .9 L T T -6.5 +2 3.1 3478 25 0 . 9 6 $1.80 NordstromInc J WN 54.41 ~ 64.19 62. 8 3 +. 2 7 +0.4 T L L +1.7 +15 . 4 98 4 1 7 1 . 32f J F M A J F M A L L +3.6 +3.5 Nwst Nat Gas NWN 39.96 ~ 45.89 4 4. 3 5 -.06 -0.1 L 89 21 1 . 84 52-week range 52-week range PaccarInc PCAR 47.12 — o 68.81 66 .69 +1.12 +1.7 L L T +12. 7 +3 9 .5 2 033 20 0 .80a $387.74~ $64 1.23 $9.62~ $ 26.68 '14 Planar Systms P LNR 1.55 ~ 2.93 2.64 +.0 4 + 2 .0 L T -19.7 ... 17 dd Vol.: 2.6m (4.1x avg.) PE: 27.3 Vol.:10.2m (2.2x avg.) P E : 73.0 Plum Creek PCL 40.73 o — 54.6 2 41 . 6 8 -.06 -0.1 T T T -10.4 - 16.2 665 3 1 1 . 76 Mkt. Cap:$17.51b Yield:... Mkt. Cap: $6.11 b Yield: ... est. Prec Castparts PCP 181.84 ~ 274. 9 6 25 3.83 +6.85 +2.8 T L - 5.7 +35.1 6 7 3 2 2 0 . 1 2 Operating $0.04 I Safeway Inc SWY 22.26 ~ 40.25 38. 0 0 +. 0 3 +0.1 L T L +16. 7 +5 3 .7 4 064 3 0. 8 0b FuelCell Energy FCEL Zogenix ZGNX EPS Schnitzer Steel SCH N 23.07 ~ 3 3.3 2 28.47 -.17 -0.6 T L T - 12.9 +13.5 2 5 6 d d 0 . 75 4Q '12 4 Q ' 13 Close:$2.48%0.10 or 4.2% Close:$2.81 %0.22 or 8.5% Sherwin Wms SHW 163.63 ~ 208. 6 3 19 4.64 +2.74 +1.4 L T T $-6.1 +1 7 .0 61 9 2 7 2 . 20f The reports of new government con- A second day of gains for the drug Price-earnings ratio: 22 StancorpFncl S FG 40.32 ~ 69.51 64. 0 6 +. 4 8 +0.8 T T T -3.3 +58.0 1 1 2 1 2 1 . 10f tracts for the cell power company company, which won regulatory apbased on trailing 12 month results StarbucksCp S BUX 57.18 ~ 82.50 72.4 8 + 1.00 +1.4 L T T -7.5 +24.6 4445 3 0 1 . 04 continued to arise, the latest worth a proval to sell a painkiller made from reported $3 million. pure hydrocodone. Triquint Semi TQNT 4.72 — O 13.96 13 .69 + . 1 8 + 1 .3 L L L +64.1 + 1 73.6 2987 d d Dividend: none $4 $5 Umpqua Holdings UM P Q 11.45 ~ 1 9.65 1 8. 3 5 -.05 -0.3 T T T -4.1 +50.1 8 1 6 2 0 0.60a source: Factset US Bancorp U SB 31.99 ~ 43.66 42.0 1 +. 2 2 +0 .5 T T T + 4.0 +26. 8 7 4 33 1 4 0. 9 2 4 3 WashingtonFedl WA F D 15.79 ~ 2 4.5 3 22.57 +.08+ 0.4 T T T - 3.1 +35.2 3 4 4 1 5 0 . 40 2 Wells Fargo & Co WF C 3 6 .19 — o 50.49 49 .10 + . 2 7 +0.6 T L T +8.1 +35. 1 15492 13 1 . 2 0 Improved sales trends? Weyerhaeuser W Y 2 6.38 ~ 33.24 28. 6 7 +. 1 2 +0.4 T T T -9.2 -6.6 5319 25 0 . 88 J F M A J F M A 52-week range 52-week range Family Dollar Stores' fiscal year is $6.84~ $4 .74 $1.26~ $ 6.19 off to a bumpy start. DividendFootnotes:a - Extra dividends werepaid, but arenot included. b -Annual rate plus stock. 8 -Liquidating dividend. 8 -Amount declaredor paid in last12 months. f - Current Vol.:13.7m (0.6x avg.) P E: . . Vol.:2.7m (0.8x avg.) P E: .. . The discount retailer cut its annual rate, whichwasincreased bymost recentdividendannouncement. i —Sum of dividends paidafter stock split, no regular rate. I —Sumof dividends paidthis year.Most recent Mkt. Cap: $629.73 m Yie ld: ..Mkt. Cap:$392.1 m Yield: ... earnings forecast for the year in dividend wasomitted or deferred. k - Declared or paidthis year, acumulative issue with dividends in arrears. m — Current annualrate, which wasdecreasedbymost recentdividend announcement. p — Initial dividend, annual rate not known, yield not shown. r —Declared or paid in preceding 12months plus stock dividend. t - Paid in stock, approximate cash January after consumers made SOURCE: Sungard AP value on ex-diseieution date.PEFootnotes: q —Stock is a closed-end fund - no P/E ratio shown. cc — P/Eexceeds 99. dd - Loss in last12 months.

fewer purchases and spent less on average per transaction in the first quarter. Financial analysts anticipate Family Dollar Stores will

Company

report today that its secondquarter earnings and revenue declined from a year ago.

$80 70

$59.07

FDO

$59.39

SPO otlight Ig

•g•

S S C

'14

Operating

Shares of Intuitive Surgical are down more than 15 percent since hitting a 52-week high last Thursday. On Wednesday the stock dropped after the company warned of slow first-quarter sales for its robotic surgery system. Sales of its cornerstone da Vinci system fell by almost half, led by steep U.S declines. Lower procedure volumes and changes in hospital spending decisions made as a result of the Affordable Care Act were cited by the Sunnyvale, Calif., company as the reasons. Revenue from system sales dropped 59 percent compared to a year ago, and the company said its total revenue will decline 24 percent to about $465 million. The top line also took a $26 million hit because of a trade-in program. Intuitive Surgical is scheduled to report its first-quarter results on April 22.

I 'I

EPS 2Q '13

Price-earnings ratio:

2 Q ' 14

IntuitiVe SurgiCal (ISRG) Wednesday's close:$456.64

Price-earnings ratio:27

based on trailing 12 month results

$351

Dividend: $1.24 Div. yield: 2.1%

Source: Factaet

541

Total return • ISRG

Y TD

* fO - Y R * 3-YR

1 8.9% 7 . 5

39. 3

(Based on trailing 12 month results) *Annuagzed

T o t al returns through April 9

AmdFocus

Source: FactSet

SelectedMutualFunds

InterestRates

HIS

The yield on the 10-year Treasury rose to 2.69 percent Wednesday. Yields affect rates on mortgages and other consumer loans.

NET 1YR TREASURIES YEST PVS CHG WK MO QTR AGO 3-month T-bill 6-month T-bill 52-wk T-bill

. 0 3 .02 . 0 5 .05 .09 .10

+ 0 .01 L ...

T T

.06 .09

-0.01 T

.12

L T

T .23 T .70 T 1.75

T 2.94

2-year T-note . 3 7 .4 0 -0.03 T 5-year T-note 1.63 1.67 -0.04 T 10-year T-note 2.69 2.68 +0.01 T 30-year T-bond 3.57 3.54 +0.03 T

BONDS

NET 1YR YEST PVS CHG WK MOQTR AGO

Barclays LongT-Bdldx 3.37 3.35 +0.02 T T T Bond Buyer Muni Idx 4.68 4.69 -0.01 T T T Barclays USAggregate 2.35 2.36 -0.01 T T T PRIME FED Barclays US High Yield 5.21 5.21 .. . T T T RATE FUNDS Moodys AAACorp Idx 4.25 4.25 .. . T T T YEST3.25 .13 Barclays CompT-Bdldx 1.86 1.88 -0.02 T L T 6 MO AGO3.25 .13 B arclays US Corp 3.05 3.06 -0.01 T T T 1 YRAGO3.25 .13

2.66 4.07 1.79 5.63 3.7 2 .99 2.6 7

PERCENT RETURN Yr RANK FUND N AV CHG YTD 1YR 3YR BYR 1 3 5 AmericanFunds BalA m 24.6 7 + .20 +1.5 +15.4 +11.9+15.5 A A A CaplncBuA m 59.25 +.42 +2.8 +11.3 +9.1+13.5 C A 8 CpWldGrlA m 46.15 +.51 +2.2 +19.8 +10.0+16.1 C 8 D EurPacGrA m 49.56 +.63 +1.0 +18.6 +5.8+14.1 8 C C FnlnvA m 51. 5 6 +.64+0.4 +21.8 +12.2+18.2 C D C Facebook 981382 62.41 +4.22 GrthAmA m 43.32 +.62 +0.7 +24.8 +13.5+17.9 8 8 D S&P500ETF 919823 187.09 +1.99 BlackRock CapApplnA m M D FGX IncAmerA m 21.10 +.16 +3.0 +13.9 +10.8+16.1 8 A A BkofAm 756624 16.62 +.18 InvCoAmA m 37.50 +.35 +2.6 +23.9 +13.7+17.5 8 C D iShEMkts 701147 42.28 +.32 VALUE B L EN D GR OWTH NewPerspA m37.68 +.52 +0.3 +20.5 +10.4+17.4 8 8 8 Alcoa 479613 13.00 +.47 WAMutlnvA m39.98 +.44 +1.9 +22.0 +14.8+18.8 8 A 8 iShJapan 458839 11.16 +.16 PwShs QQQ 427785 87.82 +1.48 Dodge &Cox Income 13.74 -.61 +2.7 +2 .3 + 4.9 +7.6 A 8 8 iShR2K 401143 115.25 +1.64 IntlStk 44.86 +.44 +4.2 +27.3 +8.5+18.1 A A A Pfizer 378615 31.23 +.36 Stock 171.40+2.61 +2.2 +28.8 +16.5+21.9 A A A Fidelity Contra 95.69 + 1.46 -0.1 +23.5 +14.0+19.2 C 8 8 Gainers ContraK 95.6 4 + 1.46-0.1 +23.7 +14.1 +19.3 C 8 8 NAME LAST CHG %CHG LowPriStk d 50.44 +.36 +2.0 +24.4 +14.8+22.0 C A 8 Fideli S artan 500 l dxAdvtg 66.41 +.73 +1.9 +21.9 +14.5+19.4 C 8 8 ConstantC 28.22 +6.30 + 28.7 Hlthlnslnn 12.00 +2.07 + 20.8 «C FrankTemp-Frankli n IncomeC m 2.53+.61 +4.8 +12.9 +9.2+16.3 A A A GrayTvA 9.45 +1.33 + 1 6.4 63 IncomeA m 2. 5 0+.61 +5.0 +13.1 +9.7+16.8 A A A Dipexium n 10.40 +1.46 + 1 6.3 Oakmark Intl I 26.84 +.26 +2.0 +24.9 +11.8+21.2 A A A UBIC n 9.50 +1.28 + 15.6 473 -1.0 +15.5 +11.1+16.1 Oppenheimer RisDivA m 19 . 50 Pixelwrks 6.01 +.79 + 1 5.1 -1.2 +14.5 +10.1+15.0 RisDivB m 17 . 44 Morningstar OwnershipZone™ GrayTelev 11.36 +1.44 + 1 4.5 RisDivC m 17 . 33 -1.2 +14.6 +10.3+15.2 PernixTh h 5.45 +.68 + 1 4.3 OsFund target represents weighted SmMidValA m45.14 +2.0 +25.7 +10.0+19.3 Prothena 33.90 +3.99 + 13.3 average of stock holdings SmMidValB m38.62 +1.8 +24.6 +9.1+18.4 Tetralogc n 7.69 +.89 + 1 3.1 • Represents 75% of fund's stock holdings T Rowe Price Eqtylnc 33.23 +.22 +1.8 +18.9 +13.1+19.0 D C 8 Losers CATEGORY Large Gro wth GrowStk 51.75+1.65 -1.6 +28.3 +15.4+20.6 A A A NAME L AST C H G %C H G MORNINGSTAR HealthSci 60.49+1.79 +4.7 +37.5 +26.8+29.6 8 A A RATING™ ** 1 y1y1y -.96 -20.4 Vanguard 500Adml 172.73+1.87 +1.9 +21.8 +14.6+19.4 C 8 8 Delcath rs 3.73 ProUShBio 17.80 -1.52 -7.9 ASSETS $1,789 million 500lnv 172.73+1.88 +1.8 +21.7 +14.4+19.3 C 8 8 -2.09 -7.5 Haverty 25.89 500Sgnl 142.68+1.55 +1.9 +21.8 +14.5+19.4 C 8 8 EXP RATIO 1.09% GMwtC 2.63 -.21 -7.2 CapOp 48.34 +.77 +4.7 +29.5 +16.7+20.1 A A B MANAGER Lawrence Kemp -.96 -6.9 WbstFn wt 12.95 Eqlnc 30.31 +.25 +2.6 +19.5 +15.9+20.1 D A A SINCE 201 3-01-01 IntlStkldxAdm 28.41 +.32 +2.2 +14.6 +4.0 NA D D -3.3 RETURNS 3-MO Foreign Markets StratgcEq 31.21 +.31 +4.0 +31.7 +17.0+24.4 A A A YTO -3.0 TgtRe2020 27.69 +.20 +2.1 +12.3 +8.7+13.8 A A B NAME LAST CHG %CHG 1-YR +22.9 Tgtet2025 16.68 +.13 +2.1 +13.8 +9.2+14.8 8 8 C Paris 4,442.68 + 17.85 + A O 3-YR ANNL +9.2 TotBdAdml 10.72 .. . + 2 .3 -0.5 +3.9 +4.8 D C E London 6,635.61 +44.92 + . 68 5-YR-ANNL +16.1 Totlntl 16.99 +.20 +2.2 +14.6 +4.0+13.8 D D C Frankfurt 9,506.35 +15.56 + . 16 TotStlAdm 47.37 +.55 +1.9 +22.9 +14.5+20.2 8 8 A Hong Kong22,843.17 +246.20 +1.09 TOP 5HOLDINGS PCT TotStldx 47.35 +.54 +1.9 +22.7 +14.4+20.0 8 8 A Mexico 40,937.77 +30.94 + . 08 Google Inc Class A 5 Milan 21,71 7.02 +49.97 + . 23 USGro 28.75 +.53 +0.2 +25.0 +14.7+18.7 8 8 C Visa, Inc. Class A 3.83 -307.19 -2.10 Tokyo 14,299.69 Welltn 38.74 +.27 +2.8 +14.3 +11.1+15.1 8 A A 3.52 Stockholm 1,366.53 + 5.00 + . 37 Comcast Corp Class A Fund Footnotes: t$Fee - covering marketcosts is paid from fund assets. d - Deferredsales charge, or redemption 3.23 fee. f - front load (salescharges). m - Multiple feesarecharged, usually amarketing feeandeither a sales or Sydney 5,460.30 +51.10 + . 94 Amazon.com Inc Zurich 8,411.43 -11.93 -.14 Yahoo!Inc 3.03 redemption fee.Source: Morningstar.

BlackRock Capital Appreciation carries a bronze-medal analyst Marhetsummary rating for expected future perforMost Active mance, but its 10-year record NAME VOL (60s) LAST CHG ranks in the bottom half of the SiriusXM 1385995 3.14 +.08 category.

FAMILY

Commodities Oil rose more than $1 per barrel to settle above $103 for the first time since March 4. Natural gas rose for the fifth time in six days, and gold fell for the eighth time in 11 days.

Foreign Exchange The dollar dipped against the euro and edged higher against the Japanese yen. At one point during trading, it fell to its lowest level against the British pound since Feb. 17.

55Q QD

FUELS

CLOSE PVS. Crude Oil (bbl) 103.60 102.56 Ethanol (gal) 2.30 2.27 Heating Oil (gal) 2.95 2.93 Natural Gas (mmbtu) 4.59 4.53 UnleadedGas(gal) 3.01 2.98

%CH. %YTD + 1.01 + 5 . 3 +1.01 +20.4 +0.67 -4.0 + 1.15 + 8 . 4 + 0.95 + 8 . 0

CLOSE PVS. 1305.50 1308.70 19.76 20.04 1437.00 1439.80 3.07 3.08 782.80 776.10

%CH. %YTD - 0.24 + 8 . 6 - 1.43 + 2 . 2 - 0.19 + 4 . 8 -0.34 -10.9 + 0.86 + 9 . 1

METALS

Gold (oz) Silver (oz) Platinum (oz) Copper (Ib) Palladium (oz) AGRICULTURE Cattle (Ib)

CLOSE PVS. %CH. %YTD 1.44 1.43 + 0.30 + 6 . 9 Coffee (Ib) 2.00 1.97 +1.70 +80.5 Corn (bu) 5.02 5.07 -0.94 +1 9.0 Cotton (Ib) 0.90 0.92 - 1.47 + 6 . 9 Lumber (1,000 bd ft) 334.30 328.80 +1.67 -7.2 Orange Juice (Ib) 1.60 1.56 +3.09 +1 7.5 Soybeans (bu) 14.95 14.83 +0.86 +1 3.9 Wheat(bu) 6.69 6.81 -1.76 +1 0.5 1YR.

MAJORS CLOSE CHG. %CHG. AGO USD per British Pound 1.6793 +.0046 +.27% 1.5335 Canadian Dollar 1.0 8 61 -.0066 -.61% 1.0150 USD per Euro 1.3853 +.0059 +.43% 1.3099 JapaneseYen 101.76 + . 1 2 + .12% 9 9 . 28 Mexican Peso 12. 9963 -.0440 -.34% 12.1230 EUROPE/AFRICA/MIDDLEEAST Israeli Shekel 3.4759 -.0032 -.09% 3.6274 Norwegian Krone 5 . 9342 -.0386 -.65% 5.7078 South African Rand 10.3936 -.0664 -.64% 8.9181 Swedish Krona 6.4 8 33 -.0106 -.16% 6.3842 Swiss Franc .8794 -.0039 -.44% . 9316 ASIA/PACIFIC Australian Dollar 1.0647 -.0042 -.39% . 9521 Chinese Yuan 6.2008 +.0038 +.06% 6.2070 Hong Kong Dollar 7.7534 -.0005 -.01% 7.7639 Indian Rupee 59.920 -.175 -.29% 54.481 Singapore Dollar 1.2456 -.0058 -.47% 1.2387 South KoreanWon 1035.71 -12.19 -1.18% 1139.50 -.14 -.47% 3 0.05 Taiwan Dollar 29.99

THE BULLETIN • THURSDAY, APRIL 10, 2014

BRIEFING Rent help for 200 households Housing Works, the regional housing authority, recently provided 200 randomly selected low-income Central Oregon households with vouchers to help pay their rent, according to a news release issued Wednesday. "We are excited to provide this opportunity to those in our community who needthesupport," Kenny LaPoint, housing and resident services director, said in the release. The Housing Choice Voucher andNon-Elderly Disabled programs assist1,200 households in Central Oregon, according to Housing Works. Far moreapply to the program than Housing Works can assist. The agency received 2,599 applications for its waiting lists in January and February, according to the release. The voucher programs are funded by the U.S. Department of Housing and UrbanDevelopment. Thevouchers pay a portion of the tenants' rent based on gross household income. — Bulletin staff report

ec wQr By Chris O'Brien and Salvador Rodriguez Los Angeles Times

SAN FRANCISCO-

The discoveryof a significant flaw in software that

was supposed to provide extraprotection for thousands of websites has thrown the tech world into chaos

as experts scrambled to understand the scope of the vulnerability. Consumers started to receive a trickle of notices from services they use on-

Photos by Ryan Brennecke/The Bulletin

Bend residents Barbara Scott and Tom Elliott are building Desert Rain, which they believe will be the greenest home in the city. They recently received approval to treat wastewater on site.

• OIC is milestone in couple's quest to build greenest home in Bend

ti/~;;:p

»,.' , I IIi) Ri I~iI

Editor's note:TomElliott and Barbara Scott invited

BIZ CALENDAR TODAY • Private Pesticide Applicator LicenseTest: Learn label comprehension, state and federal laws, safety; review andthen take the Private Pesticide Applicator test; registration required; 8 a.m.-5 p.m.; COCC Crook County Open Campus,510S.E Lynn Blvd., Prineville; 541-447-9971. • Online Marketingwith Facebook:Learn to use Facebookto market and advertise your business; registration required; $69; 9 a.m.-noon; Central Oregon Community College, 2600 N.W.College Way, Bend;541-383-7270. • 25th AnnualCentral Oregon RVDealer Spring Show and Sale: Free;open to the public; 9 a.m.-6 p.m.; Deschutes County Fairand Expo Center, 3800S.W. Airport Way,Redmond; 541-548-2711.Continues through Sunday. FRIDAY • Grant Writingfor nonprofits:Learn to select grant opportunities, to write successful applications, get tips on research, effective writing, board involvement, grant managementand reporting; registration required; $89; 9a.m.-noon; COCC Chandler Building, 1027 N.W.Trenton Ave., Bend; 541-383-7270. TUESDAY • Membership101Driving YourMembership: Connecting newchamber members with current ones; reservations required; free; 10a.m.; Bend Chamberof Commerce, 777NW Wall St., Suite 200; 541382-3221 or shelley© bendchamber.org. WEDNESDAY • BeginningPhotoshop Plus:Course provides additional time to gaina solid understanding of the basic tools andconcepts of Photoshop; registration required; $95; 9a.m.-noon; Central OregonCommunity College, 2600 N.W.College Way, Bend;541-383-7270. • CommunityHealth Workercourse: Learnto beaCommunity Health Worker, anoutreach person who coordinates access and care to help bridge the gaps and eliminate barriers between health care, social services, and theneeds of at-risk community members; registration required; $595; 9a.m.noon; Central Oregon Community College, 2600 N.W.CollegeWay,Bend; 541-383-7270. • For the complete calendar, pick up Sunday'sBulletin or visitbendbulletin.com/bizcal

users to change not just the

password for its site but for all others as well. Signahng just howmuch uncertainty and confusion surmunds the glitch, securi-

security issues we've seen in the last decade and will remain within the top five

ers couldjust as easilysteal

ecosystem significant time to get everythingupdated, and we will be looking at a longtail situation that could easilyextend intoyears."

Desert Rain, has become the

Rain will be connected to the

stalled to monitor water and

bilityin OpenSSL, a technologyused to provide en-

first in the state within a city sewer district to receive a

sewer, but no wastewater will

power usage," he said. The system, which uses

permit to treat blackwatertoilet and dishwasher waste-

Wastewater from vacuum toilets and the dishwasher

water — on site, without put-

will flow to a commercial

ting it into the sewer lines.

composting unit located in the lower level of Desert

have achieved a milestone.

Heartbleed is a vulneracryption of an estimated 66

percent ofallserversonthe public Internet. OpenSSL is an open-source code devel-

oped andmaintained by a community of developers, rather than by a single company.

Lookout — a two-story build-

alarms on the water storage

amazing." The couple, who moved

ing next to their home that will contain a fitness room

tanks to warn of pending overflow, as well as an alarm

into Desert Rain on North-

and a single-car garage.

that sounds if the water starts

west Shasta Place in December, has struggled to receive approval for about four years. And without it,

Construction on Desert Lookout is expected to start

flowing into the sewer. "The goal of the system

Monday, said James Fagan,

is to help the owners satisfy

co-owner of Timberline Con-

they wouldn't have met the

struction and project manager of Desert Rain. And once

and pass the green building challenge that they are doing," he said. "With the

it's completed, he said, the

level of automation that we

couple can begin a 12-month period of proving the home meets Living Building Challenge standards. To help Scott and Elliott achieve their goal, Fagan said, the home has sensors and gadgets to track water and energy use. Steve Powers, president of

provided, they have flexibility in adjusting the way that the water is moved around the property for better Scott will achieve the Living Building Challenge, which he expects to start in September, after the building is complete

sive set of recalls Wednesday to address a series of problems, including a faulty cable that could prevent air bags from deploying and

Bend-based Powers of Automation Inc., said he's never

and the system is installed.

a defect that could prevent

requirements of the Living Building Challenge — a set of green building standards designed to be the most advanced possible. As part of the challenge, all the water used in the

home must be collected and treated on-site, said Morgan

Brown president of Seattle-based Whole Water Systems andprojectmanager for Desert Rain's water systems. But the city of Bend requires homes to be hooked up to the

installed such a complex sys-

sewer system. So to meet both the Living Building Challenge and city regulations, he said, Desert

tem in a home. "Its definitely unusual that

a residence would have this level of instrumentation in-

conservation." Elliott is confident he and

"We're very confident that the Powers (of Automation) systems will perform the way they're designed," he said. — Reporter: 541-617-7818, rrees®bendbulletin.com

ty experts warned that such

Bluebox Security. Added Jeff Forristal,

over a monitoring system his company installed at Desert Rain, a home on Northwest Shasta Place in Bend. The system will help owners Barbara Scott and Tom Elliott meet the Living Building Challenge, a set of stringent environmental standards.

he said. It includes different

dosedthat it hadbeen hit

agesturemight actuallybe

Lonnie Powers, vice president of Powers ofAutomation, looks

"It's the last big hurdle with the city," Scott said. "It's

tion about Heartbleed. On Tuesday, Tumblr, owned by Yahoo Inc., dis-

for many years to come," said Adam Ely, founder and chief operating officer of

The Bulletin

parts from Bend companies Dent Instruments and Consolidated Electrical Distributors,cost more than $40,000,

weekby Neel Mehta, a securityresearcher atGoogle Inc., and a team of engineers at Codenomicon, a security website thathas since

all the holes created by the

By Rachael Rees

flow into the sewer.

discovered separately last

by Heartbleed and urged

pervasive on all manners of devices, systems and serv-

Their house, known as

by"https" that indicates that the OpenSSL added securityhas been enabled. The vulnerability was

could takeyears to sewup

ers. It is going to take the In their effort to build the greenest home in Bend, Barbara Scott and Tom Elliott

lock icon in the address bar of their browser, followed

experts projected that it

cer: "OpenSSL is extremely

from start to finish.

most people onlineprobably have seen the greenpad-

created a site with informa-

Bluebox chief technical offi-

their attempt to build the ultimate green homein Bend and document the project

Although such jargon is unfamiliarto average users,

line alertingthemto potential issues and recommended steps, such as changing passwords. But given the scope of the issue, security

Heartbleed bug. "This is one of the worst

The Bulletin to follow

BEST OF THE

aws urs scram e II1

ome c eare 0 IBB was ewaeronsi e

useless because ifa sitehas not fixed the problem hackthe newpassword.

