Photo by Jon Klemme INSIDE A Look Back at Summer . . . . . . . . . 10 Local Family Profile 12 Snapshot of Summer Sports 16 Community Growth 20 Big Sioux Basketball 24 Business Profiles 28-30 Business Directory 32 FALL 2022 BACKTIGERSONCAMPUS! Harrisburg School District welcomes back students for 2022-23 school year .
2 Learn more at: ShowplaceCareers.com At Showplace Cabinetry, we are 700+ employee-owners strong and we build 800+ cabinets a day for 1,000+ dealers nationwide. We are always looking for good people to join our manufacturing and office teams as we grow. Take advantage of our competitive benefits like 13 paid personal-timeoff days, 8.5 paid holidays, day shifts only, great retirement plans, comprehensive insurance plan options and onsite cafe, gym and medical amenities. PROUDLY GROWING IN AND WITH HARRISBURG.
4 CONNECTING THE HARRISBURG COMMUNITY Natural gas — energy you can count on. For over 100 years, NorthWestern Energy has safely and efficiently delivered reliable energy. We provide natural gas to more than 60 South Dakota communities, and we’re expanding to serve even more. Natural gas is more affordable and prices tend to be more stable, compared to propane. From cooking dinner on the stove to running your furnace, natural gas is always available when you need it. Call our South Dakota office or visit our website to learn more about natural gas and how you can get your home or business connected. NorthWesternEnergy.com/SDNaturalGas1-83-FOR-BUILD THE BRIDGE “The Bridge” is published quarterly by AGE Media & Promotion in partnership with the Harrisburg School District, the Harrisburg Chamber of Commerce and the City of Harrisburg. Age Media & Promotion | www.agemedia.pub PUBLISHERS Garrett and Mindy Gross, AGE Media | (515) 231-9367 EDITOR Bob Fitch, AGE Media | (712) 551-4123 | bob@agemedia.pub PHOTOGRAPHER | Jon Klemme ADVERTISING SALES Garrett Gross, AGE Media | (515) 231-9367 | garrett@agemedia.pub © AGE Media & Promotion All rights reserved. Content in this magazine should not be copied in any way without the written permission of the publisher. Content in articles, editorial and advertisements are not necessarily endorsed by AGE Media & Promotion. CONTENTSADVERTISERS American Electrical Construction 31 American State Bank 3 Baker Audiology 14 City of Harrisburg TextMyGov .............................. 15 Complete Benefits 14 Edward Jones Brock Aldrich 7 Escape 605 7 Fiegen Construction 15 First Class Dental .............................................. 9 Harrisburg Family Chiropractic 26 Jim’s National Transmission ................................ 29 Kids R Kids 23 Mariner Wealth Solutions 27 Midco 19 Northwest Energy 4 Reliabank ...................................................... 18 Sanford Health 36 Security National Bank ........................................ 5 ServPro 25 Showplace Cabinetry 2 SF Specialty Hospital – Dr. Hruby 16 SF Specialty Hospital – Urgent Care 7 Sioux Valley Coop ............................................. 31 The Select Companies 35 Ultimate Automotive 17 Wireless World 31 From the Mayor 6 From the Chamber 8 Summer in Harrisburg 10 Family Profile 12 New City Text Service 15 HHS Summer Sports ..................................... 16-17 Community Growth 20 HHS School Contacts 23 Big Sioux Basketball/Volleyball 24 Jane Klemme Column 27 Business Profile: Midco 28 Business Profile: Sioux Valley Coop 30 Harrisburg Business Directory . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 32
5THE BRIDGE | FALL 2022 Anyone can get the job done, but doing it right is a different matter entirely. That’s why, at Security National Bank, we’ll dot the i’s and cross the t’s and take care of all the little things that impact your bigger picture. The details matter around here because you matter to us. SNBSD.comMember FDIC
Derick Wenck