"The scope of this is immense," said Kevin Bocek, vice president of security

strategy and threat intelligence for Venafi, a Salt Lake City cybersecurity company."And the consequences are still scary. I've talked about this like a 'Mad Max' moment. It's a bit of

anarchy right now. Because we don't know right now

who has the keys and certificates onthe Internet right now."

It appears the bug was introduced into OpenSSLby a programming mistake that got pushed out as websites around the world updated their version of OpenSSL.

Toyota recalls6.4M vehiclesworldwide By Michael A. Fletcher The Washington Post

Toyota announced a mas-

car seats from remaining in place during an accident. Toyota, the world's largest automaker, said it is not aware of any crashes, injuries or deaths caused bythe problems. The largest recall

break, the seat will not lock in place and could move in a crash, increasingthe riskof injury, the company said. A third recall involves

fixing steering column brackets installed in some European and Asian mod-

els that canbecome unstable whenthe steering wheel is repeatedly turned with

maximum force. The other recalls address problematic wind-

shield-wiper motors and the possibility of fires in starter

motors. Those problems are equipped with a spiral cable confined to models sold in that can be damaged when Asia, Toyota has said. The five recalls cover the steering wheel turns. The frayed cable could 6.39 million vehicles worldcause a warning light to illu- wide. The air bag problem involves 3.5 million vehicles

Bank of America hit with $800M penalty New York TimesNewsService Bank of Americahas been ordered to pay roughly $800

billing practices involving credit card products.

million in refunds to customers

The Consumer Financial Protection Bureau said that Bank of

and fines to federal regulators to settle allegations that thebank useddeceptivemarket ing and

America"illegally charged" its customers for credit monitoring and credit reporting services

that were not received.

As part of a consent order with the agency announced Wednesday, the bank was or-

dered to refund more than I millioncustomers who purchased these add-on products.

minate and could deactivate

affects 1.3 million vehides

airbags. Another recall is aimed

in the United States. They

at repairing seat rails that

contain springs that could break, particularly when

include the 2009-2010 Corolla, 2009-2010 Matrix,

2008-2010 Highlander,

seats are frequently ad-

2009-2010 Tacoma, 20062008 RAV4 and 2006-2010

justed. Whenthe springs

Yaris models.

PERMITS City of Bend • GW Land Acquisitions LLC, 2981 N.E. Dogwood Drive, $239,578 • First Lutheran Church, 2265 N.W. Shevlin Park Road, $660,000 • Thomas E. Elliott, 22 N.W. Shasta Place, No. 3, $110,033 • Long Term Bend Investors LLC, 21383 N.E.NolanCourt, $263,606 • Craig Smith, 1236 N.E. Shane

Lane, $203,446 • Hayden Homes LLC,2757 N.E Aldrich Ave., $149,461 •PacWestIILLC,20693 N.E. Tango Creek, $231,736 • Structure Development N.W., 1850 N.W. Hartford Ave., $203,783 • Julie E. Audia, 20044 Crystal Creek Court, $268,596 Deschutes County • Matt and Zenita Lathrop,

10061 Juniper GlenCircle, Redmond, $268,829 • Mark J. Earl, 70344 Mahonia, Black Butte Ranch, $238,654 • PWD Associates LLC, 60436 Snap Shot Loop, Bend, $398,311 • PWD Associates LLC, 60438 Snap Shot Loop, Bend, $294,392 • Dean V. andKaren A. Oster, 16440 Dea Drive, Bend,

$177,080 • We-Be Construction Inc., 10712 Ironstone Court, Redmond, $328,312 • James A. and Debra S. Henley, 60710 River Bend Drive, Bend, $303,076 • Michael F. andCinda M. Conroyd, 69820 West Meadow Parkway, Sisters, $175,000 • Richard and Anne Wageman, 16052 Cattle Drive Road, Sisters, $332,067

• Walter M. and Roiann A. Santos, 6654 N.W.Larch Drive, Redmond, $326,125 • Jim and Billie Schilling, 56658 Dancing Rock Loop, Bend, $394,008 • Greg Welch Construction Inc., 61582 Hosmer Lake Drive, Bend, $378,346 • Marc and Sandra Clark, 52495 Lost Ponderosa Road, La Pine, $192,163 • Sage Builders, 225 Vista Rim

Drive, Redmond, $224,479 • Renee M. Palmer and David A. Endres, 17424Egret Drive, Bend, $126,906 • Rick Skinner, 64300 Deschutes Market Road, Bend, $179,200 • Careshare Investments LLC, 20186 Mountain View Drive, Bend, $313,995 • Alan and Melanie Embree, 19134 Currier Drive, Bend, $422,156

IN THE BACK ADVICE Ee ENTERTAINMENT W Health Events, D2 Fitness, D3 Nutrition, D4 THE BULLETIN • THURSDAY, APRIL 10, 2014

O www.bendbulletin.com/health

NEW AT ST. CHARLES

a er, ess invasivesur e By Tara Bannow The Bulletin

A decade ago, having surgery to repair one's aorta — the all-important artery

that brings blood from the heart to the rest of the body

Rob Kerrl TheBulletin

Dr. Wayne Nelson, a BendMemorial Clinic vascular and endovascular surgeon, unveiled the new $5.5 million operating room at St. Charles recently. The St. Charles operating room, a collaboration with BMC's Nelson, is known as a hybrid OR. It includes a large im-

aging system that allows surgeons to both see andperform certain surgeries, with minimal cutting.

— would have required four to five hours on the operating table followed by weeks of recovery, and then probably discharge to a nursing home for physical therapy. Today, it would be a roughly half-hour procedure, and the patient could go home

the next day, said Dr. Wayne Nelson, a vascular and endovascular surgeon with Bend

More photos onD2

Memorial Clinic.

Feel like a

The ability to perform less large imaging system that invasive and disruptive surallows for minimally invasive geries, he said, is thanks to surgeries for patients with cutting-edge technology that's vascular disease,aorticaneuhit the market in recent years. rysms or traumatic vascular "It's just a nightemergencies. and-day difference," M ED ICI N E A h y brid OR allows Nelson said. for catheter-based Since coming to Central interventions, meaning a long, Oregon, Nelson has been thin tube is inserted into the pushing to bring technology blood vessel in order to both to the area to create a top-ti-

see and perform the fixes

er vascular program. On Monday, St. Charles Health

internally. Not only do these types of procedures result in

System unveiled the final

smaller incisions, less scar-

product of its collaboration with Nelson: a hybrid operating room in its Bend hos-

pital. This 1,200-square-foot operating room contains a

ring and shorter recoveries than traditional procedures, but they also increase the

derly or the very frail, Nelson sard.

"Before, if you had a problem like this, nobody was going to be able to take you because you wouldn't live through the procedure," he said. "Now, they don't even no-

tice. I could do the procedure, and it's just like they don't even know it's happening." The hallmark of St. Charles'

$5.5 million project is its massive imaging machine: the Allura Xper FD20 by Philips. The machine's C-shaped arm forms a half-circle around the

number of patients who can

patient table, allowing for 3-D imaging.

be treated, especially the el-

SeeHybrid /D2

Martial arts: Find

TRAUMATIC BRAIN INjURIES

nut? How about in

your inner

milk form'?

warrior

By Noelle Carter

By Howard Schneider

Los Ange(es Times

The Washington Post

Nuts. And water. That's really all there is to nut milk.

high school senior who

Ana Petricel is 17, a plans to become a doc-

Maybe you've noticed all the dairy-free milk brands vying for

tor, and more than once she has knocked me on

my you-know-whatdespite my 70-pound advantage and enough

attention at your local market. Nut milks-

and other plant-based milks such as soy, rice and even coconut — are hot right now. Whether

extra years to know

better. As she should.

Whether we were practicing how to defend against a punch, a grab

you're lactose intolerant

or have perhaps "consciously uncoupled" yourself from dairy, plant-

or other attacks, her

responses were all of a kind: de-

based NUTRITION

signedto

FI T N ESS

options

blend with

are a growing market

the attack, avoid harm,

for both health- and fad-related reasons.

control my balance and put me on the ground. "I am not a violent

But have you bothered to check the back of the box? In addition to nuts and water, you'll most

person," said Petricel,

likely find a litany of additional ingredients.

do dojo in Washington.

Some are added to lend

pure exercise. It is an art

flavoring and/or sweetness, others to fortify

as well as martial. It's

who trains in the Japanese martial art of aikido at the D.C. Aiki"I don't see this as just

spiritual. Physical. Intellectual. It's a workout.

the milk with vitamins

and minerals. Some, like seaweed-derived carrageenan, are added to thicken and emulsify

But that's not just why I'm here."

Whether they're fed by the movies or the rise of mixed martial arts

the milk, while still others work as preservatives to extend shelf

fighting, stereotypes

life. It was enough to

make me wonder how hard it would be to just make it myself. Believe it or not,

homemade nut milk is incredibly simple: Soak nuts, blend and strain. Voila. SeeNut/D4

Recipes on D4

Ryan Brennecke l The Bulletin

Tyson Engel sits in front of Skjersaa's ski and snowboard shop in Bend on a recent afternoon. He's been recovering from a traumatic

alysts, lawyers, nonprof-

brain injury on the mountain three years ago. Nowhe's graduating from highschool and will move to Colorado for college.

it advocates, engineers

and others who practice

• At15, TysonEngelsuffered brain traumawhile snowboarding. It was awake-up callfor schools, too. Newservicesand tutoring options helped himgraduate threeyears later. By Tara Bannow The Bulletin

told the Bend teenager he had sustained a traumatic brain injury — TBI, in med-

or weeks after Tyson Engel overshot a jump on his snow-

ical parlance — a head injury that damages the brain, causing everything from board, hit his head and cracked headaches and vision problems to concenhis helmet, everything seemed tration and attention troubles and mood relatively normal. problems. There were headaches, to be

Loe Angeles Times

Almonds make good "milk" — it's not your only lactose-free choice, but it is one of today's most

popular options.

utes later ..."

milk is incredibly

simple: Soak nuts, blend and strain. Voila.

Although the U.S. Centers for Disease

sure, and he had a hard time sleeping. He Control and Prevention says Americans also got moody and took to talking back sustained 2.5 million TBIs in 2010, experts to his parents. say TBIs are severely underdiagnosed, as That was three years ago. The then-15- many people don't connect their sympyear-old had been snowboarding at Mt. toms to their injuries. Tyson's mother, Jennifer Engel, called Bachelor with a coach, who was training him to compete. After the crash, Tyson the Center on Brain Injury Research and blacked out for a few minutes, took a Training in Eugene, which has organized breather in the lodge, then bought a new a statewide network of TBI educators. helmet and hit the slopes again. "Every crash is like that," he said. "'Oh, I'm done for the day.' And then five min-

Believe it or not, homemade nut

about martial arts persist. Petricel doesn't fit that mold. Neither do I, nor do the thousands of students, think-tank an-

More than a month after the fall, the

high school freshman was back in classes when herealized something was very wrong. He had trouble paying attention and processing information, and it was hard to see out of the bottom ofhis left eye. That's when Tyson saw a doctor, who

"He received, for the first time,

information on how to recognize students who have sustained a concussion — let alone a brain injury — and t7ow to support them in the classroom." — Jennifer Engel, Tyson's mother

The center connected the Engels with Sue

Hayes, the High Desert Education Service District's TBI liaison and program supervisor. Hayes helps educate school districts

and families on caring for students with TBIs. Often, teachers don't understand how a

TBI affects a student's ability to learn in a classroom, Hayes said. These students' thinking is delayed, and they have trouble processing information. "Every other student is running a mile every day, and this student is running a marathon," she said. In Tyson's case, staff members with Bend-La Pine Schools organized a team

that included teachers, medical experts, Tyson and his family to assess his unique needs. For the past three years, the group has monitored his special education

the diverse martial arts styles in the nation's

capital. Here is the reality: A well-run dojo will be incredibly welcoming to beginners and typically filled with trainees of

different sexes, ages, sizes and fitness levels. You'll also find plenty of fun, whether your aim is to learn to spar in tae kwon do, parry with your hands and feet in capoiera, master the turning techniques of aikido or learn the fine points of grappling in Brazrhan ]uytsu.

The spectrum is a broad one. Over time, the martial arts push

you out of any comfort zone — a mental benefit. But they also have a

coursework, tutoring, neurological test-

pretty encompassing im-

ing, physical therapy and class schedule.

pact on your health: Bet-

For Tyson, now 18, all of that work paid off. He's about to graduate from

ter cardio is a given, but

high school and is moving to Steamboat Springs, Colo., this summer to attend Colorado Mountain College. See Brain /D3

also improve strength, posture, flexibility and balance, all important pillars of fitness.

these are activities that

SeeMartial /D3

TH E BULLETIN• THURSDAY, APRIL 10, 2014

HEALTH EVENTS

— ~mh

e y~,

counseling,recipesandgroupsessions;

$199, registrationrequired; 5:30p.m. today, meetsfourtimes overthree weeks; Hawthorn HealingArts Center, 39N.W. LouisianaAve., Bend;541-3300334 or www.hawthorncenter.com. BOYS PUBERTYSEMINAR: Doctor RobLehman presents"TheChallenges of Growing Up" for preteenboysand their parents; $50 perparent/child, $10 per additional child; 6:30-8:30 p.m. Friday, with secondsession 10a.m.-noon Saturday; St. Charles Bend conferencecenter, 2500 N.E. Neff Road;541-382-4321 or www.copakids.com/Event. GIRLS PUBERTYSEMINAR: Nurse Julie Metzger presents"Heart to Heart Talk About Growing Up"for pre-teen girls and their parents; SOLDOUT; 6:30-8:30 p.m. Friday,second session 10a.m.-noon Saturday; St. Charles Bend conferencecenter,2500 N.E. Neff Road; 541-382-4321 or www. copakids.com/Event. HEALTHANDWELLNESS EXPO: Featuring family-friendly, interactive and educational events to promote healthy lifestyles; free; 10a.m.-2

AThe hallmark of St. Charles Health System's

$5.5 million hybrid operating room is a C-shaped imaging machine that forms a half-circle around the patient table, allowing for 3-0 imaging of a patient's

blood vessels.

•

p.m. Saturday; TheRiverhouse Convention Center, 2850N.W.Rippling River Court, Bend;541-389-3111 or 541-322-3661. LIVING WELLWITH CHRONIC CONDITIONS:$10 includes the book, "Living a Healthy Life with Chronic Conditions," registration required; 1:30-4p.m.,Mondaysthrough May 19; Heart'n HomeHospice & Palliative Care, 51681Huntington Rd., LaPine; 541-322-7430 orwww.livingwellco.org. AMERICANRED CROSS BLOOD DRIVE: 11a.m.-4 p.m. Tuesday; The Church of JesusChrist of Latter-day Saints, 450 S.W.Rimrock Drive, Redmond; 800-RED-CROSS or www.redcrossblood.org/pnw. COCC NURSINGPROGRAM ORIENTATION: Reviewthe selection procedureand prerequisitesforstudents interested inapplying; free, registration requested;3:30-4:30p.m. Tuesday; Central OregonCommunity College, Boyle EducationCenter,room155, 2600 N.W. CollegeWay,Bend;541-318-3741. IN OURVOICE: Apresentation on recoveryand living well withmental illness; free; 7-9 p.m.Tuesday; St. Charles Bendconference center,2500 N.E. Neff Road;541-382-4321 or www.namiicentraloregon.org. AMERICANRED CROSS BLOOD DRIVE: 10a.m.-3 p.m. Wednesday; RedmondGrange,707S.W.Kalama Ave.; 800-RED-CROSS or www. redcrossblood.org/pnw. A NOVEL IDEA:SPANISH FLU IN CENTRALOREGON: Learnaboutthe influenza epidemic of1918 andhow it affected Central Oregon; free; 6p.m. W ednesday; Downtown BendPublic Library, 601 N.W. Wall St.; 541-6177050 or www.deschuteslibrary.org.

AMERICANRED CROSS BLOOD DRIVE:10a.m.-3p.m. today; Walmart,300 N.W.OakTree Lane, Redmond; 800-RED-CROSS or www. redcrossblood.org/pnw. THE BASICS: MEMORY LOSS, DEMENTIAANDALZHEIMER'S DISEASE:Understandwhat is happening to aperson with Alzheimer's disease through professionals and firsthand accounts; free;10-11:30a.m. today; Prairie House Assisted Living and Memory Care,51485 Morson St., La Pine; 800-272-3900. SPRING CLEANSE:Participate in a cleansethat includes nutritional

•

. • IB

WAfullviewofthe 1,200-square-foot operating room, located on St.

Charles' Bend campus.

PEOPLE

A hybrid OR allows

for catheter-based

•Gary Buchhelz recently joined BendMemorial Clinic's neurology department. Buchholz received hisundergraduatedegrees at the University of California in DavisandSanta Barbara. Hereceivedhis medical degree from ColumbiaUniversity College ofPhysicians andSurgeons and is board-certified in psychiatry andneurology. Buchholz hasbeen practicing neurology in Bendsincethe mid-1980s andhasadvanced training in treating Parkinson's disease,epilepsy anddystonia. •Amy LaRue recently opened anaturopathic medical practice in Bendfocusing on women's health. Shereceived her bachelor's degree in dietetics and premed at Louisiana State University in Baton Rouge,La., and her doctorate in naturopathic medicine from theNational College of Natural Medicine in Portland. LaRue isalso a certified practitioner of holistic pelvic care and iscurrently completing advanced training in classical homeopathythrough the New England School of Homeopathy. For more information, visit her website at www.dramylarue.com. •Marlene Moore Alexander of Partners in Care recently joined Sandra Bertman and Molly Carlisle in presenting "NewDynamics of Hospice andPalliative Care" at the 25th conference of theGlobal Alliance for Arts & Health in Houston, providing a hands-on art experience onhow to facilitate caregiver art. Alexander is anartist, a teacher andthe arts coordinator for Partners in Care, Bend.

interventions,

meaning a long, thin tube is inserted into the blood vessel in

•u

urP~, — ~,~jr

order to both see and perform the fixes internally. Not only do these types of procedures result in smaller incisions, less scarring and shorter recoveries than traditional

procedures, but they also increase the number of patients who can

DISPATCHES •Core Movement Pilates Studio recently added postural therapy to its Pilates practice. Postural therapy incorporates researchandknowledge about alignment, balance andstability. Conni Ramsey,owner of the studio, addedthe therapy based on her work with elite trainers while arecent staff instructor at Rancho LaPuerta in Tecate, Mexico. Shewill also incorporate the therapy into anupcoming yoga-Pilates retreat in Mexico. Ramseyhas beenacertified Pilates instructor for 22 years.

be treated. 4 An adjacent observation room houses computers

q~~ g~ lo i"a fof DaSI;

and features two large windows that face the main

surgical area.

~ June15th,2014

Photos by Rob Kerr /The Bulletin

Hybrid

Rohit Inamdar, a senior asso- into open surgery then and

Continued from 01 The technology also allows doctors to prepare ahead of

Applied Solutions Group. Even rush the patient to the operatif smaller hospitals don't have ing room, Inamdar said.

ciate with the ECRI Institute's the current patient volume to

www.be n d d a s h.com

there rather than having to Another benefit of the hybrid

support such an investment, OR is the fact that the Allura say, John Day. CT scans can they may install them to pre- Xper FD20 exposes patients to be sent instantly, loaded onto pare for what they'll see in the 75 percent less radiation comthe computer and aligned with coming decade, he said. pared with the imaging equipimages of the actual patient The trend in health care to- ment used previously, Nelson once he or she is on the table, ward minimally invasive pro- sald. providing what Nelson calls a cedures has been going on for The equipment exposes the "3-D road map of the patient's years, Inamdar said. Laparo- patient to less radiation because blood vessels." scopic mugery, for example, was rather than emitting a constant The Allura Xper FD20 was Introduced decades ago. Now, flow, it pulses for only a small among the most commonly sugeons are even using robots, proportion of the time during purchased imaging machines such as the one St. Charles Bend the procedure, Inamdar said. It for hybrid ORs between 2012 purchasedin 2012,to perform may be on for only 30 percent and 2013, at 21 percent of all sugeries, he said. of the time, for example, thereby " These endovascular ap purchases, according to an reducingapatient's exposureby analysis by the ECRI Institute, proaches now in surgery are 70 percent. The pulses happen a nonprofit that uses research really ultra-minimal because so fast, however, the eye doesn't to analyze the merits of medical they go through our blood ves- pickup onit, he said. procedures, drugs and devices. sels," Inamdar said. "They will BMC has hired another vasThe machine costs an average make an incision either in the cular surgeon, Dr. Jason Jundt, of $1.5 million and typically groin or the arm and ... they to work in the hybrid OR with makes up half the total cost of can basicall y go anywhere in Nelson. Jundt, who graduated building a hybrid OR. the body with a catheter." from the University of Texas Hospitals are experiencing In the rare case that some- School of Medicine in San Anincreasing market pressure to thing goes wrong during such tonio in 2008, will begin in July. build hybrid ORs like the one delicate procedures, hybrid — Reporter: 541-383-0304, St. Charles just unveiled, said ORs allow the physician to go tbannow@bendbulletirr.com time for a trauma patient in,

With a track record of over 500 laparoscopic ox robotic prostate and kidney suxgeries, with 100 right here in your community in the past year, ihai's experience you can inasi. See our cancer surgery outcomes at urologyinoregon.com. You will find that oxxx resxxlis aival centers in Seaitle, Portland and Califo~

Make an appointment today at one

Tips for surviving asevereallergy season Lenny Bernsteln

• Consider exercising in- nightly to rinse pollens from doors on very high pollen skin and hair. Change dothes The arrival o f w a rmer days. Pollen levels may peak before entering your bedrooms weather unleashes a pol- during the midday and after- to keep pollens out. len tsunami. Here are some noon and are generally higher • At home and in the car, survival tips from Clifford on warm, dry, windy days. keep the windows closed Bassett, an allergy specialist • Get confirmation that you and set your air conditioner and assistant clinical profes- have seasonal allergies, with to "recirculate." Clean filters sor of medicine at the New simple in-office tests. in room air conditioners freYork University School of • Begin treatment with med- quently. Do not use fans that Medicine. ications such as nasal antihista- suck outdoor pollens into your • Wear oversized sunglass- mines, oral antihistamines, ste- living area. es to block airborne pollens roids and eye drops even before • E liminate w e eds f r o m and molds. symptoms start. your yard and plant aller• W ear a hat, prefe rably • Talk to your doctor about gy-friendly greenery such as one with a wide brim. allergy shots, which c an azaleas and begonias, palm, • Avoid outdoor line drying slow the progress of allergic pine, fir and dogwood trees; of clothing and bed linens on a disease. hibiscus, boxwood and yucca high pollen day. • Shower a n d sh a m poo shrubs.

of our three Central Oregon clinics.

Bend 1247 NEMedical Center Dr., Ste. C

,a" +

The Washington Post

Redmond 236 N/rrrKingwood Ave., Ste. A

,+ p++" ,,4'ije"+'+" .',.+,+.0;e;+" >,.+,+aii

Prineville 1103 NE ElmStreet

I,"+'iiii , :+.+.e;a"w ~ "

' ~:++,ia.y" r+,++$P+' r++,"e'i<=p. +4+'+~'

Urology'""

..,.++.~~y: ='

,++yy „+'+'y+e,

S PECIALISTS OF OREG O N

++"y"y"y

•

• •

' I I

•

THURSDAY, APRIL 10, 2014 • THE BULLETIN

Brain Continued from 01 It was an especially important learning experience for the teachers, especially 7yson's math teacher, Brad Soto, who is also a football coach at Mountain View High School, Jennifer Engel said. "He received, for the first time, information on how to

organization is constantly in-

creasing, she said.

'The big crash' In their quest to learn more 7yson and his parents to look

back on the boy's active 15 years of life. "Concussions are cumulative," his mother, Jennifer En-

Doctors don't have a test

class because they're tired. that definitively diagnoses a They might go from being an TBI, said Chesnutt, also the A student to a B or C student.

co-director of the Oregon Con-

They could look depressed, stop doing their homework or become impulsive. "Maybe they're lacking in attendance, not coming as of-

cussion Awareness and Management Program. For now, the diagnosis is based off a list of biomarkers for TBIs that in-

clude physical symptoms such ten," Hayes said. "You have to as headache, nausea and vomfind out why. You have to dig iting, behavioral symptoms deeper to find out why. Those such as mood and a patient's are some t h i ngs t e achers sleep patterns. might recognize in school, and Researchers, however, are parents." trying to develop blood tests In some cases, teachers may or brain wave patterns that think students are trying to be would provide a clear answer, dishonest or deceptive with respect to their homework, at-

Chesnutt said. Such studies

are painfully underfunded, tendance or behavior in class, he said. About $20 per person Chesnutt said. with a TBI is being spent on "A lot of times students are TBI research, compared with accused of either faking it or about $2,000 per person with dramatizing it," he said. Parkinson's disease and multi7yson's situation is c o m- ple sclerosis, he said. "It's about 100 times less in mon in that he didn't realize he had a TBI until he was back terms of per person with injuin school and taking on the ries," Chesnutt said. "That's responsibilities and challeng- one reason that the research es of being in the classroom, is so lagging because there hasn't been as much invested Hayes said. K ids with T BIs wh o a r e

in it, both in funding but also

even younger than 7yson in personnel." might do fine in, say, elemenSitting in his living room tary school. with h i s p a r ents, Jennifer "But then they hit middle and Dave Engel, 7yson, with school where the demands get chin-length hair and a hooded greater, and then that incident sweatshirt, looks and sounds that happened when they were like any high school student. younger becomes more appar- To the casual observer, it'd be ent," she said. almost impossible to tell he Hayes' organization, the suffered a TBI three years ago. High Desert Education SerIn fact, he still makes it to vice District, provides services to school districts that aren't

Mt. Bachelor to snowboard

at least once a week, even in their budgets — speech and though doctors told him he language therapy, education wouldn't be able to after the technology and legal services. TBI. For Tyson, snowboarding It has offered TBI services for puts his mind at ease. "I'm mentally and physicalnearly 20 years, but still relatively few people are aware ly at peace," he said. "I just feel students can take advantage more a part of nature than a of such services, Hayes said. part of the human species." The number o f s t udents w ith TBIs identified by t h e

FITNESS

about TBIs, one fact forced

gel, said, "and every time you recognize students who have get a concussion, the sympsustained a concussion — let toms will get worse the more alone a brain injury — and you have.... This was the big how to support them in the crash." classroom," she said. When Tyson was just 5 years old, he was thrown off Talking about TBls a horse at a birthday party. To illustrate just how unAround the same age, he hit derdiagnosed TBIs are, Hayes his forehead on the side of the paints this picture: Some es- bed he was jumping on with timates say there are enough his siblings, an injury that repeople with TBIs in the U.S. quired stitches. to fill Texas Memorial StadiAt around 10 years old, Tyum in Austin — which seats son was laughing in the back roughly 100,000 people row of the school bus and acthree times each year. cidentally banged the back of "We can't even fill it once his head against the window. nationally," she said, refer- That one needed staples. ring to the number of TBIs Beginning in the fourth d iagnosed annually in t he grade, he played three years of U.S. "Here in Central Oregon, tackle football, an activity that, we're a microcosm of that. It's in hindsight, his mom said she an invisible disability at some regrets allowing him to do. level. People can't always see In middle school, someone's it." out-of-control skateboard flew James Chesnutt, medical di- up the ramp Tyson was standrector at Oregon Health & Sci- ing on and struck him just beence University's concussion low the eye. program,said some estimates TBIs are elusive in that there put the number of people with isn't always a specific blow to TBIs at more like 3.3 million, the head — like Tyson's snowmore than 10 times Hayes' boarding accident — that ultiexample. mately triggers the symptoms, Even so, the visual illus- Chesnutt said. In some cases, trates how important it is to a young person has been playhave people like Hayes helping a rough sport for years and ing school districts recognize the symptoms seem to happen the signs of TBIs and teaching out of the blue, he said. the districts to accommodate In those cases, "you have s tudents dealing w it h T B I to think of other things in life symptoms. that could be causing those Symptoms show up differ- symptoms other than just the ently in every person, which fact that you've been hit every makes TBIs even more diffi- day for a whole season versus cult to recognize, Hayes said. 'I got knocked to the ground Some students might com- and had a headache after plain of headaches. Maybe that,'" Chesnutt said. they put their heads down in

— Reporter: 541-383-0304, tbannow@bendbulletin.com

One-arm dumhhellrow: ahetter movefor your hack The one-arm dumbbell row is helpful for strengthening the back muscles, along with working the shoulders andarms. Primary muscles worked include the trapezius, rhomboids, deltoids, biceps andlatissimus dorsi. Smaller assisting muscles include the infraspinatus (one of four rotator cuff muscles) and teres major, which acts as aninternal rotator and adductor of the arm. Startingposition: Hold a dumbbell in your right hand and, leaning forward, place your free hand on your left knee for support (pictured). For proper form, your left hand should bedirectly under your shoulder and left knee in line with the ankle. Donot allow the back to round and engagetheabdominal muscles to help stabilize the spine. During the exercise, look straight aheadand donot allow your torso to rotate. Strengtheningphase: Slowly lift the dumbbell upward until the upper arm is parallel to the floor. As you are lifting, keep Cox Newspapers your arm close to the sideof your body and spinal column in alignment. W henyouhavereached full range of motion, pause,and then slowly return to starting position.

Aiming to improve onBMI The Washington Post

Most people know that BMI,

OntheWed www-ce.ccny.cuny.edu/nir/ sw/absi-calculator.html

or body mass index, is a fitness indicator calculated using your height and weight. Most people also know (don't you?) two-thirds power. The develthat where you carry your opers explain in the July 2012 weight makes a difference: It's

issue of the journal PLOS One

less healthy to have a dispro- why theythink it is auseful esportionate amount of weight timate of mortality risk. If you'd rather skip the sciaround your midsection. The April issue of 0 (the ence-speak, go to the Web adOprah magazine) features a dress above to plug in your age, calculator aimed at factoring height, weight and waist meathat belly fat, as well as your surement. If the "Relative risk, age, into the equation and BMI+ABSI" comes out as I, assessing your relative risk that puts you at average risk of of premature death. Called prematuredeath for someone A Body Shape Index, or ABSI, your age; less than I indicates the formula i n volves such less risk; and greater than I complicated steps as calculat- means ... well, you might want ing BMI, then raising it to the

to start doing some crunches.

Sometips: • For variety, you can perform rows by using resistance bands, which are aconvenient alternative to dumbbells, especially when traveling. Positioning the bandaround anystable object allows for performing either a single-arm or double-arm row, seated or standing. • You can also perform a single-arm dumbbell row using a bench. In this case, placethe left knee and left hand on thebench to supportyour body weight, dumbbell in right hand. • If you are uncomfortable using dumbbells, most gyms havemachinesdesignedspecifically for doing rows. Typically, equipment will be labeled with a description of how to perform the exercise. • Variations to grip and positioning the arms further away from the bodycan beapplied when performing rows to work muscles differently. If you are abeginner, seek theadvice of a professional or use aspotter who has experience with strength training to help ensure proper form. • Safety should be your first priority when working out. If you havemedical conditions or existing injuries, its always best to get clearance from your doctor before starting an exercise program. — Majrie Gilliam, CoxNewspapers

Martial Continued from 01 Y ou learn to m ove i n

more diverse ways. Had you asked me five years ago whether I would ever do a standing barrel roll or

"In my experience, I can teach anyone to do anything ... as long as they want to learn."

are things you train to dogradually and safely.

charge. How long have they adapt to whatever customs are been in business? What's in play. The bowing, clapping their training? What are their be comfortable and ready to

or class mottos might seem

goals? If it is a studio that has

affected. But it's part of absorb- been in business for a while, ing the culture, and you'll find with a thriving membership — Michael Veltri, that much of it either involves and a welcoming vibe, there's martial arts instructor safety or provides a moment of a reason for that, and you can

survive a hip throw, I'd have shaken my head. But these

focus that makes the practice

probably trust what you see

more effective. And pay atten- and feel. tioners the workout becomes

tion to the entire class. Are the

Most important, commit to

an almost gymnastic routine warm-ups adequate? Over the at least a few steady months None of that is surpris- where seeming falls turn into course of an hour, do you seem of training, even if progress ing, perhaps. These activi- kicks and "opponents" sweep to get the exercise you would seems slow and there's a tempties have thrived for a rea- and avoid each other's legs in want? tation to quit. The benefits son, whether it is the grace- a dance-like partnership. It's Lastly, ask questions about are real. But only if you get ful tai chi (yes, it's a martial even accompanied by drums the place and the people in knocked down a few times. art) seen so commonly in and singing, true to its BrazilChinese parks, or the vig- ian origins. orous sparring of Western Butyou don't need tobe able boxing or Japanese karate. to cartwheel to participate, so "In my experience, I can don't be intimidated. teach anyone to do anyWhen there are new stuManaging Your Health & chronic lunesses thing with aikido as long dents, instructor and owner Community Education Senes

• To Your Health

as they want to learn," said

Roberto Tapia splits the class

Michael Veltri, the owner of

and spends time with the beginner group to teach basic

D.C. Aikido and sensei to Petricel, me and the others.

A FR Es H L o o K

moves that can be picked up

A T NUTRITIO N

To test that world beyond in one session. And at first it aikido, I went to beginner does feel like you are dancing sessions at Yong Studios in — until you realize how the Washington for a tae kwon hand is positioned for a strike do class and Roda Movements Studio in Takoma

and the feet for a kick. "If you want to be effective,"

Park, Md., to try capoiera.

he said, "it has to be pretty."

A s someone wit h

Free program on nutrltlon as you age & growlng a small-space garden

Annie Baumann, RD, LD

prior training in those dis- Interaction ciplines, would I get anyOnce you select a discipline thing out of a first class? that seems right for you, visit Would I be welcomed, or a studio or dojo and pay attenfeel like the klutzy new kid tion to the people: how they on the block?

Registered Dietitian, Bend Memorial Clinic

Doug Stott Redmond Greenhouse

train and interact, whether the

These are the anxieties beginners get adequate attenthat can keep us from doing tion. In this sort of training, things that we want to try. you are joining a communiMy advice: Put those no- ty, and the more you like that tions on a shelf and forget it. communitythe more you are

The disciplines

Friday, April 25, 2014 10 a.m. — 12 Noon HospiceCommunity Room, 732 SW 23rd Street,Redmond

apt to stick with it. Look also at things like the

came obvious is how dis-

level of ritual involved; some places are sticklers on cer-

tinct disciplines are. That is

tain points of etiquette, others

important to keep in mind. If you want to pursue a

more relaxed, and you should

The first thing that be-

To slgn up, please call

541. 548.7483

HosplCE of Redmond

martial art, don't just rush to the nearest karate studio

and sign up. Investigate the origins, ethic, style and culture of different disciplines, try a few different introductory sessions and see what clicks. Do you want to strike and kick? Grab and throw'?

f„

1:"'h PreStige SeniOr Living

Spin? Tumble? Spar? Are you an 11 on the intensity

High Desert T,

scale, or want something

that works more on the mind and spirit?

4 •

•

Just as an example: In

aikido we thrive on circular motion — using turning movements and the energy of an opponent's attack to put them off balance, principles also applied in learning how to fall safely. As we grow older, that particular

By Nancy Szokan

Thursday, April 24'", 2014, 3pm Presented by Lorie Weber, PA-C, Partners In Care Home Health and Hospice

skill adds a new element to the concept of self-defense.

Stress Reduction for Seniors

In tae kwon do, by contrast, " everything is a

Lorie reviews the types of stress senior's deal with, how to recognize the stress, manage it and transform it. She gives great examples of how folks living in Assisted Living can deal with the stressors of being a senior adult.

straight line," said Peter Hounsell, the instructor of

a recent beginner's class. We worked for most of the hour on kicks, and the aim

was to align everything from the angle of the foot through the placement of

the hips and shoulders to generate maximum force. I was lousy at it. That wasn't the point.

"This really should be like a home," said Do Yong Kim, owner and master instructor of the studio. "You

Partners In Care

All presentations are held at High Desert Assisted Living, 2660 NE Mary Rose Place.

can make mistakes. When

you are here, it's safe. People don't judge. You're just another person training." C apoiera adds a f u lly di fferent d imension. Among advanced practi-

Please RSVP to (541)312-2003 Refreshmentsprovided.

Prestige Senior Living High Desert www.PrestigeCare.com

2660 NE Mary Rose Pl Bend, OR 97701

TH E BULLETIN• THURSDAY, APRIL 10, 2014

TION What nowabout fat? Studythrows a wrench in the heart disease debate My doc was pleasedthat my blood tests had improved. "Cholesterol's down," he reassured me. Yay. Trying to avoid excesssaturated fat in my diet paid off. Thenhehanded me acopy— hotoffthepressof a report in the Annals of Internal Medicine that appears to question that choice. Areview of the association betweendifferent types of fats andcoronary (heart) diseaseconcluded: "Current evidence does not clearly support cardiovascular guidelines that encourage high consumption of polyunsaturated fatty acids and lowconsumption of saturated fats." Translation: This study found no clear proof that cutting back on mysaturated fat intake and increasing my intake of polyunsaturated fats will lower my risk for heart disease. My first reaction was, "Yippee. I think I'll go buy that yummy-tasting high saturated fat yogurt I usu-

ally avoid." My second reaction was, "Maybe I need to get more information." OLD STUDIES,NEW FINDINGS This current report is actually a review of several studies, most of which are "observational" — considered a poor source of information on theeffects of dietary changes. Moreover, observational studies give us clues to what weneedto study further. And to its credit, this study also looked at real experiments on real people in randomizedcontrolled trials. So what's the problem?Theway I understand it, we haveampleevidence that replacing saturated fats in the diet with those that aremoreunsaturated reduces the "bad" LDLcholesterol in our blood. And lowering LDLlowers our risk factor for heart disease. These researchers found nopositive proof, how-

ever, that just eating less saturated fat (or eating more polyunsaturated fat) will cut our risk for heart disease. Which is enough tofuel the Internet with comments like, "Don't readanything written by food experts." To which I reply, I'd much rather trust a trained pilot to guide me to mydestination than the guy in the back of the planecomplaining about the turbulence.

SO, WHAT'SBAD FOR YOUR HEART? So here's what experts generally agree on: lrans fats —more than saturated fat — are detrimental to heart health. That's why the FDA recommends we phasetrans fats out of our food supply. Saturated fat —of which there are several types, some moredetrimental than others — complicates studies of this type evenmore. Eating patterns that include awide variety of plant-dased foods —from vegetables to fruit to

whole grains to beans to nuts — haveshown over and over again to protect against heart disease, obesity and Type 2diabetes. This "whole diet approach" is naturally lower in saturated fat and shows benefits "not from one specific element, but from the sum of its parts," according to Jeremy Pearson, associate medical director of the British Medical Journal who helped fund this research. "This study does not tell us that saturated fat is good for us," says Pearson. "It only tells us that saturated fat may not be asdamaging as wethought." Personally, I know the benefits when I improve the overall quality of my diet. Andeven if there is no absolute proof that the saturated fat in that yummy-tasting yogurt will give meheart disease, I need those extra fat calories like I needanother controversial diet study. — Barhere Ouinn, TheMonterey County (Celif) Herald

4simplestepstohomemadenut milk, usinif almonds

Step1: Pour water over almonds tosoak.

Step 2: Drain almondsand rinse.

Step 3: Puree in a blender.

Basic Nut Milk and Nut Cream

Nut options Almond is by far the most popular nut milk around, but why stop there? I loved experimenting with hazelnut and pistachio milks, neither of which you're likely to find at the store. And macadamianuts make an extrasmoothand creamy milk, perfect when substituting for dairy in, say, bisque.

Only one ingredient (not including water): 1 Ib raw, shelled nuts

Nut

Tomake nut cream: After blending the nuts, pass the nuts through astrainer to weedoutany coarse bits (eliminating the cheesecloth or use of a nut milk bag will allow more solids to pass through to thicken the cream). This makesabout 6 cups cream. Thestrained liquid should havethe consistency of heavy cream. Keep:The nut milk or cream will keep for up to five days, covered and refrigerated. It will naturally separate; simply give it a quick stir or shake to reconstitute before using. Nutmeal: Keep the discarded nut mealafter straining, as it can be used in a variety of ways (including adding to oatmeal, yogurt, dips or soups, as well as using the dried meal in tart or pie crusts, cookies or fillings). Todry themeal, spread ona rimmed baking sheet and place in a250-degree ovenfor afew hours, stirring occasionally, until the excessmoisture is evaporated.

basic: Take raw nuts and im-

Drain the water and give the

nuts a good rinse, then place them in a blender with fresh water and blend away to your heart's content.

PhotosbyAnne Cusack/Los Angeles Times

When the nuts are pureed, the fine grit from the nut pulp, the liquid will need to be carefully strained. Several layers of cheeseclothover a mesh strainer work well, as does a tea toweL But the best thing

Bonus Recipe:Vegan Almond Sable Cookies With Cacao Nibs Makes about1~/~ dozen cookies. Takes 45 minutes, plus cooling time. /3 C plus 2 TBS refined coconut

/2 tsp almond extract

~/4 tsp salt oil, at room temperature I've found is something called '/3 C vegansugar (or regular, '/3 C almond meal a nut milk bag (yes, that's the if nonvegan is OKfor you) 1 C (4~/4oz) flour ~/2 C cacao nibs name, and it can easily be 1 tsp vanilla extract found on the Internet). Fill the bag with puree and gently In the bowl of a stand mixer fitted with a paddle attachment, or in a squeeze the liquid out; the bag medium bowl using ahandmixer, beat together the coconut oil, sugar, vaworks wonders at removing nilla extract, almond extract and salt until well combined, 1 to 2 minutes. the grit to give the milk a nice, By hand, stir in the almond mealand flour until thoroughly incorporatsmooth texture. ed. Use your hands if needed to knead the ingredients, still in the bowl, After the liquid is strained, together to form a uniform dough. Stir or knead in thecacao nibs. adjust the consistency with adForm the dough into a log approximately 2 inches in diameter, and roll ditional liquid to suit your taste. in a sheet of plastic wrap (the doughwill be crumbly, and the plastic wrap Most methods I've seen call for will keep each cookie in place as it is sliced). If the dough is too soft to a ratio of 1 cup of nuts to 3 or 4 slice, refrigerate the log to firm it up, 10 to 15minutes. cups water. I personally prefer Heat the oven to 350 degrees. Cut the log, still in the plastic wrap to one pound of nuts (a little over support the dough, crosswise into slices /~-inch thick. Removeany piecthree cups) to around six cups es of plastic wrap and space the slices 1/~ to 2 inches apart on parchment-lined baking sheets. Tip: Rotate the log onequarter-turn in between of water for a nut milk similar in consistency to whole dairy slices to keepthe round shape of the cookies as they are sliced. milk. To create a "cream," alBake the cookies until set and very lightly colored, 16 to 20 minutes, low a little of the finer grit in rotating the cookies halfway through for evenbaking. with the milk and reduce the Place the baking sheets on a rackand cool the cookies completely bewater for a thicker consistency. fore removing. Because homemade nut Nutrition notes, for 1 of 18 servings: calories 177, protein 2 g, carbomilk will naturally separate hydrates11 g, fiber 2 g,fat14 g, saturated fat10 g, cholesterol 0, sugar 4 g, over time, store it in a contain- sodium 33 mg er with a tight-fitting Ld so you can give it a good shake before using. Once it's made, the milk will keep, refrigerated, for April 15, 2014 three to five days. Education Meeting Nslonal Alllance on Menlal Illness As for the leftover pulp, save

it. You can use it in so many things. Flavor the pulp and use it as a spread, add it to a shake or fold it in with pancake batters or dips. Or simply spread the pulp out and slowly dry it in a low oven to make nut meal. I recently used some dried-

out almond meal in cookies. For a batch of sables, I coma l mond

meal, sugar, flour and cacao nibs, rolling the c rumbly dough into a log. After slicing and baking, I took a bite of a still-warm cookie. Rich, with

a sabie's signature "sandy" texture, one mightneverguess the cookie was dairy-free. And vegan. Perfect for my healthand fad-conscious friends.

Flavorings andsweeteners areeasy to add, though I'd recommend against if you plan to use the milk in savory recipes. Toss alittle vanilla or spice in the blenderwith the nuts when you're ready to puree, or sweetenwith dates, honey, agaveor maplesyrup.

IlO ilr Handa alrt'V Do your hands turn white, blue, purple or transparent when cold? Are the back of your hands shiny with no lines on your knuckles? Do you have unexplained weight loss? Do you experience shortness of breath? Do you have swallowing difficulties or heartburn?

Nutritionnotes for nutmilk/cream

merse them in a bowl of water. Soak the nuts until they're noticeably plump (kind of like soaking raisins), at least several hours and up to a day or so.

strain the liquid. Because of

Nut milkflavors

Makes about 5 cups milk (seedirections for details). This recipe takes 15minutes, plus soaking time.

Place the nuts in a bowl and cover with 2 inches of water. Cover with plastic wrap and refrigerate to soak at least one night, preferably two. Drain the nuts and rinse under cold water. Placethe nuts in a high-speed blender (this will need to bedone in a couple of batches) andadd enoughwater to cover by an inch. Pureeuntil completely smooth. To makenut milk: Pass the nuts and liquid through a nut milk bag or cheesecloth-lined fine meshstrainer. You can squeeze the bag or work with a spatula to make sure you get as much of the liquid as you can. The final "milk" should have the smooth consistency of whole dairy milk; if desired, add water to thin. This makes about 5 cups nut milk (consistency will depend Continued from D1 on the type of nut and amount of water added while There are plenty of recipes blending, and canvary from just over 4 cups toaround for nut milks available on the 8 cups or more, depending ondesired consistency). Internet, but the method is

bined coconut o il ,

Step 4: Strain through a nut milk bag.

~niimi

National Alliance on Mental IllnessCentral Oregon April 15, 2014 community Education Meeting

In Our Own Voice Do you or someone you love have a mental illness? Do you want to learn more about what it can be like? Do you yourself have a mental illness and want to gain hope, to realize that it can get better? In Our Own Voice is a presentation by trained presenters who are living well with mental illness. Recovery is possible, hope is there. 7his powerful presentation helps reduce the stigma often associated with mental illness. Come learn about other NAMI programs.

When: 3rd Tues. 4/15/14 7-9 PM Where: St. Charles Medical Center-Bend Conf. Rm. C Light refreshments available

Facts for each~/~cup when using almonds in the recipe above: Nut milk:calories 84, protein 3 g, carbs 3 g, fiber1 g, cholesterol 0, sugar1 g, sodium 7mg, fat 7 g, saturated fat1 g Nut cream:calories107, protein 4g, carbs4 g, fiber 3 g, cholesterol 0, sugar1 g, sodium1 mg, fat 9 g, saturated fat1 g

If you areexperiencing any one ormoreof thesesymptoms, it may be anautoimmune diseasecalled Scleroderma.Call your doctor for an appointmentwith documentedsymptoms as soon aspossible to either rule out or confirm Sclerodermadiagnosis. Raising Awarenesswith Strength R Courage

for more infovisit www.sclerodermaaniel.orl

r r

<*/'/," "

Don't let your changing vision affect your active lifestyle.

We have modern vision solutions for mature eyes that can haVe yOLI Seeing aS yOung aS yau feel: • Premium Lens Implants for simultaneous near and far focus • Bladeless LASIK vision correction

Inrocus

• Advanced Dry Eye Therapy • Cataract Surgery

eye care

• Eyelid Rejuvenation

cata r ac t • l a s i k • v i s i o n

All meetings are free and open to all. See our website www.namicentralore on.or for more information on our free meetings, classes and support groups

a •

•

• •

•

THURSDAY, APRIL 10, 2014 • T HE BULLETIN D 5

ADVICE Ee ENTERTAINMENT

' iicon ae'vs.' rones': TV SPOTLIGHT

By Mark Milian and Sarah Frter Bloomberg News

comedy "Silicon Valley" debuted Sunday, some of the real er shows: "Game of Thrones." Silicon Valley fans of the dragon-filled fantasy drama celebrated the return of the

has established itself as a bona viewers per episode last sea-

and one in San Francisco.

son, the most of any show on

Yet none of that translated

the network since "The Sopranos" in 2004.

to "Jobs" becoming a hit. The movie has a 27 percent rating

of Mountain View, Calif.-based

software startup EasilyDo Inc., was one of those who got

that,' and, 'Larry doesn't walk

fide escapist hit as the series averaged 14.4 million gross

ing one at the South by Southwest festival in Austin, Texas,

fourth season Sunday evening. Mikael Berner, founder

myself judging everything — like, 'We don't code like

Being true to life was part of the problem for some technology workers who decided not to watch "Silicon Valley." In contrast, "Game of Thrones"

technology executives, includ-

s eries, which kicked off i t s

too connected with my reality," Berner said. "I just find

and others who worked there.