605-743-5872 | www.harrisburgsd.gov 301 E. Willow St., Harrisburg SD 57032 City Administrator Andrew Pietrus 605-743-5872 Communications Larry Klipfel 605-767-5078 Deputy Building Official . . . . Brandi Savage . . . . 605-767-5011 Engineer Stockwell Engineers, Inc 605-338-6668 Finance Deb Harris 605-767-5008 Library 605-767-7910 Mechanical Inspector . . . . Steve Robertson . . . . 605-595-3527 Parks and Recreation Jason Thurston 605-213-1000 Police/Lincoln Co Sheriff Non-emergencies 605-764-2664 Planning & Zoning Michael McMahon 605-767-5010 Public Works Toby Huizenga 605-767-0075 Utilities (water/sewer) . . . . . . . . . . . . 605-743-5872 COMMUNITY GARDEN 48 individual gardening plots are available to all Harrisburg residents for the price of just $35 00 per plot Applications are available at www harrisburgsd gov HARRISBURG BASEBALL Information and applications can be found at www harrisburgtigersbaseball com TIGER SOFTBALL CLUB The TSC is a nonprofit organization providing softball for youth ages 5-16 Registration is available at www tigersoftballclub com CABLE TELEVISION SERVICES Vast 877-633-4567 Midco . . . . . . . . . . . . . . . . . . 800-888-1300 Electricity, Xcel Energy (Zone 1 includes most areas) 800-895-4999 Electricity, Southeastern Electric (Zone 2, Greyhawk Addition) 800-333-2859 GARBAGE SERVICES Novak Sanitary 605-338-7126 Waste Management . . . . . . . . . . . . 605-906-6039 A-Ok Sanitary 605-331-1103 Bolte’s Sunrise Sanitation 605-361-7936 RBS Sanitation 605-213-3021 Roo’s Sanitation 605-498-1588 Sweeney Sanitation Services 605-630-1734 INTERNET SERVICES WOW 877-633-4567 Midco 800-888-1300 HughesNet www .hughesnet .com Natural Gas, Mid American . . . . . . . . . . . . 888-427-5632 TELEPHONE SERVICES Vast 877-633-4567 Midco 800-888-1300 Qwest 800-244-1111 GENERAL CONTACT INFO FOR HOMEOWNERS
is making a greater investment in public safety. The City and the Lincoln County Sheriff’s Office have agreed to a new contract that includes a substantial increase financially in terms of deputies covering City Limits. The City’s latest agreement with the Harrisburg Community Fire Department also includes increased financial support of the Fire Department’s goals of purchasing a ladder truck and establishing a sub-station on the city’s western edge.
Each year volunteers from local businesses and organizations pitch in to clean, maintain, and beautify our City parks or support events within the community. We welcome civic organizations, schools, clubs, and interested citizens who wish to help. We can set up a volunteer project just for your group. Think of it as way to carry on a small investment in your community.
Mayor Derick Wenck, City of Harrisburg Mayor Derick Wenck HARRISBURG
FROM MAYOR Hi, I’m Derick Wenck. My wife, Melissa, and I moved to town 15 years ago and have sincerely enjoyed the support of the community. We have a daughter starting as a sophomore and a son starting 7th grade. I own and operate a small taxidermy business here in Harrisburg.Ifyou’renew to town, welcome to Harrisburg! We’re a growing community with lots to show you. We anticipate that the population of nearly 8,000 will climb to more than 12,000 by 2030 and reach 18,000 by 2040. Look around and you’ll see that our community continues to make strong investments. Infrastructure projects that improve utilities and traffic corridors are key to a successful transportation network. They support the commercial and residential development that continues to find space and begin construction. Investing in our quality of life is important, too. Significant effort has been made to polish our Central Park master plan and bring that vision forward. A new ADA accessible playground was installed at Hugh Robinson Park through the efforts of the Parks & Recreation Board and the Parks Department. I hope you can make your way over to enjoy it along with the newly built picnic shelter. We’ve also placed additional effort in community programming that offers activities for the entire Harrisburgcity.
INVESTING IN OUR QUALITY OF LIFE IMPORTANT LOCAL CONTACT INFO CITY OF
In September, the City will roll out TextMyGov – a smart texting technology that will improve communication with residents. Using your regular messaging service, you can connect with the city from anywhere on just about any topic. This enhancement will streamline requests to City Hall and provide added benefits to workflow for staff members. Read more on how to sign up in this issue of The Bridge.