"Silicon Valley" 10 p.m.Sunday, HBO

technorati were more interested in one of the network's oth-

— and then skipped "Silicon Valley," which aired right afterward. He said Hollywood often misses the mark when trying to capture Silicon Valley life. "I prefer shows that aren't

researched Silicon Valley culture, speaking with executives

"Game of Thrones" 9 p.m.Sunday, HBO

SAN FRANCISCO — Even as the much-anticipated HBO

together with friends to follow the battle for the Iron Throne

's Lie oi ee s

of Thrones." The show, in its

Siqi Chen, whose startup Hey Inc. makes the Heyday digital journal app, said he'll still watch "Silicon Valley" using the HBO Go app on his

fourth season, has become

iPad. Yet Chen said he isn't

from critics on Rotten TomaJaimia Trueblood/HBO

"Silicon Valley" stars Zach Woods, le ft,and Thomas Middleditch, front. It's a new satirical comedy about the tech industry.

For "Silicon Valley," HBO

toes, and it landed in seventh place on its opening weekend. With "Silicon Valley," HBO took aim at the same technology-savvy young adults who are ditching monthly cable subscriptions for cheaper, online options from Amazon and Netflix.

"It's kind of like a two-fer," tailored to the technology in- said Ken Doctor, an analyst dustry. The cable channel held with Newsonomics, a media a screening for the show last consulting firm. "It's another week in Redwood City, not original series, which they picourted attention with events

around with Google Glass on; far from the headquarters of

oneered, but aimed directly at

Sergey does.' It's not as fun." Berner illustrates how even

Oracle and Electronic Arts.

the cord-cutter generation."

amid a blaze of hype for "Silicon Valley," a satirical program from "Office Space" creator Mike Judge, some of the digerati were shrugging their shoulders. That continues a vein of indifference toward te-

and venture capitalist Michael

Elon Musk of Tesla Motors

Netflix, the largest subscrip-

tion streaming service, surArrington were among the at- passed HBO last year, posting tendees. HBO has put on sim- 24 percent growth in paid U.S. ilar red-carpet affairs to build subscribers and capturing buzz for its other shows — in- tons of publicity with shows cluding a screening of "Game like "House of Cards" and "Orof Thrones" last year in San ange Is the New Black." While chie-oriented entertainment. Francisco where technology HBO has hits like "Game of Reality show "Start-Ups: Sil- influencers rubbed elbows Thrones" and the buzzy "True icon Valley," which was pro- with the cast and creators. Detective," U.S. subscribers duced by Facebook CEO Mark Those tactics haven't helped were basically flat last year at Zuckerberg's sister, flopped other Silicon Valley-themed 28.6 million, according to rein 2012. "Betas," the Amazon. entertainment become h its. searcher SNL Kagan. com-produced comedy about For Ashton Kutcher's portrayal With Judge,HBO bet on a life at a software startup, was of the Apple Inc. co-founder in creator who specializes in irnot on a list of shows that was the movie "Jobs," the actor held reverence. Judge created the renewed. severalscreenings lastyearfor animated MTV hit about two

Helen Sloan/HBO

LenaHeadey stars in "Game HBO's biggest hit since "The

sure he'll enjoy it. "When you

Sopranos."

watch shows like this, it's not

exactlytaking you somewhere else," he said. "It's all these m aladjusted teenagerswho as- landmarks you recognize. It's pire to delinquency with "Bea- like work all over again." vis and Butt-head," later co-creOthers were wary of the bad ated "King of the Hill," about a vibes the show could give to Texas propane salesman and the rest of the world. "I've worked in the industry his wacky neighbors, and the 1999 film"Office Space," which for 20 years, and I like to see follows a technology worker more of the positive stories who schemes to get himself told about why it's a good cafired from a ho-hum job and reer to have," said Adam Nash, winds up gettingpromoted. CEO of personal finance softFor "Silicon Valley," Judge ware maker Wealthfront Inc. drew on his own experiences "As funny or entertaining as living in East Palo Alto and the show might be, it might Sunnyvale in the late 1980s continue the trend of making when he worked at technology it look unappealing to work in high-technology jobs." companies, he said. "It wasn't a great experience Nash was probably disfor me, but I got a lot of come- appointed. The hypocrisy of dy material out of it for later," technology companies purJudge said. porting to improve people's Judge and c o llaborator lives, while making billions of Alec Berg, whose writing dollars monetizing their inforand producing credits include mation or selling them gadgets "Seinfeld" and "Late Night was a recurring joke in"Silicon With Conan O'Brien," also Valley's" first episode.

TV TODAY 8:30 p.m. on 6 8, "Parks and Recreation" — Leslie and Andy (Amy Poehler, Chris Pratt) battle the flu while trying to book performers for the Unity Concert in this new episode. Tom (Aziz Ansari) attends a wine competition hoping to find a sommelier for his restaurant. Ben (Adam Scott) asks Ron (Nick Offerman) to help him with a personal matter. Jim O'Heir also stars in "Flu Season 2." 8:31 p.m. on 6, "The Millers" — Nathan (Will Arnett) is dating Carol's (Margo Martindale) dentist, but he has to keepthe relationship secret from her. The dentist charged Carol an extra fee for being late to an appointment and landed on the family blacklist. Tom (Beau Bridges) tries to figure out why he keepswaking up with gum in his hair in the new episode "Cancellation Fee."

9 p.m. on (CW), "Reign"Mary (Adelaide Kane) finds out that there's a secret clause in her marriage contract thanks to her mother, Marie de Guise (Amy Brennan), and QueenCatherine

(Megan Follows). She andFrancis (Toby Regbo) hatch a plan to turn all of Scotland against Marie. Alan Van Sprang and Torrance Coombs also star in the new episode "Liege Lord." 9 p.m.on FX,"SaintGeorge"Alma (Olga Merediz) takes afall,

and George(GeorgeLopez)gets to care for herassherecovers from her injuries. She's difficult on her best days, so it goes without saying that she's not going to be a model patient. Diana Maria Riva, Kaden Gibson andDanny Trejo also star in the newepisode "Carry On Wayward Son." 10 p.m. on 58, "Parenthood"

—Crosby(DaxShepard) asks Joel (SamJaeger) for helpwith a housing dilemma. Julia (Erika Christensen) steels herself for a much-needed talk with Sarah (Lauren Graham). After getting

some badnews, Kristina (Monica

Independentwomancan't be intimate Dear Abby: I'm a 27-year-old know if I'll be this way forever or woman who has never had a boy- get more comfortable the more I friend or been kissed. I was never knowhim. I'm afraid Brian — and most interested in romance or having a

reception. I have worked at my job for a year, and I haven't always been treated well by a few co-workers. I

men — won't be willing to wait that

am reluctant to invite these people

significant other. I felt strong be-

ing independent and taking care long. I'm afraid if I don't move faster I'll lose a great guy of myself. Now that I have a degree, a caand never get anothreer and a house, I er chance. What do DEAR feel ready to try to let you think? ABBY — Blocked in Boise a man into my life. I met a really nice Dear Blocked: Beguy a month ago. i ng i n t imate w i t h "Brian" and I have gone out sever-

becauseI' m worried about the repercussions if I do. I know they will judge every aspect, because they did it to another co-worker. I like a few of the people I work with, but I don't know if I can invite

only them. What do I do? — Wedding Planner in Omaha

Dear Wedding Planner: What al times and have a lot in common. you'll lose him or it will be your you do is invite only those people He's a gentleman, and he says he's last chance is the wrong reason. I you truly want to attend your wedwilling to wait for me. think that the sooner you talk with ding. It's not necessary to apoloI have been having a difficult a licensed therapist about your life- gize for it or to explain why. If you time letting myself be physical long shyness and discomfort, the are put on the spot and feel you with him. Even hugging is uncom- quicker you can understand the must give a reason, say that your fortable for me. I know it's because reasons for it and overcome it. Your guest list is limited because of fiIhave been a shy loner my whole doctor should be able to refer you to nancial constraints. It's far more life and I'm unaccustomed to being someone. If Brian is the right man tactful than saying they are being close to people. for you, he will stand by you. But excluded because they are rude, Even though Brian says he'll be if he doesn't, you'll be able to more awful people, and you don't want patient, I can sense his frustration. easily relate to someone else. them anywhere near you on such Physical closeness should come Dear Abby: I am planning my an important occasion. easily if you like and are attracted wedding in the fall. My fiance and — Write to Dear Abbyat dearabbycom to someone. I feel abnormal. I don't I are paying for the wedding and or P.o. Box 69440, LosAngeles, CA90069

HAPPY BIRTHDAYFOR THURSDAY, APRIL10, 2014: This year you make waves because of your ability to brainstorm and find answers. This quality will be emphasized even more come summertime. To others, it seems as though you don't believe in the word "no." If you are single, you enter one of the most romantic periods of your life from July on. Stars show the kind You could meet of day you'll have someone who ** * * * D ynamic fulfills many of ** * * Positive yo u r fantasies. If ** * Average you are attached, ** So-so you can be found * Difficult happilytogether at home this spring. You are likely to plan a special vacation or fulfill an important mutual goal this summer. VIRGOcan be very fussy and detail-oriented.

ARIES (March 21-April 19)

** * * * You refuse to accept "no" as an answer right now. You will find a way of using a problem to pave your way to a goal. What seems to be an obstacle will vanish given creative brainstorming. Tonight: Make sure to get some exercise.

TAURUS (April 20-May 20) ** * You might not want to budge in the morning or even in the afternoon. If you can, take a day off or try to work from home.Make itOKto extendyourweekend once in a while. You will come back feeling much more refreshed. Tonight: Head out for a walk.

GEMINI (May 21-June20) ** * * L ook at the long-term implications of someone's resistance at work. The problem could be bigger for this person than for you. In the afternoon,

someone because you're afraid

SCORPIO (Oct. 23-Nov. 21)

YOUR HOROSCOPE By Jacqueline Bigar

you might want to check on a real estate investment or the possibility of a change around your home. Tonight: Be a couch potato.

CANCER (June21-July 22) ** * * Be aware of your finances, and make a decision thatallows greater flow for you. This ease might come from saying "no" to some risk-taking or overindulgence. Postpone a talk until late afternoon or tomorrow if you can. Tonight: Go hang out with a friend.

LEO (July 23-Aug. 22) ** * * You'll enter any situation with a positive attitude, despite the fact that a personal matter might weigh you down. You know that the issue will resolve itself given some time. Resist pushing, and let it go for now. Tonight: Spruce up your wardrobe.

VIRGO (Aug. 23-Sept. 22) ** * You will feel as if you are on hold most of the day. You might wonder what would be the best way to proceed with a

key project. You'll sense aloosening up-

if not today, in the near future. You could be a lot tenser than you realize. Tonight: Leave today behind you.

LIBRA (Sept. 23-Oct. 22) ** * * A meeting or discussion could color your thinking. You might be replaying certain situations in your head. Aim for whatyou want, and worry less about what others think. A financial matter seems to pull your purse strings too tight. Tonight: Get some extra R and R.

** * A boss might be more pleased with your performance than you realize. You could be unusually concerned or worried. Perhaps you are not aware of the image you are projecting of yourself. Try to loosen up a little; you want to be approachable. Tonight: Only what you want.

SAGITTARIUS (Nov. 22-Dec. 21) ** * * Take a broad look at some information that is coming down the pike. If you feel as if something is off or that facts are being withheld, do a little personal research. Before you take a stand, carefully review everything you have discovered. Tonight: Out till the wee hours.

GAPRICORN (Dec. 22-Jan. 19) ** * * You can't control someone else's decisions; however, you can separate yourself from this person if his or her actions have financial implications. Make a decision for your security in the long run. Expect some upset over this matter. Tonight: Detach and relax.

AQUARIUS (Jan. 20-Feb.18) ** * * You might feel weighed down by a work-related matter and want to have a discussion with a loved one immediately! Explain your predicament, and emphasize the importance of having this conversation. Tonight: Schedule some quiet time with your sweetie.

PISCES (Feb.19-March 20) ** * * You'll dive headfirst into a project with the ability to complete it within a certain time frame. Someone at a distance seems to be unavailable to you. Do not reach out to this person right now, as his or her behavior points to a desire for space. Tonight: Accept an invitation. © King Features Syndicate

MOVIE TIMESTODAY • There may be an additional fee for 3-0and IMAXmovies. • Movie times are subject to change after press time. I

I I

Regal Old Mill Stadium16 & IMAX, 680S.W. Powerhouse Drive, 800-326-3264 • 300: RISE OF ANEMPIRE (R) 3:30 • 300: RISE OF ANEMPIRE 3-0 (R) 12:35, 6:45 • 8AD WORDS (R) 1:35, 3:55, 7:30, 9:50 • CAPTAIN AMERICA: THEWINTERSOLDIER (PG-13) Noon, 3:15, 4:15, 6:30, 9:50,10:10 • CAPTAIN AMERICA: THEWINTERSOLDIER 3-0 (PG-13) 1, 7:45 • CAPTAINAMERICA: THE W INTER SOLDIER IMAX3-0 (PG-13) 12:30, 3:45, 7,10:05 • DIVERGENT (PG-13) 12:15, 3:40, 6:55, IO:05 • DRAFT DAY (PG-13) 8, 9, 10 • GOD'S NOT DEAD(PG) 12:10, 3, 6:05 • THE GRAND BUDAPESTHOTEL(R) 11:45 a.m., 2:45, 6, 9 • THE LEGOMOVIE (PG)12:40,3:25,6:40 • THE MONUMENTS MEN(PG-13) 12:55, 7:10 • MR. PEABODY 8 SHERMAN (PG)12:20,3:10,6:25 • MUPPETS MOSTWANTED (PG)1:20,4:35 • NEED FOR SPEED(PG-13) 3:50 • NFINITYCHAMPIONS LEAGUE CHEERLEADING EVENT (no MPAArating) 7:30 • NOAH (PG-13) 11:50a.m.,12:50, 2:55, 4:05, 7:15 • NON-STOP (PG-13) 1:45, 4:45 • OCULUS (R) 10 • RI02(G) 9,10 • RI023-0 (G) 8 • SABOTAGE (R) 1:10,4:25, 7:35, 10:15 • Accessibilitydevices areavailable for some movies. i

Potter) throws herself into the battle for the charter school, while

Hank (RayRomano)helpsAmber (Mae Whitman) deal with some disturbing news of her own in the new episode "I'm Still Here." 10 p.m. on HIST, "Vikings"Ragnar and King Horik (Travis Fimmel, Donal Logue) agree that Jarl Borg (Thorbjorn Harr) must be brought to justice. They just can't agree how. King Aelle (Ivan Kaye) arrives in Wessex, and Ecbert(Linus Roache) considers a new alliance. © zap2it

REDMOND OW

gREATS 711 SW10th• Redmond• (S41) 548-8616 www.redmondwindowtreats.com

EVERGREEN

In-Home cata servlces Care for loved ones. Comfort forall. 541-3894i006

McMenamins OldSt. Francis School, 700 N.W.Bond St., 541-330-8562 • HER(R) 9 • JACK RYAN:SHADOW RECRUIT(PG-13)6 • After7 p.m., shows a/e2f and older only. Younger than 21 may attend screenings before 7p.m.ifaccompanied by a legal guardian.

www.evergreeniabome.com

Tin Pan Theater, 869 N.W.Tin PanAlley, 541-241-2271 • THE ROCKET (no MPAArating) 6 • TIM'8 VERMEER (PG-13) 8:30 I

TOUCHMARK

SINCE 19SO

RedmondCinemas,1535S.W.Odem MedoRoad,541-548-8777 • CAPTAIN AMERICA: THEWINTERSOLDIER (PG-13) 3:45, 6:45 • DIVERGENT (PG-13) 4:15, 7:15 • MUPPETS MOSTWANTED (PG)4:15,6:45 • NOAH (PG-13) 4:30, 7:30

•J

•

Purc 6mrt.6 Ca Sisters Movie House,720 DesperadoCourt, 541-549-8800 • CAPTAIN AMERICA: THEWINTERSOLDIER (PG-13) 6:15 • DIVERGENT (PG-13) 6 • MUPPETS MOSTWANTED (PG)6:30 • NOAH (PG-13) 6

>j B~ dU Bend Redmond

John Day Madras Cinema 5,1101 S.W. U.S. Highway97,541-475-3505 • CAPTAIN AMERICA: THEWINTERSOLDIER (PG-13) 6:20, 7 • CAPTAIN AMERICA: THEWINTERSOLDIER 3-0 (PG-13) 4:05 • DIVERGENT (PG-13) 3:40, 6:40 • GOD'SNOT DEAD (PG)4:35 • MUPPETS MOST WANTED (PG) 4 • NOAH (PG-13) 3:30, 6:30 • SABOTAGE (R) 7:10 •

Burns Lakeview

La Pine 541.382.6447

bendurology.com

•

Pine Theater, 214 N.MainSt., 541-416-1014 • CAPTAIN AMERICA: THEWINTER SOLDIER(PG-13) 6:15 • NOAH (Upstairs — PG-13) 6:30 • Theupstairsscreening room has limitedaccessibility.

4eaaa ~

30" Ran g e

"."l349

¹ACR3130BAWLarge oven, spillssvartop

Find a week'sworth of movie times plus film reviews in Friday's 0 GO! Magazine

•

HNsobif TV.APPLIANCE

De THE BULLETIN • THURSDAY, APRIL 10, 2014

BII n e w . • • BII

A l auc ion

l o c a l .. . BUV BELOW RETAIL!

i d d ing closes uesda , A r i l 1 a 8 p . m .

«I

YOU CAN BID ON:

~' ggf

sk l es

YOU CAN BID ON:

$17SAIC Service

Partial Denture

Non-Surgical Eye Lift

RETAIL VALLIE:$175

RETAIL VALUE: $500

FROM:

Advanced Auto Repair

Changing Smiles

)urrlP

Come downand pre-qualify for financing at All Seasons RV 8 Marine. Taxes, title anddocfees additional.

FROM:

All Seasons RV& Marine

YOU CAN BID ON:

Two Night Stay in a Restless Waters Room

Installation

$100 Gift Certificate Toward

Package

RETAIL VALUE: $150

RETAIL VALUE: $550 FROM:

FROM:

Overleaf Lodge

Solar Light

FROM:

Exhale Spaand Laser Center

tf gourse NeH cA+

vn shoP-"- 541.548-819' ~gggnt-

YOU CAN BID ON:

RETAIL VALUE:$10,995

Truck Camper 9' 6" for a longbed. Includes electric jacks, fiberglass construction, sleeps 4,wet bath.

YOU CAN BID ON: 2001 Gench Citation Truck Camper

YOU CAN BID ON:

10 Classes of

YOU CAN BID ON:

"lyengar Yoga"

10 Rounds of Quality BenchMaster Golf Punch Card Stress-FreeChair

RETAIL VALLIE: $110

RETAIL VALUE:$400

RETAIL VALUE:$399.60

FROM:

lyengar Yoga

Juniper Golf

M. Jacobs Fine Furniture

4 I

any Repair

RETAIL VALUE:$100 FROM:

The iPhoneGuy

ref 4

-h ,I

YOU CAN BID ON:

Combination Sandwich 8 Salad Tray

YOU CAN BID ON:

Top Pin Archery

$25 TowardWaxing Service ofYourChoice

RETAIL VALLIE:$80

RETAIL VALLIE: $25 FROM:

FROM:

Totally Polished Nail & Skin Studio

RETAIL VALUE: $65 FROM:

Togo's

Top Pin Archery

YOU CAN BID ON: Lot 22 at Yarrow in Madras *

RETAIL VALLIE:$23,000 ( *60%Reserve)

FROM:

Sun Forest Construction

A tremendousvalue, lot 22 at Yarrow in Madras has unobstructed views to theNorthwest, West toward the mountains andcity lights as well as to the South.Yarrow is abeautiful planned community created byBrooks ResourcesCorporation. Visit www.yarrowliving.com to learn more about thecommunity, the neighborhood association, CC8Rs,HOAsetc. This homesite would be agreat"hold as aninvestment", or build right away totakeadvantage of current building costs. Call Jeff Jernstedt at SunForest Construction at 541-385-8522 for details.

0 •

R-'" Q

R Q

ON PAGES 3&4: COMICS & PUZZLES M The Bulletin

Create or find Classifieds at www.bendbulletin.com THE BULLETIN • THURSDAY, APRIL 10, 2014 • •

•

•i•

• J

4g1» • 'I

'Iht, s

enlen ge'» „,

hours:

Place an ad: 541-385-5809

Fax an ad: 541-322-7253

Business hours:

Place an ad with the help of a Bulletin Classified representative between the

Includeyour name, phone number and address

Monday - Friday

businesshours of8 a.m. and 5 p.m.

Subscriber services: 541-385-5800

7:30 a.m. - 5 p.m.

Classified telephone hours:

Subscribe or manage your subscription

Monday - Friday 7:30 a.m. - 5 p.m.

24-hour message line: 541-383-2371 Place, cancel or extend an ad

TP e

On the web at: www.bendbulletin.com

Q u l l e t i n : g

00 202

Want to Buy or Rent CASH for dressers, dead washers/dryers 541-420-5640

Wanted: $Cash paid for vintage costume jewelry. Top dollar paid for Gold/Sifver.l buy by the Estate, Honest Artist

t yg ~

W .

208

Pets & Supplies

Pets 8 Supplies

Pets & Supplies

O tt ~ y

tg r

210

Furniture 8 Appliances

Adopt a rescued cat or Bow front fish tank, 42" G ENERATE SOM E The Bulletin recomteen kitten! F ixed, w/ stand, pump & EXCITEMENT in your mends extra caution shots, ID chip, tested, heater, $250 o b o. neighborhood! Plan a when purc h as- more! 65480 7 8 th, 541-408-0846 garage sale and don't ing products or serTumalo, T h urs/Sat/ Boxer/French Mastiff forget to advertise in vices from out of the Sun 1-5 , 3 8 9-8420 "Hooch"mix,2 males, classified! area. Sending cash, www.craftcats.org 541-385-5809. 9 wks, shots, wormer, checks, or credit indewclaws 8 docked tails, f ormation may b e African gray red-tail par- $500. 541-419-0149 subjected to fraud. rot, very t a lkative,Chihuahua puppies, very For more i nformahuge cage intion about an adver- $500, cluded. 541-279-6459 tiny, 1 male, 1 female, $250. 541-420-1068 tiser, you may call the O regon State Corgi pups, 6 wks, $300. Hassock (or ottoman) Aussie Mini puppies, 5 Attorney General's purebred, born 3/13/14, 541-420-8621, or leave about 17 t/6" tall and Office C o n sumer 5/8. 541-693-4888 msg at 541-447-3985. 34t/e" in diameter, in Protection hotline at ready www.miniaussiesbend.com good cond. $35 obo. 1-877-877-9392. 541-419-6408

The Bulletin

Just bought a new boat? Sell your old one in the classifieds! Ask about our Super Seller rates! 541-385-5809

** FREE ** Garage Sale Kit

Place an ad in The Bulletin for your garage sale and receive a Garage Sale Kit FREE! KIT INCLUDES:

• 4 Garage Sale Signs • $2.00 Off Coupon To Use Toward Your Next Ad • 10 Tips For "Garage Sale Success!"

• Be n

d • O r e gg n

Multi-family Yard Sale-

Fri-Sat-Sun, 4/11-13. 8-4 72 SE 15th. Household, furniture, motor bikes, kids stuff & clothing.

253

259

260

TV, Stereo & Video

Memberships

Misc. Items

Bid Now!

How to avoidscam and fraudattempts

Bid Now!

www.aulletinaidn6uy.com

Buy New...Buy Local

You Can Bid On: Widgi Golf Pass Retail Value $79 Mfidgi Creek Golf Club (Bidding closes Tues., April 15, at 8:00 p.m.)

MusicNoice Studio Includes: • Pro Tools 8 software • Mbox 2 mini version 8.0 • Behringer B1 mic • Sony headphones • Samson USB studio mic w/stand; • Training books • Corrugated foam padding Packaqe price new, $01200+-

Offered at $550. (All reasonableoffers considered) Call 541-639-3222

290

Sales Redmond Area 4th Annual Cystic Fibrosis Fundraising Yard Sale, Fri. 8-4 8 Sat. 9-2. 611 NW 35th MOVING SALE 57- Yr. Accumulation!

255

T HE B U LLETIN

on the first day it runs to make sure it is correct. "Spellcheck" and human errors do occur. If this happens to

your ad, please contact us ASAP so that

corrections and any adjustments can be made to your ad. 541-385-5809 The Bulletin Classified

in good condition. These chairs sold new for $700 each. Selling all four for only $500!

246

Guns, Hunting & Fishing

541-419-8035

& up. 541-280-1537

www.rightwayranch.wor Very nice L-shaped desk w/hutch, bookcase & file dpress.com cabinet, brown leather 210 chair, $300 for all. In Furniture & Appliances Redmond, 541-504-2428

CASH!! For Guns, Ammo 8 Reloading Supplies. 541-408-6900.

Beautiful antique furNeed to get an niture pcs, a ntique 3-pc display cabinet/curio IOI'INIISTJHH china & g l assware, w/lightsl glass shelves, ad in ASAP? 282 crystal, silver, cos- faux finish (looks like You can place it 1777 SW Chandler DO YOU HAVE Sales Northwest Bend Ave., tume jewelry, vintage stone), end sections 70" Bend, OR 97702 online at: linens, k itchenware, tall, middle section 80" SOMETHING TO tall; 72" width. $450 obo. SELL NW 4-family sale Sat. The Bulletin lots of knick-knacks & www.bendbulletin.com serving central oregonsince iggs 8-1, 137 NW Outlook decor, Roseville pot- 541-330-8177 after 11 am FOR $500 OR LESS? Vista off Mt. Washingtery, nice a r twork, 541-385-5809 A1 Washers8 Dryers Non-commercial round oak dining set, ton, tons of items. $150 ea. Full waradvertisers may living room & b edyard sale! room furn., Samack ranty. Free Del. Also The Bulletin place an ad Saturday only, 9-2 NRS Multi-family Adoption f u ndraiser! wanted, used W/D's recommends extra ' with our raft frame, drybox, oars. piano, books, tools, Clothing, fu r n iture, 541-280-7355 "QUICK CASH Misc household items, i caution when purg uns, garage a nd sports items, books, antiques, outdoor stuff, chasing products or • SPECIAL" outdoor, two cement m ovies, & more ! benches, loads misc! Bid Now! etc. 1426 NW Portland services from out of I 1 week3lines 12 L emonade stand 8 www auaetinaidnauy com oi' 8 the area. Sending 8 Fri.-Sat., 9-4 • cash, checks, or • Yard Sale Fri & Sat, 8-4, treats! Saturday 4/12, numbers Fri. 8 a.m. ~gweeks 2N 2805 NE Butcher Ln. 1630 NW 11th. Outdoor Ad must i credit i n f ormation Take Highland to Bend, 8 a.m.-4 p.m. furn, antiques, clothes, may be subjected to include price of Helmholtz (Reindeer pottery, linens, etc. gn le sem oi ssao i FRAUD. For more Ranch) south. to Ob~ information about an 8 or less, or multiple sidian to 5665 Pat Farris advertiser, you mayi items whose total For more info go to Buy New...Buy Local $ call th e Or e gon $ does not exceed MOVING SALE www.atticestatesanYou Can Bid On: ' State Atto r ney ' $500. dappraisals.com $2,000 Gift 17545 Cascade Estate Drive i General's O f f i ce 541-350-6822 Certificate Consumer Protec- • Call Classifieds at Friday April 11 • Saturday April 12 541-385-5809 Estate Clean-out Sale! Retail Value $2,000 tion h o t line a t i 9 a.m. to 5 p.m. fl/f. Jacobs Fine www.bendbulletin.com April 10-11-12. 1000s of i 1-877-877-9392. Furniture (Take Hwy 20 west towards Sisters) From Robal table items I $1 each. Road stoplight, go approx. 12.3 miles, turn right Collectibles, antiques & (Bidding closes Tues., > TheBulletin > serving ceniwf oregonsince lggs April 15, on Cascade Estates Drive - follow right to sale) furniture. Thurs 9-5; FriPrivate party wants to Crowd control admittance numbers issued at at 8:00 p.m.) 8-5; Sat. only, $5 box buy WWII 1911 pistol, 8:00a.m. Sale opens at9:00 a.m . sale, 8-5. 4780 NE 21st S&W Victory, M1 car212 Lovely glass topped dining table and six chairs; Sat. 9-4pm, bike, skis, • Chandelier, bine. 541-389-9836 Antiques & Two love seats and matching chair all in very 22" diameter x 17" pottery. 323 NW 27th Collectibles dark upholstery; Large pole lamp extension high, 12 lights, Wanted: Collector seeks St., Redmond, (Fieldpoles; Side by Side refrigerator; Washer and bronze 8 crystal, high quality fishing items stone Crossing). Dryer; Eureka vacuum; Dinette Table and four 2 - d rawer 8 upscale bamboo fly has 6 arms (2 lights Dark oa k chairs; Love seat recliners: Sofa with two reclindresser, curved front, rods. Call 541-678-5753, 292 on each arm), ers; Large sheep wool wall hanging rug: Older TV $250. White wicker or 503-351-2746 $300 obo. and stereo sets: Queen size black lacquer bed ~ Sales Other Areas baby crib, u n ique 541-923-7491 set; King size mattress; King size waterbed $250. Large dark oak 248 Moving Sale, Fri-Sun, frame; Luggage; Lamps and pictures; African Art; 9am, sli p -covered roll top desk, $800. 780 S Redwood, Couch Health & Wicker giraffe; Lots of Linens; Tools and rolla- Sisters. Surveryor's tr a nsit furni- $125; black k itchen way tools chest; An entire cottage of craft items; ture, bedFreezer, Beauty Items set, swing, & table w/4 chairs 8 leaf, 1930-1940, orig. box Full Pheasant skins and feathers; Leather pieces; C ASH more! 503-701-3840 $150; 2 bikes $35 ea. $350. Lots of other feathers; gourds; paints; Wreaths; 541-923-5960 (239) 877-1550 beads; Dream catchers; Syracuse China set MOVING SALE Bid Now! The Bulletin reserves www.aulletinaidnauy.com "Evening Star" Pattern; Wood desk; metal com- Furniture & household the right to publish all uter desk; Lots of outdoor furniture; and yard art; Sat., 9am-1pm. 66150 Dining table ads from The Bulletin hite cabinets; Wood tool bench units; Clothing Becker Rd, Tumalo. Beautiful round and purses and shoes; Lots of Linens; Small newspaper onto The oak pedestal table NOTICE Bulletin Internet webUtility trailer; Lrg 8' tall heater; Lawn swing & pawith 4 matching Remember to remove tio set; decor items; 100s of clear glass piecessite. chairs, table is 42" she made items from glass; Weight bench; Ex- your Garage Sale signs in diameter and in tension ladder; small compressor; Chimnea; (nails, staples, etc.) The Bulletin Buy New...Buy Local brand new condiswwwgcentral oreggn sincesgeg some firewood; set of 4 tires; New arrowheads; after your Sale event You Can Bid On: tion, as are the costume jewelry; Apache tears; 1970 Schwinn is over! THANKS! 242 $250 Gift Card chairs. Priced at suburban mens bike; Lots of kitchen items; ElecFrom The Bulletin Retail Value $250 $300. 541-447-3342 Exercise Equipment trical appliance; and lots more!!! Parking is and your local utility ExhaleSpa and crowdedplease be cautious!!!! companies. LaserCenter Handled by: Dining table, glass & A e r O P i l ateS (Bidding closes Deedy's Estate Sales Co. The Bulletin brass, glass pedestal, machine w/ pull up bar, Tues., April 15, serwngcentral oregon slncguiu 60"x40". $450 obo. Call r e b ounder & 3 DVDs 541-419-4742 days • 541-382-5950 eves at 8:00 p.m.) www.deeedysestatesales. com www.bendbulletin.com 541-330-8177 after 11am $150. 541-504-5982 PICK UP YOUR GARAGE SALE KIT at

i i

requires computer advertisers with multiple ad schedules or those selling multiple systems/ software, to disclose the name of the business or the term "dealer" in their ads. Private party advertisers are defined as those who sell one computer.

257 Check out the classifieds online Illlusical Instruments www.bendbulletin.com Updated daily

Theater room seating

245

Computers

541-389-8420.

www.craftcats.org German Shepherds www.sherman-ranch.us $1700+ 541-281-6829 POODLE pups,toys or sml mini. also 'rescued pup'. 541-475-3889 Queensland Heelers Standard 8 Mini, $150

9j g

Golf Equipment

CHECKYOUR AD

Aussie, Mini/Toy pup, tri-color, first shot, $320 Dachshund, mini male, Elizabeth,541-633-7006 cash. 541-678-7599 9 weeks, pick of the litter, $275. 541-447-4490 LEATHER CHAIR Powell Butte Espresso brown Donate deposit bottles/ in very good condicans to local all vol., tion, less than 2 non-profit rescue, for years old. $250. feral cat spay/neuter. In SE Bend Cans for Cats trailer at 541-508-8784 Bend Pet Express E; or donate M-F at Smith Sign, 1515 NE 2nd; or at CRAFT, Tumalo. 280 286 288 Call for us to pick up Estate Sales Sales Northeast Bend Sales Southeast Bend large quan t ites,

Estate/Garage sale Fri. Sat. Sun. 9-6. Hwy 97 So.m of La Pine, to Hackett to Snuffy. Old glassware, jewelry, records, hardback and paperback books, like new Danner boots sz 15, new $ 300, sell $100. Canning, pressure cooker, Swing set, camping, misc.

A v e .

Beautiful Lowrey Adventurer II Organ Absolutely perfect condition, not a scratch on it, about 4-feet wide, does everything! Includes a nice bench, too. $1600 obo. 541-385-5685

www.6uaetin6idnsuy.com

I i

Buy New...Buy Local

You Can Bid On: One Year Couples Non-Tennis Membership Retail Value $1,836. Athletic Club of Bend (Bidding closes Tues., April 15, at 8:00 p.m.) 260

Misc. Items

Bulletin 2012 Sim p licity The servingcenrtal oregon since iggs Gusto Hepa canister v acuum with Office File cabinet 4-drawer, qray, $1 50 attachments, extra filter and bags, exc. obo 541-388-0865 cond. Retail $1500, Wantedpaying cash A sking $700 . for Hi-fi audio & stu971-221-8278 (cell) dio equip. Mclntosh, JBL, Marantz, D y naco, Heathkit, SanGood classified adstell sui, Carver, NAD, etc. the essential facts in an Call 541-261-1808 interesting Manner. Write from the readers view -not WHEN YOU SEE THIS the seller's. Convert the facts into benefits. Show the reader howthe item will help them insomeway. On a classified ad This go to advertising tip www.bendbulletin.com brought toyouby to view additional photos of the item.

gfoag

MorePixatBendbjjlletin.com

The Bulletin

serving central oregonsince iggs

Bid Now!

a ROW I N G with an ad in The Bulletin's "Call A Service Professional" Directory

You Can Bid On: $1000 Floonng Voucher Retail Value $1000. Interior Ideas NM/Redmond (Bidding closes Tues., April 15, at 8:00 p.m.)

Bid Now!

www.auaetinaidnauy.com u s•

DRUM SETS:

Ludwig drum set, d rums only, n o hardware, 26" base drum, 13", 16", and 18" toms, 14" snare, $500. REMO Master Touch drum set, drums o nl y no hardware, 22" base

261

Medical Equipment

www 6uaetin6idnsuy com

Buy New...Buy Local

Get your business

YBe aware of international fraud. Deal locally whenever possible. Y Watch for buyers who offer more than your asking price and who ask to have money wired or handed back to them. Fake cashier checks and money orders are common. u'Nevergive out personal financial information. s/Trust your instincts and be wary of someone using an escrow service or agent to pick up your merchandise.

uw;; Else

Buy New...Buy Local

You Can Bid On: $100 Gift Certificate

Toward any Repair Retail Value $100 The iPhoneGuy (Bidding closes Tues., April 15, at 8:00 p.m.)

Flatscreen Magnifier Optlec Clearview+ viewer, magnifier for reading, writing and viewing for those who have vision loss. $900 obo. (otheritems listed previously havebeen sold) In Bend, call 541-480-6162 Where can you find a helping hand? From contractors to yard care, it's all here in The Bulletin's "Call A Service Professional" Directory 263

Tools

2 workbenches, for garage use, $50 and $85 drum, 8", 10", 12", each. 541-280-4459 1 3", 16" an d t 8L t orns, 14 " s n a re Complete sandblasting ouffit, $75. drum, $800. Both in Budweiser Millenium edi541-280-4459 excellent condition. tion, 4 12-oz glass, 46 oz 541-410-4983 bottle, $20. 541-420-9136 265

258

Travel/Tickets

Bid Now!

www.sulletinaidnauy.com

Buylng Dlamonds /Gold for Cash Saxon's Fine Jewelers 541-389-6655

BUYING Lionel/American Flyer trains, accessories. 541-408-2191. BUYING &

Buy New...suy Local

You Can Bid On: Two Night Stay in a Restless Waters Room Retail Value $550 Overleaf LodgeYachafs,Oregon (Bidding closes Tues., April 15, at 8:00 p.m.)

Building Materials REDMOND Habitat RESTORE

Building Supply Resale Quality at LOW PRICES 1242 S. Hwy 97 541-548-1406

Open to the public.

SE LLING

All gold jewelry, silver Garage Sales and gold coins, bars, rounds, wedding sets, Garage Sales class rings, sterling silver, coin collect, vin- Garage Sales tage watches, dental gold. Bill Fl e ming, Find them 541-382-9419. in FAST TREES The Bulletin Grow 6-10 feet yearly! Classifieds $16-$21 delivered. www.fasttrees.com 541-385-5809 or 509-447-4181

E2 THURSDAY, APRIL 10, 2014 • THE BULLETIN

TO PLACE AN AD CALL CLASSIFIED• 541-385-5809

541-385-5809 or go to www.bendbulletin.com

AD PLACEMENT DEADLINES Monday • • • • • • • 5:00 pm Fri • Tuesday.••• • • • .Noon Mon. Wednesday •• • • • • • • • • • • • • • • • • Noon Tues. Thursday • • •• • • • • • • • • • • • • • • • • Noon Wed. Friday. • • • • • • • • • • • • • • • • • • • • • Noon Thurs. Saturday Real Estate.. . . . . . . . . . 1 1 :00 am Fri.

Saturday • • • Sunday. • • • • PRIVATE PARTY RATES Starting at 3 lines

• . 3:00pm Fri. • • 5:00 pm Fri • Place aphotoin yourprivate party ad foronly$15.00par week.

*UNDER '500in total merchandise

OVER '500 in total merchandise

7 days.................................................. $10.00 14 days................................................ $16.00

Garage Sale Special

4 days.................................................. $18.50 7 days.................................................. $24.00 14 days .................................................$33.50 28 days .................................................$61.50

4 lines for 4 days ................................. $20.00

(call for commercial line ad rates)

*illlust state prices in ad

A Payment Drop Box is available at CLASSIFIED OFFICE HOURS: Bend City Hall. CLASSIFICATIONS MON.-FRI. 7:30 a.m.- 5:00 p.m. BELOW M A R K E D W ITH AN (*) REQUIRE PREPAYMENT as well as any out-of-area ads. The Bulletin The Bulletin bendbulletimcom reserves the right to reject any ad at any time. is located at: 1777 S.W. Chandler Ave. Bend, Oregon 97702

PLEASE NOTE: Checkyour ad for accuracy the first day it appears. Please call us immediately if a correction is needed. We will gladly accept responsibility for one incorrect insertion. The publisher reserves the right to accept or reject any ad at anytime, classify and index any advertising based on the policies of these newspapers. The publisher shall not be liable for any advertisement omitted for any reason. Private Party Classified ads running 7 or moredays will publish in the Central OregonMarketplace each Tuesday. 267

Fuel & Wood

269

Gardening Supplies • & Equipment

476

Employment Opportunities

Caregivers Log Truck Needed - S panish Drivers speakers, E s t ab(Long & Short) for lished, c o ntracted logging company in-home care in Florence, OR. agency is looking for Spanish speaking Experience caregivers. No exrequired, CDL, perience required. current medical Must posses the card. Great pay following: and benefits. 1. 18 years of age or older. Year-round, 2. Must pass a long-term criminal background employment. check. Caii 3. Have a valid ODL 541-997-8212 and insurance. 4. High school diploma or GED. Call Kim Mon.-Fri., Want to impress the 9am-3pm at relatives? Remodel 541-923-4041. Advancement your home with the opportunity. Great help of a professional work environment. from The Bulletin's Se habla espanol. "Call A Service Professional" Directory Take care of your investments with the help from The Bulletin's "Call A Service Professional" Directory

THKIIE $

Concrete Finishers Wanted! Roger L a ngeliers Const. Co is looking for experienced cement finishers. Full benefit p a c kage, EOE. We E-Verify, d rug screen r e quired. A pplicants may come bythe office at 62880 Mercury Place to fill out an application, or call Steve 541-318-6200, or 541-948-0829

270

Lo s t& Found

DRIVER

® l3z@zm

Sales - Retail Immediate Opening for motivated self starter, experience helpful but not required. Apply in person only at Furniture Outlet, 1735 NE Hwy 20, Bend.

<© suaaau

528

Loans& Mortgages

Loans & Mortgages BANK TURNED YOU DOWN? Private party will loan on real estate equity. Credit, no problem, good equity is all you need. Call Oregon Land Mortgage 541-388-4200. LOCAL iyfONEyrWe buy secured trust deeds& note, some hard money loans. Call Pat Kelley 541-382-3099 ext.13. FIND ITr St!T IT! SELL IT! The Bulletin Classifieds Real estate investor loan needed. Investor will pay 7% on a $40,000 to $60,000 loan secured by First Trust deed. 541-771-4414

WARNING The Bulletin recomSales mends you use cauSales professional to tion when you proJoin Central vide personal Oregon's l a r gest information to companew ca r de a l er nies offering loans or Subaru of B e n d. credit, especially Offering 401k, profit those asking for adsharing, me d ical vance loan fees or plan, split shifts and companies from out of paid vacation. Expestate. If you have rience or will trail. 90 concerns or quesday $1500 guarantions, we suggest you tee. Dress for succonsult your attorney cess to work in our or call CONSUMER d rug f r e e wo r k HOTLINE, Need to get an ad place. Please apply 1-877-877-9392. at 2060 NE Hwy 20, in ASAP? Bend. See Bob or Need help fixing stuff? Devon. Call A Service Professional Fax it to 541-322-7253 find the help you need. What are you www.bendbulletin.com The Bulletin Classifieds looking for? You'll find it in ADMINISTRATIVE ASSISTANT

RESORT

Black Butte Ranch

RmliiCCI

Employment Opportunities

The Bulletin Classifieds

Operations Administrative Assistant Hours: Mon:Fri., 8:00 am-1:30 pm

541-385-5809

Current Job Opportunities!

TELEFUNDRAISING

Food & Beverage • Line Cooks • Servers • Beverage Cart • Bussers • Dishwashers • Barista Server • Catering Servers • Snack shop staff • Grill Cooks

Tele-funding for • Meals On Wheels, •Defeat Diabetes Foundation, ~Veterans (OPVA). Seniors and a/i others we/come. Mon-Thur. 4:30-8:30 p.m. $9.10/hour.

Golf • Assistant Mechanic • Outside services • Greens Keepers

Call 541-382-8672

Maintenance • Grounds Maint. • Admin. Assistant

The Bulletin is seeking an energetic, dynamic individual to fill a vital role within the operations department. The Operations Administrative Assistant provides an administrative link between a number of departments, including Commercial Print, Press, Pre-Press, Mail Room, Digital Imaging, Advertising and Accounting. Responsibilities include ad insert order-entry, collecting production-related data from the above departments, organizing, maintaining and delivering it to the appropriate personnel within the company in a timely fashion. Will work with personnel within The Bulletin as well as with its Commercial Print customers. The ideal candidate will be computer literate, have experience with detailed data entry, outstanding customer service skills, the ability to multi-task, and a desire to work for a successful company. To apply, submit a resume by Friday, April 11, 2014 to The Bulletin, attention: James Baisinger, PO Box 6020, Bend, OR 97708-6020. Pre-employment drug screening is required prior to hinng. The Bulletin is a drug-free workplace and an equal opportunity employer.