THE
6 CONNECTING THE HARRISBURG COMMUNITY
7THE BRIDGE | FALL 2022 URGENT CARE SIOUX FA URGENT CAR X FALLS T CARE SIOUX FALLS URGENT CARE SIOUX FALLS URGENT CARE ALLS RE SIOUX FALLS URGENT CARE SIOUX FALLS SI URG SOUX IOUX W e e k d a y s : 7 A M - 7 P M W e e k e n d s : 8 A M - 5 P M 605.444.8860 I 7600 S. Minnesota Ave. Proud to be Physician Owned Pneumonia Strep Throat Infections Stomach Aches Headaches Heat Stroke Dehydration Urinary Tract Infection Sprains Strains Fractures Cuts Scrapes Burns Colds Flu Bronchitis URGENT CARE EURG IRT-1948J-A edwardjones.com Member SIPC Brock Aldrich Financial Advisor 225 N Cliff Avenue 5 Harrisburg, SD 57032 605-777-1566
Harrisburg is a better place to play baseball than ever before with the dedication of Dakota Access Field. Energy Transfer, the parent company of Dakota Access Pipeline, made a donation of $175,000 to upgrade the baseball and softball fields in Harrisburg’s Central Park. On hand at the ribbon cutting ceremony this summer were representatives of Dakota Access Pipeline, the Harrisburg Community Foundation, the Harrisburg Baseball Association, the City of Harrisburg and the Harrisburg Chamber. Photo courtesy Harrisburg Chamber of Commerce. BALL!
Harrisburg has so much to offer throughout the year, but I hope you’ll especially take advantage of the opportunities this fall to experience all that Harrisburg has to offer. Come “fall” in love with Harrisburg! Chair of the Board, Harrisburg Chamber of Commerce Adrienne McKeown HARRISBURG CHAMBER OF COMMERCE Carrie Bell, Executive Director director@harrisburgsdchamber.comwww.harrisburgsdchamber.com605-777-9120 220 S. Cliff Avenue | Harrisburg SD 57032
PLAY
8 CONNECTING THE HARRISBURG COMMUNITY MESSAGE FROM THE CHAMBER “FALL” IN LOVE WITH HARRISBURG
It sounds so cliché, but I’m going to say it anyway. Where has the year gone? It seems like we just turned the calendar to 2022, and now we’re in back-to-school season and staring down the barrel of another busy fall that will lead right into the holiday season. At the Chamber of Commerce, we’re gearing up for a fall frenzy of activity. Like many of you, I can’t wait for Tiger Stadium to fill up with the sounds of Friday night football games. No doubt many of you will be driving down from southern Sioux Falls to cheer on our returning state champs, so on behalf of our member businesses within the city limits of Harrisburg, I invite you to make a night of it! Come down early before the game and grab some pre-game snacks at Fresh Horses, Big J’s, Subway, Harrisburgers, or Milky Way. Or fill up your gas tank and your tummy tank at Friendly’s or the newly opened Sioux Valley Cooperative. Both have great options for grab-and-go hot food for your tailgate party. And don’t forget to stop in and visit our local businesses after the HHS Homecoming parade on Friday, Sept. 16. Before you head home with your buckets of candy, stop in at Fareway or Dollar Fresh to grab some groceries to balance out all that sugar! Their small-town service will get your weekend started off right.Aswe turn the page to October, we’ll keep the candy coming with our annual Business Trick or Treat event. Held on the Friday afternoon before Halloween (Oct. 28 this year), this event is a perennial favorite for kids who love candy and parents who love getting an extra wear out of those Halloween costumes. If you haven’t already done so, make sure to like and follow us on Facebook so you’ll see all the details about which member businesses will be participating. It’s always a great time, and we again invite you to stick around and spend your Friday afternoon and evening supporting our Chamber members. After getting your fill of candy (again), take the opportunity to support our small businesses (again) by filling up your gas tank, grabbing your groceries, and enjoying dinner out. Of course, it wouldn’t be fall without a visit to the apple orchard and pumpkin patch! We are lucky to have Country Apple Orchard right here in Harrisburg, and you won’t want to miss their fall lineup of fun throughout September and October. From a petting zoo to zip lining to enjoying fallinspired brews on tap, you’ll find more than just apples at this orchard—although I can say from personal experience that shooting the apples out of the cannon is quite entertaining!