CDL Driver The Bulletin National wholesale distributor of waterworks Recreation BarkTurfsoil.com caution when purREMEMBER:If you products in Redmond is • Life Guards chasing products or I have lost an animal, seeking motivated and • Activity Leaders services from out of a don't forget to check hard working part time/ PROMPT DELIVERY l the area. Sending 541-389-9663 The Humane Society seasonal individual with a Rental Operations c ash, checks, o r Bend ood attitude. C andi- •HousekeepingStaff Serving CenrretOregon since r903 476 l credit i n f ormation ate must have good • Night Audit 541-382-3537 communication skills, be Redmond Employment l may be subjected to • Vacation Sales Fornewspaper FRAUD. professional, punctual, a • Guest Services 541-923-0882 Opportunities General delivery, call the For more informa- I self starter, and work as 4' x 4' x 8' Pdne ille The Bulletin Mailroom is hiring for our SaturCirculation Dept. at tion about an adver- • a team player. Primary Spa iSports Shop 541-447-71 78; • Receipts should day night shift and other shifts as needed. We 541-385-5800 iob duties are driving and • Nail Techs / MLT's l tiser, you may call or cralt cate CAUTION: include name, currently have openings all nights of the week, To place an ad, call all warehouse functions. • Sales Associate the Oregon State 541-389-8420. Ads published in phone, price and everyone must work Saturday night. Shifts 541-385-5809 l Attorney General's "Employment O p - Secondary duties i nkind of wood start between 6:00 p.m. and 11:30 p.m. and or email counter sales, an- J oin our team of Office C o n sumer t BULLETINCLASSIFIEDS portunities" include volve purchased. claseified@bendbulletimcom end between2:00 a.m. and 3:30 a.m. Allpophones, and professionals todayProtection hotline at I employee and inde- swering • Firewood ads Search the area's most sitions we are hiring for work Saturday nights. various other d uties. I 1-877-877-9392. "fun" The Bulletin comprehensive listing of pendent positions. Class A CDL is required. We offer a MUST include Starting pay is $9.10 per hour, and we pay a serving central oregonsince ras Ads fo r p o sitions species& cost per classified advertising... Ability to operate a fork- work environment, LThe Bull@in minimum of 3 hours per shift, as some shifts that require a fee or breathtaking views cord to better serve real estate to automotive, are short (11:30 - 1:30). The work consists of lift, climb a ladder, maupfront investment our customers. and excellent seamerchandise to sporting n ipulate t o ol s an d loading inserting machines or stitcher, stack270 goods. Bulletin Classifieds must be stated. With e quipment, lift u p t o sonal b e nefits inTRUCK DRIVER ing product onto pallets, bundling, cleanup Lost & Found any independentjob 100lbs, and type a mini- cluding FREE WANTED appear every day in the and other tasks. For qualifying employees we servlny ceneal oregon slnceser opportunity, please mum of 20 words per GOLF! Must have doubles print or on line. offer benefits i ncluding life i n surance, Found about 2 months i nvestigate tho r endorsement. minute is a must. We are short-term & long-term disability, 401(k), paid Call 541-385-5809 ago, in Tillicum Viloughly. Use extra Visit our website & Local run. looking to fill this position vacation and sick time. Drug test is required All year Dependable lage area, male cat, www.bendbulletin.com c aution when a p- very quickly so please apply online at Truck is parked in prior to employment. Firewood: Seasoned; orange tabby, white www.BlackButteRanch.com plying for jobs onemail your resume to Madras. 541-475-4221 The Bulletin and click on the Lodgepole 1 for $195 paws & chest, rings of servlngcentral oregon s/nce f9te line and never pro- aaron.bondi@fer uaon.com Please submit a completed application atten"Career" Link to or 2 for $365. Cedar, white on tail. Probvide personal infor- if you are interested. The Looking for your next tion Kevin Eldred. Applications are available submit an split, del. Bend: 1 for lems w/ left eye. Call mation to any source Company is an equal opemployee? at The Bulletin front desk (1777 S.W. Chanidentify, $175 or 2 for $325. to you may not have portunity employer as application todayor Place a Bulletin help dler Blvd.), or an electronic application may be 541-420-3484. 541-389-9968. contact Human researched and well as a government wanted ad today and obtained upon request by contacting Kevin Resources at deemed to be repu- contractor that s h a ll reach over 60,000 Eldred via email keldred©bendbulletin.com). Dry, split Juniper, (541) 595-1523 for Lost cat, black/gray tiger table. Use extreme abide by the requirereaders each week. No phone calls please. Only completed appli41 CFR moreinformation. $1 90/cord. Multi-cordstriped, yellow eyes, c aution when r e - ments o f Your classified ad cations will be considered for this position. No discounts, & t/a cords female, 8 lbs., in DRW s ponding to A N Y 60-300.5(a), which prowill also appear on resumes will be accepted. Drug test is reNavaio Rd. area. dis c rimination Black Butte Ranch avail. Immediate deonline employment hibits bendbulletin.com quired prior to employment. EOE. is a Drug-free work livery! 541-408-6193 REWARD. 541-554-6031 ad from out-of-state. against qualified prowhich currently place. EOE We suggest you call tected Veterans and the receives over 1.5 of 41 CFR The Bulletin Lost Maltese, white, the State of Oregon requirements servmg central oreyon sinceaor 325 million page views Pine & Juniper Split female, Gist Rd. area • Consumer Hotline 60-741.5(A), which proevery month at Hay, Grain& Feed hibits dis c rimination on 4/1 541 350 5106 at 1-503-378-4320 SALES no extra cost. qualified indi- Daytime Inside Sales PROMPT DELIVERY For Equal Opportu- against Bulletin Classifieds viduals on the basis of Mixed Grass Hay, 1st Customer Service Representative 54X-389-9663 nity Laws contact Get Results! Just too many Midstate Electric Cooperative, located in La Pine, quality, big bales, 3'x3'xs', Oregon Bureau of disability. Will hire two sales Call 385-5809 Oregon, is seeking a qualified applicant for the barn stored, $230/ton. collectibles? & In d ustry, people to work from or place Patterson Ranch Sisters, Labor osition of customer service representative. Seasoned Pine, (2yrs): FIRE/PARAMEDIC Civil Rights Division, the B e n d Bu l letin your ad on-line at 541-549-3831 ust be a high school graduate or equivalent. LaPine rounds $130/cord; Establishment of 971-673- 0764. Sell them in newspaper office for bendbulletin.com One year of office expenence is required. Must split, $145. Sunriver Employment List for t he Newspaper i n Call The Bulletin At be reliable, motivated, creative, self-starter, The Bulletin Classifieds rounds, $145. Bend split, Firefighter/Paramedic Education sales camThe Bulletin serving cenaaloreyon sinceser team player, goal oriented, personable, well-or541 -385-5809 $165. Redmond rounds, Crook County Fire and paign. This is soft, 541-385-5809 ganized with ability to work under high stress $165. Sisters split, $180. Place Your Ad Or E-Mail Rescue is establishing an relaxed business-to541-385-5809 situations. Must exhibit proven problem-solving 2 cord min. 541-508-3159 employment list for Fire- business sales. We At: www.bendbulletin.com and decision-making skills. Previous public fighter/Paramedic. Indi- offer a s h ort p aid contact experience is preferred. Must have abilviduals who meet the training program. The Tick, Tock ity to establish sound customer relations while minimum qualifications average salesperson working effectively with customers and the pubinvited to apply and Tick, Tock... are lic, and promoting a pleasant working atmotake the examination for earns $400 to $700 sphere among associates. Ability to indepen...don't let time get Firefighter/Paramedic. A per week, for a 2 7 dently estabhsh files and maintain records hour work week. The complete iob description away. Hire a accurately and efficiently. Possess working for Firefighter/Paramedic dress code is very Call5f I 385580f to promoteyour service• Advertise for 28deyt starting at'lfl pta srrttfrctrtrt natsiirbir onourertarl knowledge of personal computer (current verprofessional out is posted on the district's relaxed and casual. sion of MS Office), word processing and website. Th e s a l ary We prefer a b ackof The Bulletin's spreadsheet capabilities. Proficient with 10-key range is from $4,248- ground in "business-to "Call A Service and data entry. Must possess valid Oregon $5,002 per month. Appli- -business" s e l ling. driver's license. Building/Contracting Handyman Landscapingfyard Care cations will be accepted This is not ad or subProfessional" This position is an Hourly/Non-Exempt until Monday, April 14, scription sales, howDirectory today! Bargaining Unit Position — 1BEW Local 125. NOTICE: Oregon state ERIC REEVE HANDY NOTICE: Oregon Land2014. Contact: ever if you have prelaw requires anyone SERVICES. Home & scape Contractors Law Crook County vious experience in Submit resume with a cover letter to: who con t racts for Commercial Repairs, (ORS 671) requires all Add your web address Fire& Rescue advertising sales, I will to your ad and readHuman Resources 4/f 4/201 4 construction work to Carpentry-Painting, businesses that ad500 NE Belknap Street give you priority conMidstate Electric Cooperative, Inc. be licensed with the vertise t o pe r form ers on The Builetin's Prineville, OR Pressure-washing, sideration. I'm looking P 0 Box 127, La Pine OR 97739 Construction ContracLandscape Construc- web site, www.bend97754-1932 Honey Do's. On- time for motivated, enerFax No. 541-536-1423 bulletin.com, will be tors Board (CCB). An tion which includes: (541 ) 447-5011 promise. Senior getic, articulate E-Mail:smiesentNmidstateelectric.coo Thousands of ads dai l y active license deck s , able to click through Discount. Work guar- p lanting, people, with excellent in print and online. means the contractor anteed. 541-389-3361 fences, arbors, automatically to your fireandrescue.com communication skills. NO TELEPHONE CALLS WILL BEACCEPTED. website. is bonded & insured. water-features, and inor 541-771-4463 Call M e l anie at Verify the contractor's stallation, repair of irBonded & Insured 330-605-6767. All resumes must be received by 12:00 noon CCB l i c ense at rigation systems to be ©s Say "goodbuy" CCB¹1 8'I 595 UB A R U. s cs ~ on Monday, April 14, 2014. EEOE www.hirealicensedl icensed w it h th e *This is not an emto that unused contractor.com Landscape Contrac- Auto Sales ployee position with or call 503-378-4621. tors Board. This 4-digit Sales professional to item by placing it in The Bulletin but an The Bulletin recom- USE THE CLASSIFIEDS! number is to be inJoin Central IOII YOUR AD WILL RECEIVE CLOSE To 2,000,000 mends checking with cluded in all adver- Oregon's l a r gest The Bulletin Classifieds I ndependent C o n tractor position with EXPOSURESFOR ONLY$2SO! the CCB prior to con- Door-to-door selling with tisements which indi- new ca r de a ler Mid South Circulation tltSIIltgl 0 r d ~ Ad i ~ N~ r tracting with anyone. fast results! It's the easiest cate the business has Subaru of B e nd. nA oe N re P a I a 541-385-5809 Sales. Some other t rades way in the world to sell. a bond, insurance and Offering 401k, profit IIeek o April 7, 2014 also req u ire addiworkers c ompensa- sharing, m e dical tional licenses and tion for their employ- plan, split shifts and The Bulletin Classified certifications. ees. For your protec- paid vacation. Expe541-385-5809 tion call 503-378-5909 rience or will trail. 90 Serving Central Oregon since f903 Serving Central Oregon since 1903 Custom Remodel & Tile or use our website: day $1500 guaran541-385-5809 T. Schellworth, Gen. www.lcb.state.or.us to tee. Dress for sucHome Delivery Advisor Contractor/Builder check license status cess to work in our CCB ¹188631 Landscaping/Yard Care before contracting with d rug f re e wo r k The Bulletin Circulation Department is seeking 541-588-0958 the business. Persons place. Please apply DIVORCE $155. Complete preparation. Includes children, a Home Delivery Advisor. This is a full-time doing lan d scape at 2060 NE Hwy 20, position and consists of managing an adult maintenance do not custody, support, property and bills division. No court Bend. See Bob or Debris Removal carrier force to ensure our customers receive r equire an LC B l i - Devon. appearances.Divorced in 1-5 weeks possible.503-772-5295. superior service. Must be able to create and cense. JUNK BE GONE www.paralegalaltsrnatives.com legalalt©msn.com Serving Central perform strategic plans to meet department Aeration/Dethatching I Haul Away FREE Oregon Since 2003 objectives such as increasing market share Have an item to 1-time or Weekly Services I For Salvage. Also Residental/Commercial and penetration. Ideal candidate will be a Ask about FREEadded Cleanups& Cleanouts sell quick? self-starter who can work both in the office svcs w/seasonal contract! DRIVERS-Whether you have experience or need training, we Sprinkler Mel, 541-389-8107 and in their assigned territory with minimal If it's under Bonded 8 Insured. offer unbeatable career opportunities. Trainee, Company ActivationlRepair supervision. Early a.m. hours are necessary Lawn Maint. '500 you can place it in Back Flow Testing COLLINS Driver,LEASE OPERATOR, LEASE TRAINERS. 877-369-7104 with company vehicle provided. S t rong Domestic Services Ca/I 541-480-9714 customer service skills and management skills www.centraltruckdrivingjobs.comHiring The Bulletin Maintenance Allen Reinsch Yard are necessary. C o mputer experience is Home is Where the Dirt Is «Thatch& Aerate Hiring One Ton and 3/4 Ton Pickup trucks to deliver RV's. $750 Classifieds for: llaintenance& Mowing required. You must pass a drug screening 9 yrs exp. in housekeep- • Spring Clean up (& many other things!) Sign-on Bonus, 4 Terminals& 8 Backhaul Locations. Call 866ing. Refs& rates to fit and be able to be insured by company to drive .Weekly Mowing Call 541-536-1294 or '10 - 3 lines, 7 days vehicles. This is an entry-level position, but 764-1601 or www.foremosttransport.com your needs. Julie & & Edging 541-615-5313 Hovana, 541<10-0646 •Bi-Monthly & Monthly we believe in promoting from within, so '16 - 3 lines, 14 days PICKUP TRUCKS NEEDED NOW! Move RV trailers from Indiana or 541-728-1600 advancement within company is available to Villanueva Lawn Care. Maintenance and delivery all over the USA and CANADA. Many trips headed Maintenance,clean-up, (Private Party ads only) the right person. If you enjoy dealing with People Look for Information •Bark, Rock, Etc. EAST! Go to: horizontransport.com thatching + more! people from diverse backgrounds and you are Caregiver Free estimates. energetic, have great organizational skills and About Products and CDL-A Truck Drivers Needed! $1500 Sign On Bonus! Dedicated ~Landsca in Prineville Senior care 541-981-8386 interpersonal communication skills, please Services Every Daythrough •Landscape h ome looking f o r send your resume to: and OTR; Great Miles& Time Off! Benefits, 401k, EOE. Call 7 Construction The Bulletin Classifieds days/week.866-435-8590 GordonTrucking.com Painting/Wall Covering Caregiver for multiple The Bulletin ~Water Feature s hifts, part-time t o c/o Kurt Muller Installation/Maint. Pass Handyman WESTERN PAINTING full-time. PO Box 6020 •Pavers CO. Richard Hayman, criminal background Bend, OR 97708-6020 •Renovations WERE YOU IMPLANTED WITH A ST. JUDE RIATA check. 541-447-5773. I Do THAT! a semi-retired paintor e-mail resume to: •Irrigations Installation DEFIBRILLATORLEAD WIRE between June 2001 and December Home/Rental repairs ing contractor of 45 kmuller©bendbulletin.com Look at: Small jobs to remodels years. S mall Jobs 2010? Have you had this lead replaced, capped or did you receive Senior Discounts No phone calls, please. Bendhomes.com Honest, guaranteed Welcome. Interior & Bonded& Insured The Bulletin isa drug-free workplace. EOE shocks from the lead? You may be entitled to compensation. for Complete Listings of work. CCB¹151 573 541-615-4458 Exterior. c c b¹51 84. Contact Attorney Charles Johnson 1-800-535-5727 Dennis 541-317-9768 LCB¹8759 541-388-6910 Area Real Estate for Sale WHEN BUYING FIREWOOD... To avoid fraud, The Bulletin recommends payment for Firewood only upon delivery and inspection. • A cord is 128 cu. ft.

l l l

The Bulletin

l l

The Bulle6n

Where buyers meet sellers Classifieds •

The Bulletin

•

The ulletin

THE BULLETIN • THURSDAY, APR 10, 2014

TO PLACE AN AD CALL CLASSIFED• 541-385-5809

TUNDRA

FOR BETTER OR FOR WORSE TH(5 l5 THE PLACE, SOY5! LET'5 (7ET SUSY!

jH JiS jH 4/

KNOLU 4)HRf, HONES! P WHFlf,

THERESHE!S! MOM'S HOME! SHEh HERe.!

W3'4IOH

MOM! KNOLU WHRT. ' ':::::'.

KVEN IF VOU BROUGHl MF-SOME.-

lHINEI -. Ibl NO1 GONI4R FISK IF ~ E YOUFLROUGHf, g 0 MESOME.THINL0!

O I

4-10

©Tundra 20%

SIBBP-

HEART OF THE CITY So NI((htT I ((AH@RC To K(TE'?

SALLY FORTH

I pL(7 c((!L(oijr CF L(IS I/I(~.

YOO Pga'4

CH/ A(O!

I PE /I Hlhi INIE7H~ O AI ::::', SUSPENPEP (7/4EI ! AOIWATgAI!

gg AHgW

OH, THIS IS NICE.

NE~

GREAT. LET'5 SUY IT AND GO

•

l 'LI

TEDY WILL YOU

0, ON SECOND

YOU RE I'M SORRY. AND iT DOES LOOK NICE.

AT I.EAST LOOK AT THE CLOTHESR I'M DOING IT FOR YOU.

AND IN THIS THOUGHT, I MANNER THEY DON'T CARE NEVER LEFT THE FOR IT. MALL.

'l.'

-L- / I 4PPEP 3 O

FEEL h((cE2E

II lo

cl-!0

AT ~ E .

RAZZ

ROSEIS ROSE

IT'S NlCE GETTINGHEREA lEKLE EARL( AND L(NGERIN(jO'IERMg COEEEE AND A CRO SSWORD.

l HEAR THAT.

H glt„+e,diMK ovmu5E,S

kfll0$ Sl,PI,

I'N( NOT HEIERING THAT.

THOU(BH YOV NIIGHT WANT f0 VIRAP(T UP %EOR$.SCQR)L GEYS oUT.

VAAA/

NO. CA I I'T EXPNLN %4'%

8 ((OK NSCtON(0t/"tHAtH8 (CNOW

KAN(CO NAMa,V AM'

%t@lÃP

OMG0(r

BAY 84XIW

1O W%II ILINH(:LIk OI'ROP. lP 'tHA t5'

B j

CLOB

F(P(eeSi

I(' PAV...9A Irlr 0 g(

ls O

-(0

LUANN

STONE SOUP HOLLcl', YOU CAN'T FA!cE ILLNF9> J'Uc T ELEC AU% '!OU HAVEN'T FINI&HEP QOUR. HOMCIAIO!2K,

lKCAUW '(OU CAN'T ELE +ICK %E (ZE5TOF ci'OUR I IN! cl'OU IFPW5 IHAVE TO FACE '(OUR (2E FLII.ITIEc .I HOIAI MUCH HOME. IAIHcl I IA(O!2K PO '!OU NF&P TO IVIAKE UPPP NOT? I

8%r(CAL5'„, AI-l. OF IT,

NOIAI I FESI +ICK.

•

• •

4t3

I 8 a 8

BNe e+cX<

BNe+cz hz~e+czhz~ eeeehs

I MOTHER GOOSE AND GRIMM

e ssae

+10

DILBERT E

P55T"

THE BOAR.D NAMED ME TEMPOR.AR.Y CEO. AND GUESS IAIHO IS COMING (AIITH ME TO THE C — LEVEL SUITE!

MPAEB VOU 5HOUI-D

SST'A PG.

')0

•

INsT&c.

•

IT'S MB

NO. AND YOUY(.E ALSO A TER.R.IBLE GUESSER..

00 al

E '0

~30

0 0

BO a

'e Ie 0

0 0

OONESBURY

ICKLES puvpo/HT /r, Bvr

PER5OHm EVE57/OH

r sess n'lv/6Hr r

Ott/EHo/p VovFIRsr

STRRT HRV/H6 OIFFICIIC TIES /IIITH'

I / Otto/45BRHI/

CCIH'roHIP

Rrr/IE E I IIO OF THE HERC,CytrE Ctc H/5 FIIIEHO5 COHFIIHEHIEI7 /IE OH I/p' FI8EHCH FRIES . CCIA(TOH CERAEP BRCK I/ HI5 CHiM RIVP5RIP 8/TH R Bl(o, 575P/P 6rsrHr

AIEL/, /I/IKE' /7 5 //IF'FICuu' TO

//5, CRl/CVS -I I0 YOO /IOH'7 H iRP R

(lsi iC/

HRVE EEEHOHENAP/

IRST 5(P/iVEIIY OIHEII/

(IEIS

o "II,V OIIFE X"Wl>Vf„

HI 5BXk/HEEfVOPIE5 CRIIE 7D /7/'HHEH...

'It(OQ SEFORE

L(FEf(AAf. O(= lA((GOOAA(hl M(5

BROK8' Hls li/OSE.

IAIHAT PO +LI THINK ASOGI

A.NP \!A)ANf fo PA&& (f ONTO

VE5,5OAl, l HAUE.

A(.'CUAAu&fEPA

THAf P'

('M SOhlE.

VOCK! ARE VOLl

90(C 'I

PUT (T

IN A QA55 5AR OR5OAAEfHING'P

HERE SRA(N„,

Z'LC. KEEP HEIS "

4/10

4-Io

ADAM

IZARD OF ID I PON'T KNOW , FUT IT POFSSOMFTHINEI.THF TASTF ISGRFAT.

Holll PPFsBIEINGPIEIFSTFP (LY LIIARPsMAKFTHFSE HEAN SFlTFR?

YFAH.

PWS I MNOTSVRFI'(IF FLIFR (LFFNTHISALFRT.THIS Alt(ABE! THIS RFA!7( R ACT(ON!

PIP%0HIA!l(|THA T? YOU $@ N IHFAR PSNPIIING!

(/IFRFFNC Y

I TOI.D HI/I! NOT TO STUDY A-N B.R. Bll I WITH. A HEART CONDITION

HF WFNT INTO CRRDIACARREST WHFN HF SAWHOW MUCHWE CI(7(RIVE F0R &AUzE!

z X O

0),

'l ((( (

)

+/CIC rr WITARDOE(D.COM

+IO

DIST. BY CREATORS

SHOE

Tt STINKSINYOO R

A LITTLE &fFT FROHI HEAVENY

HYPoTHESIS Olsl IAIATURA L5EL-Ec. TI 0 f4.

00 E0

I HOPE HE GAhlGET

USEDTOTHE SMELL

0 OI 0 tr

AHAM51ER.

0 E

HOLYCOW , SKYLER.

WELL, AREN'T You aOSr

I NEED A WAY To PRoVE RIY

gggON'

9EP P!f 0

<I, (!

0 0

Dist by Creators

ARFIELD

PEARLS BEFORE SWINE g

IT'S A

MOMMY,

LOON

NECICY SINGCE STEPHAN TRIES PICKING UPCIOI(IEN

HAIRY HOSI

I CIANT TO TACKTOTHATC!OPIAN,

HERE

WE C40...

WAI'T FOR IT...

'L 3

0 0

BVTHOCIPSHOUCPI TEC(HERCIHO

...ANP, IT'S SITINCv TIME

I ANPCIHATCONICSTRIPI PRA CIP OFPERTO SKETCHHfRSOHETHINGP

I•

PARPON Pl f,BUTARf VOU YES!' YESEYOV RECOGVH,, STE PHANPASTIS.o 8E NIlf P(f! I'CCPRA(t/ YOVPRO PPEP Y OVR YOV SOPI ETHING/I'CC AUTOGRAPH SOPIETHING! CREP!T I 'CC C IRITEYOUSONETAIAIG/ CARP, 8 E

HO L E.

I'LL

cahLIL IHT O

3 0

0/ st s 8480

PEANUTS

MARY WORTH (XAV,EANS.THAT'& 1HEEND OF THE INNINS! IT'S OUR

TURL(AT 5AT... LETS 6ET 50MERUNS, OKA(v'I

1R15 O'TORMS AWAY AFTER, AN ARGUMENT Wl'TH WILSLlR A5 HE W AIT5 F O R THE SILL.

JUST (UHAT A MANA GER LIKES... A PLA4'Eli,' LL(HO ISN T l3QTHERED 8V TENSION!

PON'T GOI WE NEEP TO P15CL155 THIS!

IRI S I wAI T!

>/'t.io e e'J4

w aJ

Q Z

•M

I g4

~gI)II',

4-10

ET FUZZY TIIAT CATS HDT CTON NA

NON SEQUITUR 00 4 0 Ae Naaae

8 S~ IN5 T O RECE=N~UER Alc

FLAEST.

NO v(EG-A/SE(4

POLlC („, ri

eee

t '3 3'

8 o

/DI4weev INK,IBc. e.io

WI JBV INKSBASIVNttNK.NS'T

TH E BULLETIN• THURSDAY, APR 10, 2014

TO PLACE AN AD CALL CLASSIFED• 541-385-5809

DAILY BRIDGE CLUB Th~dayAP~10 2014

NEW YORK TIMES CROSSWORD will $bprtz

Reality check By FRANK STEWART Tribune Content Agency "I guess I'm an idealist," a club player told me. "At least, I think of myself as one. But I k eep getting mugged by reality." My friend showed me today's deal. He was declarer at four spades. West led thequeen of hearts. "I won with the ace and led the king of trumps. East took the ace and l ed a c l ub , an d W est w o n a n d continued with the jack of hearts. When I played dummy's king, East ruffed and led another club.

your right opens one spade. What do you say? ANSWER: A bid of 2NT would be "Unusual," showing length in both minor suits. But this is the wrong type of hand for that gadget, which o ught t o s h o w e i t her a w e a k , offensively oriented hand suitable for a sacrifice if the opponents bid game, or a strong hand. I w ould pass. I could accept an overcall in a minor. South dealer Both sides vulnerable

ENTRIES

NORTH 41932

"I ruffed and could still get home if the diamond finesse worked. I didn't have enough dummy entries to establish and cash the long hearts. When I led a diamond to the jack, East took the king. Down one." The reality i s t hat ba d b reaks h appen. South's p la y w o ul d b e defensible at matchpoint scoring, but at IMPs or party bridge, he must guard against a 4-1 heart break by p laying low f ro m d ummy o n t h e s econd heart. If W est shifts to a diamond, South takes the ace, ruffs a h eart, draws the last trump w i t h dummy's nine and runs the hearts for 10 tricks.

9K87542 OAJ 494 WEST 417

EAST 4IA6

9 Q J109 0873 A AJ 8 6 3

Q6 0 K 109 6 2 A K1075 2

CHE GR HEM CE AYE HE MYR I AD PO I N T SUL K A SHR GAS 8E OUT G 0 OTO E A DON TA S E ER I I HA V E N ROG E T KEE N E

4 9KQ J 1 0 8 5 4

QA3 0Q54

DAILY QUESTION

Wes t Nor th Pas s 2 45 All P a ss

East Pass

Opening lead — 8 Q

Y ou hold : 4 A 6 9 6 0 K 1 0 9 6 2 4 K 10 7 5 2. Wi t h neither side vulnerable, the player at

Seeking 8 friendly duplicate bridge? Find five gamesweekly at www.bendbridge.org. BIZARRO

57 "Come here often?," e.g. 58 Japanese watch 62 Redding of R&B 63 Blue hue 64 British poet laureate Day-Lewis 65 Honey-soaked dessert 66 Some fundraising grps. 67 Upright

33Common situation near the start of an inning 36 Many a shot in the arm, for short? 37 Plafform ... or something that appears four times in this puzzle? 39 Decks, in brief 41 Management'6 counterpart 43 Royal son of the comics 44 First word, maybe 45 Seoul soldiers 47Assumed 49 2452 Device that converts pressure into a rotating motion 54"SomeKind of " (Dick Van Dyke comedy) 55 Double56Actress Andersson

AMS L I A LL I D I MS D I 0 ED ATS EL ERO KME E OC L UPE TAN

E P 5 OM R OU T E F I KN O W A T E S T UM P E D S OO Z E I NT R A M E SA D UDE 5 D EA R F I RM A J ET S E T U E A C T N D T H E K S Z E D

20 23

31 37

33 38

autobiography "The Soul of a Butterfly" 3 Computer storage unit, informally 4 Military decoration 5 German beer now owned by the Pabst Brewing Company 6 Annual parade locale 7 Wine feature 8 Kind of steak 9 Casual wear 10Traction provider 11Sharp 12 Prime 13 Fuentes and Puente 21 Socialize professionally 23 Land name before 1939 24 Heavenly figure, in Hesse 25 " lovely time" 26Curse 29Opalescentgems 32 New Deal inits.

DOWN 1 Rattle 2 Athlete with the

ANSWER TO PREVIOUS PUZZLE

SOUTH

South 1 49 4 41

ACROSS 1 Side pieces 6Tenor in a barbershop quartet, e.g. 10Lot 14Quick 15Singer India. 16Modem yogurt flavor 17Strictness 18Pepsi-owned beverage brand 19Cajun French, e.g. 20Oneslittle-known in their fields 22TLC,e.g. 23 Doesn't waste an opportunity 26Agrees 27 Quickly 28 Qatari leader 30 Ingredient in many Asian desserts 31 Dallas-toAmarillo dir.

No. 0306

55 56

PUZZLE BY DANIEL RAYMON

34 Relative of a giraffe 35 "Tullius" in Marcus Tullius Cicero 37 Pipe buildup 38 European city whose airport is the world's largest chocolate-selling point

49 Item purchased at many a food cart 50 "West Side Story" woman 51 Cube creator 53 Aegean region 44 Character in Clue 55 Pat-a-ceke element 46 N ascar'5 C u p 59 Cube makeup Series 48 Paris-based grp. 60 It's all relatives since 1945 61 Familiar 40 Singer with the 1986 ¹1 album

"Promise" 42 Capital on the Danube

Annual subscriptions are available for the best of Sunday crosswords from the last 50 years: 1-888-7-ACROSS. AT&T users: Text NYTX to 386 to download puzzles, or visit nytimes.com/mobilexword for more information. Online subscriptions: Today's puzzle and more than 2,000 past puzzles, nytimes.com/crosswords ($39.95 a year). Share tips: nytimes.com/wordplay. Crosswords for young solvers: nytimes.com/learning/xwords.

DENNIS THE MENACE

SUDOKU

What time iC it7

Complete the grid so that every row, column and 3x3 box contains everydigitfrom1 to9 inclusively. SOLUTION TO Oi

YESTERDAY'S

SUDOKU

-.B Z

45 4i

8 i4

Ci LL

"ka IVIAYNdr GQOW UP TO I%'A LAWVGR... SUT HSP MAKE A &IZGAT 120LITICIAf4."

CANDORVILLE

5/G SOY.

Edited by Rich Norrisand Joyce NicholsLeWiS

a\ O

Cf 8 6

SAFE HAVENS ~IAi& 5Ilouj.P 8& ('OMIII& IIITo I rHEIZE rl

gl &IIT OF 'THE. IV~SIZFOLI4 CAI7lfOL /IINII'-

ACTLIALLY, 6HI(tl/IfeOK A Izt/lt.T

TV ITFgo/IIA

I/)IloA

GOUPL E

O'HOQ + HP L'5. 5HIP(8)IZF-<I

e 2014 by King Features syndicate, Inc. world rights reserved

E-m8il: bholbrook1@gm81.00m

httP://WWW.88feh8V80800miC.com

SIX CHIX

,' gON'7 BUY(7, ',

/ls COd ls nP

uJitrless, I'm nok

SiS7&R

)

havingan a$$air.

0 'bb 8 A4 8 IO

00luhrKINGFEATuRES.Coe

ZITS Holii'9 Iro(jlz 4OCK ITCH,

H fl-PEP?

CP.

FINE.

M<c4izs Ui' Nlof& tlMi fl

PRF 'COLI ij4PINIG

IT'IWICS APPh; I-IKFI 5AIPP' g~ HUH.

COjlh~

~g coNygzShTICIN!

HERMAN

THAT SCRAMBLED WORD GAME by David L. Hoyt and Jeff Knurek

eI Unscramble these four Jumbles,

0ne letter to each square,

to form four ordinary words.

1 E

SHULS

3 some skilli vii<

Thesmartplay 6'4 M 4 i e6 thOae ia tO lay up.

68014 Tiibune Content Agency,LLC All Righls Reeenred.

BAMUL o s 4 7i4 + 8 o s 4 0

8 0484> 8 8 0 4 > 0 8"ai,6 ~ 9 8 " 4

4044404 4 4 4 8 i ik4 4

RATBYE

~ 4 i ~ r'4s ~4 ~ c • R44si'~~eR44a> +4+<48 944 s49 4> 0 484 ~ 9

rc7 WIN THE eI85EN JA~ AT AU&osT A, A eciLR5c'.

FITARD

i4849 1 4848

0 4 4%o

HERMAN~ 440

04!u9hingStOCk InternetiOnal InC, DiSt by UniverSal UCliCk for UF8,2014

"Mr. Henderson will aee you now."

* 4

LOS ANGELESTIMES CROSSWORD

'E 6

•g

DIFFICULTY RATING: ** *

IOO LATE.

0•I

Cil 0 o

y AGOO '/IIG00,' I TI/AY

YOOKNOI/ I/I/AT 5/G SOYG PO,GONF TIIEY GO GTRAIGI/TTO GLEEP INGTEAP OFJOMPING UP ANP POI/N ON TIIEIK SEPG ANP KEEPING Ti/EIK PAKENTGOP ALL NIGIIT LONG.

ARE YOV A5/GSOY NOI/i GONF OKAKE YOO GTILL A LITTLE SASYF

NEEt75 TD PLAYNow arrange the circled letters IO fOrm the SurPriSe ansW8088 suggested by the above cartoon.

Ans here (AnsWers tamarrOW) OCCUR L AWFUL A U TUMN y88188I8 8 ~ Ju mbles: OOMPH Answer. After 8 long day of showing off the new dothing line, the fashion model was — WORN OUT

ACROSS 1 "Find your own road" automaker 5 Bitter

4 Ones showing varying amounts ofinterest? 5 Facility about 350 miles NW of LAX 6 Beau Brummel, for one 7 Brusque 8 Steamed

disagreement 11 26-Across download 14 Minuscule lake plant 15 Wee hr. 16 Dude 17 RASPBERRY 20 Vampire'8 bane 21 T-man, e.g. 22 Courageous 23 Hermey of TV's "Rudolph the Red-Nosed

Reindeer," e.g. 25 Take out 26 BLACKBERRY 32 Newtonian elements'? 33 Is ready for business

34 Big runners 35 Bustle 36 Natural resource 37 Educational org. 38 Chloe fragrance maker 40 Good-sized chamber ensemble 42 Baseball family name 43 HUCKLEBERRY 46 Goal line play 47 Kitchen tool 48 Like wasted milk in Westminster 49 Its HQ is named for George Bush 52 Schisms and chasms 56 STRAWBERRY 59 k w o n do 60 Sherlock Holmes' instrument 61 Small case 62 Wanted-poster letters 63 Use 64 Percolate DOWN 1 Fresh answers,

say 2 Oodles 3 Lago contents

9 Word with cry or out 10 Future citizen, perhaps 11 Not particularly

30 Show contempt 31 Son of Isaac

48 Mlle., in Monterrey

32 Fundamental of

49 Recipe verb

science 39 Harvest output 40 Spider-Man

50 Cruise destination 51 Related 53 You've got it

nemesis Doc

coming

41 Select 42 Occasionally 44 From around here 45 Podiatrisf s concern

54 "No argument here" 55 Ignore 57 Pack quantity 58 Senator Sanders of Vt., on ballots

ANSWER TO PREVIOUSPUZZLE:

challenging 12"Law 8 Order"

J A Y U P S E I K E E A T M F A N N Y P A C mount A S A F E 18 Mark of rejection F E 19 Like James Bond A P P T Q U I C H E S 24 Ubiquitous A N T H E M U insurance spokeswoman B I C F I N K 25 To whom A C H T G E E reporters report: A G R A Abbr. FO N D U E P O 26 Dracula feature V 27 Brainstorming cry A D E P T S D E P O T F U 28 Historical S T A L E E L segment 29 Simmons S L E D Y E competitor xwordeditorINaol.com

figure 13 County fair

T E K

B E A E T N N E O R N N O O U T T A S E R T A U L N N Y Z I E A T S

H I P P A P R O T B O W E

I D A H O

M I N S K

N E A X G O

25 28

O N E A

T R I N E

H E A R T

04/10/14

15 37

A N G E L E S

35 38

49 5 0

Ss 5 4

58 61

04/10/14

TO PLACE AN AD CALLCLASSIFIED• 541-385-5809

Bxi9mlh

THE BULLETIN• THURSDAY APRIL 10 2014 E5

Homes for Sale

870

880

881

882

Boats & Accessories

Motorhomes

Travel Trailers

Fifth Wheels

NOTICE

632

pt./Multiplex General CHECK YOURAD

on the first day it runs to make sure it is correct. nSpellcheckn and

human errors do occur. If this happens to your ad, please contact us ASAP so that corrections and any adjustments can be made to your ad. 541-385-5809 The Bulletin Classified 648

Houses for Rent General

All real estate advertised here in is subject to th e Federal F air Housing A c t , which makes it illegal to advertise any pref850 erence, limitation or Snowmobiles discrimination based on race, color, reliion, sex, handicap, Iamilial status or national origin, or intention to make any such preferences, l i mitations or discrimination. We will not knowingly 1989 Yamaha accept any advertisExciter, ing for real estate 2,000 miles, which is in violation of original owner, this law. All persons always garaged, are hereby informed that all dwellings ad$600. vertised are available 541-480-7517 on an equal opportunity basis. The Bulle- Arctic Cat 580 1994, tin Classified EXT, in good condition, $1000. 750 Located in La Pine. Call 541-408-6149. Redmond Homes 860

2007 Winnebago Outlook Class "C" 31', solar panel, Cat. heater, excellent condition, more extras. Asking $58K. Ph. 541-447-9268 Can be viewed at Western Recreation (top of hill) in Prineville.

Monaco Lapalma,

2002, 34'10" -Work-

horse 8.1, Less than 18,000 mi, 5.5 Onan gen., 2 slides, 4 dr. refrig w/icemaker, micro/convection oven, water purifier, hydraulic jacks, power pilot seat+ more options. Exceptionally clean. $59,900/make offer.541-504-1008

(2) 10' Kayaks; Old Town Otter, Ocean Just bought a new boat? Frenzy Si t -on-top, Sell your old one in the Ask about our both with p a ddles, classifieds! Super Seller rates! $225/ea. 541-385-5809 541-593-6053 Ads published in the "Boats" classification include: Speed, fishing, drift, canoe, house and sail boats. For all other types of watercraft, please go to Class 875. 541-385-5809

G R E AT

I RX.JK E

National RV

Tropical, 1997,

35-ft, Chevy Vortec

WINNEBAGO BRAVE 2003 • 34D, 2 slides • Tires 80% • Just completely serviced • 39,000 miles • No trades • $48,000 firm 541-815-3150

Looking for your next employee? Place a Bulletin help wanted ad today and reach over 60,000 readers each week. Your classified ad will also appear on bendbulletin.com which currently receives over 1.5 million page views every month at no extra cost. Bulletin Classifieds Get Results! Call 385-5809

or place your ad on-line at bendbulletin.com

Winnebago Sightseer 30' 2004

For Sale

BULLETINCLABBIFIEDB Search the area's most with living r o om comprehensive listing of classified advertising... slide, 48,000 miles, in good condition. real estate to automotive, merchandise to sporting Has newer Michelin tires, awning, goods. Bulletin Classifieds appear every day in the blinds, carpet, new print or on line. coach battery and Call 541-385-5809 HD TV. $31,000 www.bendbulletin.com Call Dick at 541-408-2387 The Bulletin

I)I j

NI I'

Holiday Rambler 37' Recreation by Design 2013 Monte Carlo, Presidential model 2003, all factory op- 38-ft. Top living room, 2 tions, 3 slides, 2 A/C bdrm, has 3 slideouts, 2 units, 4 door fridge, A/Cs entertainment fireplace, generator, center, fireplace, W/D, electric jacks front garden tub/shower, in and rear, flat screen great condition. $36,000 TV, e n t ertainment obo. Call Peter, 307-221-2422, center, bay window, exc. cond., MUST ( in La Pine ) WILL DELIVER SEE! Sacr i fice $24,500 OBO. 541-223-2218 RV CONSIGNMENTS WANTED USE THE CLASSIFIEDS! We Do the Work, You Keep the Cash! Door-to-door selling with On-site credit fast results! It's the easiest approval team, way in the world to sell. web site presence. We Take Trade-Ins! The Bulletin Classified Free Advertising. BIG COUNTRY RV 541-385-5809 Bend: 541-330-2495 Redmond:

173 Highland Meadow engine, new tires, 541-548-5254 Laredo 30' 2009 Loop - Smith Rock Motorcycles & Accessories new awnings, 12-ft views! .30 acre lot, PUBLISHER'S slide-out, queen 2321 sq ft, 3 bdrm, Snrwng CennniOregon nnne 1ggg 885 NOTICE bed, Italian leather All real estate adver- 2.5 bath, triple car Canopies & Campers Sennn Central Ore nn since 1903 couch and recliner, 881 garage. $402,777. tising in this newspaexcellent condition. 882 Travel Trailers per is subject to the Lynn Johns, Principal 2009 9grg' Arctic Fox, Ready to travel„ Bid Now! Fifth Wheels F air H ousing A c t Broker, 541-408-2944 loaded, excellent! Must www.sulletinBidnsuy.com towing hitch inCentral Oregon overall length is 35' which makes it illegal AIRSTREAM sell, price slashed, sell2005 HD Super Glide cluded. $19,900. Resort Realty has 2 slides, Arctic ing below book, $18,500. 2010 25' FB, Int'Ito a d vertise "any custom, fuel injected 541-815-4811 Serenity, like new, only package, A/C,table 541-410-1312 preference, limitation 7k mi, new tires, like & chairs, satellite, used 4x. Originally or disc r imination$282,900. 2189 sq.ft., new cond. $9500 single level, 3/2, famArctic pkg., power based on race, color, $75,000; asking 541-639-9857 Call a Pro awning, in excellent $59,500. Call for religion, sex, handi- ily room w/ gas firecondition! More pix Whether you need a place, formal dining details, 541-593-0204 cap, familial status, Buy Ne|N...suy Local at bendbulletin.com Alpenlife 29' 1993, marital status or na- room, den, sunroom, fence fixed, hedges You Can Bid On: n with qoo s eneck. tional origin, or an in- upgrades galore. For$28,000 trimmed or a house 1994 Alumacraft 16 541-419-3301 $3500 OBO. Needs tention to make any SaleByOwner.com ID Call Aluminum Boat built, you'll find new ref r igerator Navion IQ Sprinter such pre f erence, ¹ 23975895. Retail Value $4,995 541-306-1961. chassis RV 2008, 25' limitation or discrimi- 541-526-1206 for info. profess<onal help in Monaco Lakota 32' 2002, All Seasons RV 8 Leave message. Mercedes Benz diesel, nation." Familial sta2 slides, AC, recliners, The Bulletin's "Call a FXSTD Harley Nfarine 295 Vista Rim Dr. En only 24k miles, exceltus includes children walk-around queen bed, Service Professional" Forest River 27' by Wildergy Star home built Davidson 2001,twin (Bidding closes lent condition, autounder the age of 18 sliding glass door closet, cam 88, fuel injected, wood 2004, winter pkg, Tues., April 15, matic rear slide-out CHECK YOUR AD living with parents or by Sage in Vista Rim! Vance & Hines short new tub & 10-gal water Directory slide, AC, oven, Craf t sman shot exhaust, Stage I at 8:00 p.m.) w/queen bed, full bath legal cus t odians, NW heater, good tires. Brand tub-shower, outside 541 -385-5809 w/shower, deluxe cappregnant women, and w/great room plan, new 20' screen room with Vance 8 Hines shower, micro, awning, Enclosed raft t railer, tain swivel front seats, always stored. $12,500. available. Super clean, 1 people securing cus- contemporary luxury fuel management woo d system, diesel generator, 12'x7', pulley system owner, n o n -smokers. tody of children under finishes & custom parts, Prineville, 541-447-9199 Btd Now! floors. Designed for awning, no pets/ 18. This newspaper to help load, wired for $11,999. 541-447-7968 extra seat. $10,500 www.sulletinBidnsuy.com no smoking. $69,500. an a c t iv e fa m i ly will not knowingly acOBO. Call 12 volt ai r p u mp. on the first day it runs 541-382-2430 $750. 541-593-6053 cept any advertising w/mud room, full size Today to make sure it is corr for real estate which is pantry & utility room 541-516-8684 —n rect. nSpellcheckn and 875 in violation of the law. w/extra built-ins. Den Find It in human errors do ocO ur r eaders a r e & extra bonus room Watercraft cur. If this happens to Ths Bulletin Classifisdsi hereby informed that w/walk-in closet. En- Harley Davidson 2009 your ad, please con541-385-5809 joy tranquil setting on Super Glide Custom, all dwellings adverds published in nWaBoy Hegg...soy Local Keystone Laredo 31' tact us ASAP so that MONTANA 3585 2008, Stage 1 Screaming tised in this newspa- the pond 8 peaceful tercraft" include: KayYou Can Bid On: RV 20 06 with 1 2' corrections and any exc. cond., 3 slides, sounds o f n e a rby Eagle performance, per are available on aks, rafts and motor2001 Gench slide-out. Sleeps 6, adjustments can be king bed, Irg LR, water feature from too many options to an equal opportunity Ized personal Citation Truck queen walk-around made to your ad. Arctic insulation, all list, $8900. basis. To complain of your back patio. Exwatercrafts. For Camper bed w/storage under541-385-5809 options $35,000 obo. 541-388-8939 d iscrimination ca l l pansive views east of "boats" please see neath. Tub & shower. The Bulletin Classified Retail Value 541-420-3250 HUD t o l l-free at Smith Rock, mtns & Class 870. 2 swivel rockers. TV. $10,995. city lights from front. 1-800-877-0246. The The Bulletin's Air cond. Gas stove 8 All SeasonsRV8 541-385-5809 Plumbed for central Providence 2005 toll free t e lephone refrigerator/freezer. "Call A Service Marine Fully loaded, 35,000 number for the hear- v ac. H eat/cool i s Professional" Directory Microwave. Awning. (Bidding closes d uctless system. 2 miles, 350 Cat, Very ing i m paired is Outside sho w er. Tues., April 15, is all about meeting bedrooms, 2 baths, clean, non-smoker, 1-800-927-9275. Slide through storat 8:00 p.m.) 880 1 919 sq f t . ML S 3 slides, side-by-side your needs. a ge, E a s y Lif t . 687 201308726. $349,900 refrigerator with ice Motorhomes $29,000 new; OPEN ROAD 36' Call on one of the Robyn Fields, Principal maker, Washer/Dryer, Asking$18,600 Fleetwood Prowler Need to get an Commercial for 2005 - $25,500 Broker, Eagle Crest professionals today! Flat screen TV's, In 541-447-4805 32' - 2001 King bed, hide-a-bed Rent/Lease ad in ASAP? Properties motion satellite. 2 slides, ducted sofa, 3 slides, glass You can place it 971-255-9866 $95,000 heat & air, great shower, 10 gal. waFenced storage yard, 541-480-2019 condition, snowbird online at: ter heater, 10 cu.ft. building and o ffice Roomy single l evel ready, Many upfridge, central vac, www.bendbulletin.com trailer for rent. In con- home on a large lot in s atellite dish, 2 7 " grade options, fivenient Redmond lo- Stonehedge in RedRV TV/stereo syst., front nancing available! cation, 205 SE Rail- mond. Open floor plan CONSIGNMENTS 541-385-5809 Beaver Marquis, front power leveling $14,500 obo. road Blvd. Reduced to with vaulted l iving WANTED 1993 jacks and scissor We Do The Work ... $700/mo. Avail. now. room Plus a family Harley Davidson Lance Travel Trailer Summerwind 811, 2000 stabilizer jacks, 16' 40-ft, Brunswick Call Dick, 541-923-7343. 2011 Classic LimYou Keep The Cash! (Model 1985) 2012, room, kitchen fea- ited, awning. Like new! Camper w/slide, Loaded floor plan. Many 541-480-1687. On-site credit Loaded! 9500 dinette/slide makes Asking $10,900 541-419-0566 Advertise your car! tures plenty of cabin- miles, custom paint extras, well mainapproval team, to a queen-size bed, Call 541-815-3960 Add A Picture! etry, eating counter, tained, fire supweb site presence. queen walk-around Reach thousands of readers! large pantry, dining "Broken Glass" by pression behind Nicholas Del Drago, We Take Trade-Ins! bed, inside/outside Call 541-385-5809 area with access to refrig, Stow Master Free Advertising. new condition, sound system, miThe Bulletin Classifieds the huge back deck. 5000 tow bar, BIG COUNTRY RV crowave, c o oktop Master bed r o om heated handgrips, Bend: 541-330-2495 auto cruise control. $24,995. with oven, power separation from addiRedmond: $32k in bike, 541-383-3503 awning, flat screen B3ce9 &MtRs tional two bedrooms. 541-548-5254 only $20,000 or best TV, only used 10 Two offices or hobby l@e ©nlh offer. 541-318-6049 times. Easy tow with rooms. Landscaped F-150. Call for price. front and back with 541-647-0658. fenced back yard that has lots of trees for HDFatBo 1996 privacy. Forced air gas with central air Bigfoot Diesel 32' cond. $199 , 900 726 2006, Su p er C ¹201310177 John L. TIFFINALLEGRO Duramax d i e sel, Timeshares for Sale Scott Rea l E s tate BUS 2010 - FULLY Allison trans., only 541-548-1712 LOADED 40QXP Completely 37K mi., do u b le Powerglide $5000-$35,900 Enjoy Chassis / Orbit 21' 2007, used Rebuilt/Customized slide, 5500 Onan Eagle Crest all year 425HP Cummings only 8 times, A/C, 2012/2013 Award diesel gen., to many as a fractional owner. Looking for your next Engine / Allison 6 oven, tub shower, emp/oyee? Winner options to list. Vin¹ Benefits of being an Spd Automatic Trans micro, load leveler Showroom Condition 534032, $79,995. Eagle Crest Owner at Place a Bulletin help / Less than 40K miles hitch, awning, dual Many Extras a "fraction" of the cost. wanted ad today and Beaver Coach /Offered at $199K. batteries, sleeps 4-5, reach over 60,000 Low Miles. Home-ID FRAC Sales &Service, Too many options to EXCELLENT CONreaders each week. Eagle Crest Properties Bend 541-914-8438 $17,000 list here! For more DITION. All accesYour classified ad DLR ¹3447 866-722-3370 541-548-4807 information go to sories are included. will also appear on mnn ~ $14,511 OBO. 738 bendbulletin.com l ln obus.com n~ 541-382-9441 which currently reMultiplexes for Sale or email ceives over trainwater157© 1.5 million page Duplex on large lot and gmail.com views every month adjacent duplex for or call 858-527-8627 at no extra cost. sale too. ¹1382 "~I! Bulletin Classifieds TEAM Birtola Garmyn Vgnng Get Results! High Desert Realty Triumph Da ytona Dodge Tioga 24' Class C Call 385-5809 or 541-312-9449 2004, 15K m i l es, Motorhome Brougham 1978, place your ad on-line www.BendOregon Pacific Ridge by perfect bike, needs Bought new in 2000, 15', 1-ton, clean, at RealEstate.com nothing. Vin Komfort 2011 currently under 20K bendbulletin.com 69,000 miles. Mdl P 27RL 31', 15' ¹201 536. miles, excellent 740 $4500. Super slide, power $4995 shape, new tires, Condo/Townhomes In La Pine, jack, electric awning, Dream Car professionaly winter762 solar panel, 6-volt Auto Sales call 541-602-8652 ized every year, cutfor Sale Homes with Acreage batteries, LED lightoff switch to battery, 1801Division, Bend DreamcarsBend.com ing, always stored plus new RV batterRedmond Townhomeies. Oven, hot water inside. Must see to 541-678-0240 3 bdrm, 2 bath, 1887 14482 SW Pony Trail in Dlr 3665 heater & air condiappreciate.Asking sq ft, jetted tub, Bra- CRR. Like new home tioning have never $28,000. Call Bill, zillian Cherry floors, built in 2001 that has been used! 541-480-7930 d ouble gara g e. always been a vaca$24,000 obo. Serious tion home. U n obMLS201400831 TO PlaCe yOur Bulletin ad With a Photo, ViSit inquiries, please. structed mtn views, 2 $134,900. Pam Lester, Fleetwood Discovery Stored in Terrebonne. bdrm, 2 bath on 2.58 WWW.bendbulletin.Com, CliCk On "PlaCe an Principal Bro k e r, Call a Pro 40' 2003, diesel, w/all 541-548-5174 n C entury 2 1 Gol d acres. Master bath options - 3 slide outs, Whether you need a has garden tub and ad and fOIIOW theSe eaSy StepS: Country Realty, Inc. satellite, 2 TV's, W/D, separate walk-in fencefixed,hedges 541-504-1338 etc., 32,000 m iles. shower, New Pergo V ictory TC 9 2 ci trimmed or a house Wintered in h eated 745 flooring and windows. ~s • shop. $84,900 O.B.O. built you'll find Large composite 2002, runs great, Homes for Sale 541-447-8664 decking, Hardi-plank 40K mi., Stage 1 professional help in 1.Choose a category, choose a classification, Performance Kit, Generator Kubota 3500 siding. $110,000. 17280 SE Renegade The Bulletin's "Call a Juniper Realty, n ew tires, r e a r Loop, $230,000. as, 60 h rs, $ 1000 Winnebago Adven- Service Professional" and then select your ad package. 541-504-5393 3 Bdrm, 2 bath, 1 acre, brakes. $ 5 0 0 0. ASH. 541-923-5960 turer 2005 35grg', gas, Directory 1280 sq.ft. home w/2 541-771-0665 less than 20,000 miles, 771 stall barn. Minutes 541 -385-5809 2.Write your ad and upload your digital photo. excellent condition, 2 from Prineville. Lots Yamaha 750 Maxum, slide-outs, work horse MLS ¹201306623 1983, 19K, exlnt cond, chassis, Banks power 3. Create your account with any Winderemere Swifterra RV 50mpg, shaft d rive, brake system, sleeps Bid Not/tr! 150 NW 4th St., $1195. 541-279-7092 5, with al l o p tions, CONSIGNMENTS www.sulletimBidnsuy.com Prineville, OR. major credit card. WANTED $62,000 i negotiable. 865 Gulfstream S u n541-447-7502 Call 5 4 1-306-8711or We Do The Work ... sport 30' Class A ATVs a ikistu@bend- You Keep The Cash! 2305 NW Grimes Rd. 1988 new f r idge, email On-site credit cable.com $875,000. Great farm TV, solar panel, new Arctic Cat Prowler 650, approval team, located in the agrirefrigerator, 4000W 2007, UTV w/camo web site presence. cultural valley, north canvas. Asking: $7450. generator, w h eelWe Take Trade-Ins! of Prineville. 5 Bdrm, Boy Ne|N...soy Local chair lift avail. Good Call: 541-815-3960 Free Advertising. 3.5 baths, 438/4 sq.ft. You Can Bid On: cond. $7,000 obo BIG COUNTRY RV 870 property includes 75 Lot 22 at Yarrow in 541-447-5504 Bend: 541-330-2495 acres. Must see! MLS Madras Boats & Accessories Redmond: 201309754. Retail Value $23,000 541-548-5254 Winnebago Aspect Winderemere Swifterra SunForest 12'1969 Searsalurn2009 - 32', 3 slide150 NW 4th St., Construction num fishing boat, Prineville, OR. outs, Leather inte(Bidding closes low hours on new 8 541-447-7502 rior, Power s eat, Tues., April 15, hp engine, with trailer locks, win d ows, at 8:00 p.m.) and extras. Good Madras Hwy, Aluminum wheels. shape!$1600. Reduced to $250,000. 17n Flat Screen, KOUNTRY AIRE 541-382-2599 22.3 acres within the Surround s o u nd, 1994 37.5' motor775 city limits, 21.1 acres camera, Queen bed, home, with awning, Manufactured/ Tango 29.6' 2007, of irrigation rights. Foam mattress, Awand one slide-out, Rear living, walkwww.bendbulletin.com Hwy frontage, Mobile Homes ning, Generator, InOnly 47k miles dividable/backs to around queen bed, verter, Auto Jacks, and good condition. Ochoco Creek. central air, awning, FACTORYSPECIAL Air leveling, Moon All ads appear in both print and online. Please allow $25,000. MLS ¹201307351 1 large slide, New Home, 3 bdrm, roof, no smoking or 541-548-0318 24 hours for photo processing before your ad Winderemere Swifterra 18'Maxum skiboat,2000, $46,500 finished $12,000. p ets. L i k e ne w , (photoabove is of a 150 NW 4th St., appears in print or online. on your site. inboard motor, g reat similar 541-280-2547 or $74,900 model & not the Prineville, OR. J and M Homes cond, well maintained, 541-480-6900 541-815-4121 actual vehicle) 541-447-7502 541-548-5511 $8995 obo. 541-350-7755

The Bulletin

•

F~-

•

The Bulletin

a e volli' t;assiie 8 1

•

with a full-color photo, in print and online.

TO place your ad, visit

www.bendbulletin.com or call

541-385-5809

assi ie s

E6 THURSDAY APRIL 10, 2014 • THE BULLETIN g

TO PLACE AN AD CALL CLASSIFIED• 541-385-5809

916

933

935

975

Trucks & Heavy Equipment

Pickups

Sport Utility Vehicles

Automobiles

ChevyColorado LX Crew Cab 2009

Volvo S60T52013

(Photo for ittuatration onlyl

908

Aircraft, Parts & Service

&mr

nerttr

1/3interestin

Columbia400,

Kenworth 1991 T800 Water Truck 914 350hp diesel eng, 9-spd trans, Hendrickson cab suspension, double framed, self-contained John Deere pony motor, 4000 gallon water tank, new battery, 902,832 miles.$22,500 obo. 541-589-2209

4 wheel drive, less than 50k miles. ¹132212 $20,977 ROBBERSON c I II ec0n ~

ataaa a

541-312-3986 DLR¹0205

AWD, less than 11k mi., auto, 6 spd. vin ¹202364 $31,977

Subaru Impreza fVRX 2012, Limited! AWD, 5-Speed Manual. Vin¹ 213631, Stock ¹44202A

Come in and TEST DRIVE!

ROBBERSON'L ~

® s un mu

mama ~

541-312-3986 DLR ¹0205

Financing available.

2060 NE Hwy 20• Bend 877-266-3821 Dlr ¹0354

Good classified ads tell the essential facts in an interesting Manner.Write (located O Bend) 54'I -288-3333 from the readers view -not the seller's. Convert the X3 2 007, 99K facts into benefits. Show Blillw miles, premium packPeterbilt 359 p otable the reader howthe itemwill age, heated lumbar water truck, 1 990, help them insomeway. supported seats, pan3200 gal. tank, Shp This n oramic moo n roof, p ump, 4 - 3 hoses, advertising tip Bluetooth, ski bag, Xecamlocks, $ 25,000. brought toyou by non headlights, tan & 1/3 interest in well541-820-3724 black leather interior, equipped IFR Beech BoThe Bulletin n ew front & re a r Serring Central Oregonsince rgte nanza A36, new 10-550/ 931 brakes @ 76K miles, prop, located KBDN. Automotive Parts, one owner, all records, $65,000. 541-419-9510 Chevy Ext. Cab 1991 very clean, $1 6,900. Service & Accessories with camper shell, www. N4972M.com 541-388-4360 ood cond., $1500 BO. 541-447-5504. Bid Now!

$150,000

www.sulletinsidnsuy.com

1/5th interest in 1973

BMW X3 2011 black

Cessna 150 LLC

150hp conversion, low time on air frame and engine, hangared in Bend. Excellent performance & affordable flying! $6,000. 541-410-6007

172 Cessna Share IFR equipped, new avionics, Garmin 750 touchscreen, center stack, 180hp. Exceptionally clean & economical! $13,500. Hangared in KBDN Call 541-728-0773 The Bulletin To Subscribe call 541-385-5800 or go to www.bendbulletin.com

Buy Hegr...Buy Local

You Can Bid On: $200 Automotive Shop Labor Retail Value $200 Advanced Auto Repair (Bidding closes Tues., April 15, at 8:00 p.m.)

Get your business

D odge R a m 15 0 0 Mega Cab 2006, V8 HEMI, 4WD, pw, pdl, tilt wheel, tow package, lift. Vin ¹146717 Stock ¹82918 $22,479

s u a ARU.

2060 NE Hwy 20, Bend. 877-266-3821 Dlr ¹0354

Dodge Ram 1500 SLT uadcab 1999

a ROW I N G with an ad in The Bulletin's "Call A Service Professional" Directory 932

Antique & Classic Autos

5 .2L V8 auto . , 1 43,659 mi. R W D Vin ¹628726 Bar-

gain Corral. $5,977

on black, sport/prem packs, leather, 3.5i turbo, nav., 20k

2180 TT, 440 SMO, 180 mph, excellent condition, always

hangared, 1 owner for 35 years. $60K.

Ford T-Bird, 1966, 390 engine, power everything, new paint, 54K orig. miles, runs great, exc. cond.in/out. $7500 obo. 541-480-3179

cold weather pkg, Xenons, warranteed to 9/2015.$38,000 One owner,

cllleocn ~

Tick, Tock Tick, Tock... ...don't let time get away. Hire a professional out of The Bulletin's "Call A Service Professional" Directory today!

A ero Commander, 4 seat, 150 HP, low time, full panel. $23,000 obo. Contact Paul at 541-447-5184.

TURN THE PAGE For More Ads The Bulletin

International Harvester TD6 Bulldozer, older model, has logging winch in back for skidding or dragging. $3500 obo. Call 541-389-5353 or 541-647-8176

$9,979

DLR¹0205

Chrysler 2012 Town & Country Touring steel blue, 27,000 mi. ¹223391 $ 2 1 ,995

541-598-3750

aaaoregonautosource.com

Chrysler Town & Country LXI 1997, beautiful inside out, one owner, nonsmoker,. loaded with options! 197,892 mi. Service rec o rds available. $4 , 950. Call Mike, (541) 8158176 after 3:30 p.m.

Honda Odyssey

541-593-2312 or 541-977-7588

Ford F-350 2010 Cabela'sCrew Cab

Ford Edge 2011

Leather trimmed heated seats, AWD, auto. 6 speed. vin ¹A50096 $26,997

ROBBERSON clnoocll ~

V8 diesel, 4 wheel drive. ¹A74567

ataaaa

541-312-3986 DLR ¹0205

$39,777

541-312-3986 DLR¹0205

Ford Thunderbird 2004 Convertible

with hard & soft top, silver with black interior, all original, very low mileage, in premium condition. $19,900. 702-249-2567 (car is in Bend) Kia Soul+ 2012

975

Automobiles

mama ~

CorvetteCoupe fuel/synthetic oil, garaged/covered. Bose Premium Gold system. Orig. owner manual. Stock! $10,500 OBO. Retired. Must sell! 541-923-1781

miles, 28 MPG Hwy, vin¹438072 $13,977 ROBBERSON w neoc» ~

~ata m a

541-312-3986 DLR ¹0205

Where can you find a helping hand? From contractors to yard care, it's all here in The Bulletin's Audi A4 2011, 34K mi. $22,000. Call "Call A Service 541-389-8181 Professional" Directory

Chevrolet HH R

LS 2009, tow pkg, FWD, Mazda Miata 1997 remotge keyless enM-Edltion try. V i n ¹ 61 8 685, Mica Green, 5-spd, Stock ¹43663C All power options, $9,979 leather, convertible boot, Tonneau © s u a aau Cover, synthetic oils, small alum. 2060 NE Hwy 20, Bend. trailer, extra set 877-266-3821 tires and rims Dlr ¹0354

$5995.

541-548-5648 Ford Escape Ltd 2012 Exc. cond! Silver gray m e tallic, Nissan Altima 2010 • %nr .. loaded, flex f u el, Ford F-350 4x4, Bluetooth, l e a ther (photo forillustration only) lj3 int., ski rack, keyless Chevrolet TrailBiazer entry, back-up sens 2003, auto, 4.2 liter, sors. new all season a lloy w heels. Vin tires, Ext. warranty. ¹ 103029, Stock Great all weather ve2.5S 4cyl., FWD, ¹44183A hicle! $22,000 CVT, 76k mi., 32 2006 XLT 4-door $5,979 Call or text Sandy at mpg„Tuscan Sun Crew Cab 541-480-4778 vin¹443778 ® s u a ARU. Metallic, $11,997 6.0L Turbo diesel, full 2060 NE Hwy 20, Bend. power, a u tomatic, ROBBERSON y 877-266-3821 6-disc CD, cruise, fog Lllloecn ~ ~ Dlr ¹0354 lights, running boards, tow pkg, bedliner, grill 541-312-3986 guard, folding rear DLR ¹0205 seat. Tan cloth interior, metallic tan exte- Jeep Compass Latirior. 91,400 miles. tude 2012, roof rack, spoiler, keyless entry, Priced to sell $21,500 Vin ¹508927, Stock 541-350-6925 Corvette 1979 ¹44165A L82- 4speed. $18,779 85,000 miles ® s u a a au Garaged since new. Olds 98 Regency 1990 Ford Ranger 1990 I've owned it 25 exc. shape, runs as K ing Cab, g o od 2060 NE Hwy 20, Bend. new, one owner, 20 years. Never damcond, new motor, 877-266-3821 mpg in town. New aged or abused. tinted windows, bed Dlr ¹0354 battery, stud snow liner, 2 sets tires, $12,900. tires $2000 dual pipe. Must see Dave, 541-350-4077 54'I-389-9377 to appreciate. $4000 Garage Sales obo. 541-948-9061 •

Buick Skylark 1972 17K orig. miles. Please see Bend Craiglist for details. $18,900. 541-323-1898 933

Pickups

Oarage Sales Garage Sales

FORD XLT 1992 3/4 ton 4x4 matching canopy, 30k original miles, possible trade for classic car, pickup, motorcycle, RV $13,500. In La Pine, call 928-581-9190

Mercedes Benz C300S ort 2012

2005 Diesel 4x4 Chev Crewcab dually, Allison tranny, tow pkg., brake controller, cloth split front bench seat, only 66k miles. Very good condition, Original owner, $34,000 or best offer. 541-408-7826

ton dually, 4 spd. trans., great MPG, could be exc. wood hauler, runs great, new brakes, $1950. 541-419-5480.

Less than 14k mil, AWD, 7 spd, leather vin ¹700716 $31,977

ROBBERSON clnoocll ~

ataaaa

541-312-3986 DLR ¹0205

goag

Just too many collectibles?

MoreP ixatBendbulletin,com On a classified ad 1996, 73k miles, Tiptronic auto. transmission. Silver, blue leather interior, moon/sunroof, new quality tires and battery, car and seat covers, many extras. Recently fully ser-

2003 6 speed, X50 added power pkg., 530 HP! Under 10k miles, Arctic silver, gray leather interior, new quality tires, and battery, Bose p remium sou n d stereo, moon/sunroof, car and seat covers. Many extras. Garaged, p e r fect condition, $59,700. 541-322-9647

Porsche Carrera 911 2003 convertible with hardtop. 50K miles, new factory Porsche motor 6 mos ago with 18 mo factory warranty remaining. $37,500.

Sell them in The Bulletin Classifieds go to www.bendbulletin.com to view additional 541 n385-5809 photos of the item.

VONOSE DANSANDSUY'S I

1000

Legal Notices

LEGAL NOTICE IN T H E CI R CUIT COURT O F THE STATE OF OREGON FOR THE COUNTY OF DES C HUTES Probate Department, In the Matter of the Estate of GLEN W.

ERNST, Deceased, Case No. 14PB0003. NOTICE TO INTERESTED P ERSONS. NOTICE IS HEREBY GIVEN that CODY W. ERNST has resigned as Administrator of the estate and that SHELBY DEE ERNST has been appointed as Successor Administrator of the estate. All persons having c laims against t he estate are required to present them, with vouchers attached, to the undersigned Successor Administrator a t 74 7 S W MI L L VIEW WAY, BEND,

OR 97702, within four months after the date of first publication of 541-322-6928 t his notice, o r t h e claims may be barred. All persons whose r ights may b e a f fected by t h e p r oceedings may obtain additional information from the records of Subaru impreza 2.5i the court,the Succes2011, 4 C y l., a uto, sor Administrator, or AWD, running lights, the lawyers for the n ice w h eels. V i n Administrator, ¹ 507659, Stock DANIEL C. RE. Dated ¹82824 and first published on $13,979 April 3, 2014. DEE © s uennnngogngnn.nna e A Ru SHELBY ERNST, S u ccessor 2060 NE Hwy 20, Bend. Administrator. 877-266-3821 LEGAL NOTICE Dlr ¹0354 NOTICE OF SALE Mark G. R e inecke, Successor T r ustee under the Trust Deed e. d escribed bel o w, hereby elects to sell, pursuant to Oregon Sta t utes Subaru Legacy 2.5 GT Revised Limited 2005, loaded, Sections 86.705 to 86.795, the real propleather, roof, a l loy wheels. VIN ¹210360, erty described below at 1 at 10:00 a.m. on Stock ¹42935A June 10, 2014, on the $12,979 f ront steps o f t h e ® s u a ARU. Crook County Court300 NE Third 2060 NE Hwy 20, Bend. house, Street, Prineville, Or877-266-3821 egon. All obligations Dlr ¹0354 of performance which are secured by the Trust Deed hereinafter described are in default for reasons set forth below and the beneficiary declares all sums due under Subaru Legacy 3.0 R Limited 2008, 6 Cyl., the note secured by auto, AWD, leather, the trust deed d em oon r o of , re a r scribed herein immespoiler, alloy wheels. diately due and payable. G R ANTORS: Vin ¹207281, Stock Joseph A. Miller and ¹82547 Krista A. Miller. BEN$23,979 FICIARY: Ha n n e © s u a ARU. EHollander. T R U ST 2060 NE Hwy 20, Bend. DEED RECORDED: August 15, 2013, in 877-266-3821 Book 2013, at page Dlr ¹0354 2 59523, Of fic i a l R ecords, Croo k County, Ore g on. P ROPERTY C O V ERED BY T R UST DEED: Parcel 141 of J UNIPER ACR E S Subaru Outback 3.0R UNIT 2, according to 2006, AWD, leather, the official plat thereof roof rack, CD. Vin on file and of record in th e ¹ 300629, Stock t he office o f C ounty C l er k fo r ¹82891 Crook County, Or$14,979 DEF A ULT: © s u a aau egon. F ailure to p ay : 1 . 2060 NE Hwy 20, Bend. Regular i n stallment payments for A p ril 877-266-3821 2013, May 2013, July Dlr ¹0354 through D e cember 2013 and J a nuary 2014, at $600.00 each for a total of $ 5,400.00; 2. L a t e charges of five percent (5%) of e ach payment not received within fifteen days of its due date for a total amount of $270.00; 3. Trustee's Sale Guarantee: $420.00. SUM OWING ON OBLIGATION SECURED BY TRUST DEED: Princ ipal b a lance o f $90,690.00 with intere st at s e ven a n d one-half percent per annum from April 1, a ] 2013, until paid. Notice is given that any a I ' person named pursuant to Section 86.753. Oregon Revised Statutes, has the right to have the foreclosure proceeding dismissed and the trust deed reinstated by curing the above-described defaults, by payment

SIIPERIO REElECloN OFMEI elIIKEO

a a

I nternational Fla t Bed Pickup 1963, 1

WHEN YOU SEE THIS

ALL,NEW STATEOF THE ART DEALERSHIP!

Find them in The Bulletin Classifieds

541-385-5809

I M aaa

Ford Thunderbird 2002 c o nvertible with brand new tonCheck out the neau cover, white classifieds online with grey i nterior, www.bendbulletin.com loaded, 88,600 low Updated daily miles, choice condition, eve r ything works. Great fun car to d r ive. I l l ness Porsche 911 Turbo forces sale. price reduced to $13,250. Bill Call 541-604-9307

.'I

1996, 350 auto, 135k, non-ethanol

clnoecll ~

viced, garaged,

automatic, 43k

Ford Bronco II 4x4, 1989Automatic, power steering, stereo upgrade, set-up to tow, runs good. $1700. 541-633-6662

6,977 ROBBERSON i

Place a Bulletin help wanted ad today and reach over 60,000 readers each week. 541-598-3750 Your classified ad will also appear on www.aaaoregonautobendbulletin.com source.com which currently receives over 1.5 million page views every month at no extra cost. Bulletin Classifieds Get Results! Call 385-5809 or place V olvo S40 T 5 2 0 0 5 your ad on-line at AWD, sunroof, lux/winter bendbulletin.com pkgs, new tires, more! $6775 obo.541-330-5818

looks and runs like new. Excellent condition $29,700 541-322-9647

940

2.0L 4 cyls, FWD,

541-647-8176

WHEN ONLY THE BEST WILL DO!

T-Hangar for rent at Bend airport. Call 541-382-8998. Trucks & Heavy Equipment

Power Stroke diesel, turbocharged, S-spd, good runner & work truck. $4500 obo. Call 541-389-5353 or

ROBBERSON

Sunriver Hangar - Hard to find T-Hangar located at Sunriver Airport will accommodate m os t si n gle engine and small twin aircraft. A u tomated b i-fold door i s a p 2012 Chevrolet proximately 40'x11'. Silverado LT 4x4Equipped with elec- 5.3 V8, Flexfuel, 14K t ric w i nch & n e w miles, Extended fluorescent lighting in Cab, tow pkg, Per2013. H o m eowner formance 20" dues are assessed wheels, Sirius XM, each January. HOA OnStar, bedliner, dues cover hazard inSnug Top, s urance, grou n d like new! $28,500. lease, snow removal 541-923-8868 and acco u nting. Self-serve f ue l is Silverado 2500 available at airport of- Chev f ice. $85,0 0 0 . 2007 HD ExtCab LT 4x4 V8, 6.6 diesel. MLS201108365 ¹E591992 $35,995 Clyde Browning, Principal Broker, 541-480-4520 Eagle Commercial Real Estate 541-598-3750 www.aaaoregonautosource.com Find exactly what you are looking for in the CLASSIFIEDS

916

Ford Mustang 2004, V8, manual, RWD, power seats, r e ar spoiler, leather. VIN ¹ 232501, Stock ¹82459A

541.312.3986

Vin¹572987

Bar ain Corral

Porsche 911

2060 NE Hwy 20, Bend. 877-266-3821 Dlr ¹0354

~ata a a a

mi., 29 mpg Hwy,

Looking for your next employee?

Carrera 993 cou

ral $9,977 w neocn ~

FWD, V6 auto., 90k

541-312-3986 DLR ¹0205

ROBBERSON

Dodge Ram 2500 2008 Diesel, exc. towing vehicle,

Find exactly what you are looking for in the CLASSIFIEDS

c raft. 1 96 8

4.7L V8, 4WD, auto., 16 mpg Hwy, Vin¹ 66902 Bargain Cor-

1999. Very good cond. Runs well, Two sets of tires on rims - summer and winter. $2500.

541-312-3986 DLR¹0205

Ford 3/4 ton F250 1993

Save money. Learn to fly or build hours with your own air-

(Portland)

2WD, 55,000

Rolls Royce 1992 Silver Spur II,excellent! Midnight Blue exterior, Parchment leather interior, 15-inch chrome RR wheels, Alpine Sirius DVD/CD/AM/FM/GPS navigation system, 77,200 miles, dealership maintained, always garaged. New, about $250,000; sell $19,500. 541-480-3348

503-358-1164.

,t.k tfts

503-789-9401

ROBBERSON

miles. New batteries, rear air bags, In Madras, Roll-n-lock bed call 541-475-6302 cover, spray-in liner. 5th wheel People Lookfor Information Plymouth B a rracuda hitch available, too. About Products and 1966, original car! 300 $19,000. 541-604-1285 hp, 360 V8, centerServices EveryDaythrough The Bulletin Classieeds lines, 541-593-2597

Cessna 182Q, 1977, mid-time engine/ prop, custom panel, S-Tec 30+ altitude hold, Garmin 430, GPSS, oversized tires, digital fuel flow, excellent paint & interior. Must see to appreciate. Asking $68,000. Bill, 541-480-7930

Grand Sport - 4 LT loaded, clear bra hood & fenders. New Michelin Super Sports, G.S. floor mats, 17,000 miles, Crystal red. $42,000.

Toyota Landcruiser VX 1999

miles, 19n wheels,

Chev Trailblazer LS 2004, AWD, V6, remote entry, clean title, 12/15 tags, $5995. 541-610-6150

1974 Bellanca 1730A

CORVETTE COUPE Glasstop 2010

Vans

ggs aeaatsraa et a aaer tasss

T oyota Camry LE 2012

Pontiac Grand AM SE1 2003

SMOLICHVOLVO.coM

of the entire amount due (other than such portions of principal as would not then be due had no default o ccurred), and b y paying all costs and expenses actually incurred in enforcing the obligation and trust deed, together with trustee's and attorney's fees, at any time prior to five days before the date last set for the sale. NOTICE TO TENANTS: If you are a tenant of this property, foreclosure could affect your rental agreement. A purchaser who buys this property at a foreclosure sale has the right to require you to move out after giving you a 30-day notice on or after the date of the sale. If you have a fixed-term lease, you may be entitled to receive after the date of the sale a 60-day notice of the purchaser's requirement that you move out. To be ent itled t o ei t he r a 30-day or 60-day notice, you must give the trustee of the property written evidence of your rental agreement at least 30 days before the date first set for the sale. If you have a fi x ed-term lease and cannot provide a copy of the rental agreement, you may give the trustee o ther w r itten e v i dence of the existence of t h e r e ntal agreement. The date that is 30 days before the date of the sale is May 11, 2014, the name of the trustee and t h e tr u stee's mailing address are listed on this notice. Federal law may grant you additional rights, including a right to a longer notice period. Consult a lawyer for more inf o rmation about your rights under federal law. You have the right to apply your security deposit and any rent you prepaid toward your current obligation und er y o u r ren t a l a greement. If y o u want to do so, you m ust n o tify y o u r landlord in writing and in advance that you intend to do so. If you believe you need legal assistance with this matter, you may contact the O regon State Bar and ask for the lawyer r eferral service. Contact information for the Oregon State Bar is inc luded w ithin t h i s notice. If you have a low income and meet federal poverty guidelines, you may be eligible for free legal assistance. Con t act information for where you can obtain free legal assistance is included within this not ice: OREGO N STATE BAR, 16037 SW Upper Boones Ferry Road, Tigard, Oregon 97224, (503) 620-0222, (800) 452-8260, http://www.osbar.org. DIRECTORY OF LEG AL A I D PRO GRAMS: http://www.oregonlawhelp.org. MARK G. REINECKE, Successor Trustee.

LEGAL NOTICE

Public Auction Public Auction to be held on Friday, April 18th, 2014 at 11:00 am at All Star Storage, 136 SW Century Drive, Bend, Oregon 97702. (Unit ¹ 0 328 Kellen J. Montgom-

ery).

PUBLIC NOTICE Tumalo Town District improvement Company is holding its annual mem b ership meeting on Tuesday April 22, at 6:30 p.m. at Tumalo Commun ity Hall , 646 7 1 Bruce Ave. in Tumalo.