At FIRST CLASS DENTAL CARE we provide first class service and first class smiles. We’re here to help you achieve your dream smile, whether that means a routine cleaning or beyond. We offer it all, including dental implants and ClearCorrect clear aligners to straighten teeth invisibly. *This plan is only honored at First Class Dental Care. This membership is NOT a dental insuranceClearCorrectplan. clear aligners straighten teeth braces.withoutinvisibly,metal SCHEDULE AN APPOINTMENT WITH DR. BEECROFT TODAY! 6703 S Louise Ave, Sioux Falls, SD 57108 605.271.9330 | FirstClassDentalCare.com
A LOOK BACK AT HARRISBURG DAYS Photos on pages 10-11 by Jon Klemme
11THE BRIDGE | FALL 2022 Even with temperatures of 100 degrees, many Harrisburg residents came out to enjoy the food and fun during National Night Out on Aug 2 Marv Rozeboom prepares his radio controlled airplane for takeoff at Lake Alvin Marv is a member of the Sioux Falls Sod Busters RC Club A walk around Lake Ole South Dakota Game Fish & Parks presented an archery event at Lake Ole this Kidssummerhadfun with members of the Harrisburg Fire Department on National Night Out OFSNAPSHOTSSUMMERINHARRISBURG
By Bob Fitch
12 CONNECTING THE HARRISBURG COMMUNITY LOCAL FAMILY PROFILE | AHRNDT
Sheldon told Jackson, “You know, you keep on learning a few more things this summer and by next year, you could be my right hand man. He said, ‘I’ll be ready. I could be a teacher next year.’”
This year, Sheldon volunteered to lead and mentor the city of Harrisburg’s new youth garden club. Just one problem: Only one young man joined – Jackson Blom, son of Nathan and Ashley Blom. However, like a preacher who still delivers a full load to a congregation of one, Sheldon followed through and has spent many hours this spring and summer teaching and mentoring Jackson.
Sheldon Ahrndt and his wife, Jan, are originally from west central Minnesota. Both grew up in families with large gardens. Jan did much of her family’s garden work and gardened for 4-H. Sheldon was one of the first three people in Swift County to become a Master Gardener.
Today, in Sheldon and Jan’s backyard, there’s not a blade of grass to be found. Instead, the yard is a vegetable lover’s paradise.
An abundance of produce and good cheer is what you’ll find when you sit down to visit with Sheldon Ahrndt, an 80-year-old retired farmer and factory worker who is willing to lend a hand to youth and military veterans
VEGETABLE GARDEN IS ‘HEAVEN ON EARTH’
The backyard of Sheldon and Jan Ahrndt includes a cornucopia of vegetables and fruits Jackson Blom raised vegetables in two plots at Harrisburg’s community gardens this summer Sheldon Ahrndt educated and mentored Jackson on plants and garden
Each spring Harrisburg families are welcome to plant their own garden plots at the city’s community garden. Each plot is only $35. The city tills the soil in the spring and furnishes the water.
“It’s really fun to just go and work with the kid. Jackson is really into this and it’s going pretty good for him,” Sheldon said. Initially, Jackson’s gardening knowledge was very limited, but he “picked up on it real quick. At the start, he didn’t know which were the vegetables and which were the weeds. But a couple of weeks ago his dad was helping him pull some weeds and Jackson said, ‘Dad, you missed a couple.’ I got a kick out of that.” Jackson planted family favorites like sweet corn, tomatoes, carrots, peas, beans, onions and Brussels sprouts.
Jan Ahrndt cans up to 1,000 containers of vegetables, fruits, soups and sauerkraut every year
When they moved in, Ahrndt’s Harrisburg yard was overrun with pigweed, thistle and bind weed. “Over the years, we just kept on digging and pretty soon we had pretty much all of that out of our garden. Today, we don’t use any chemicals for weeds, none whatsoever. We pull everything out. You can see it’s clean,” he said.
Sheldon and Jan share their fresh and canned produce with family members and with the families of localInveterans.addition to sharing food with veteran’s families, the couple cares for the geraniums at the American Legion memorial at the Harrisburg Cemetery. When hail damaged the geraniums at the cemetery this year, Sheldon and Jan re-planted them with generous support from Tannenbaum Tree Farm, located southwest of Sioux Falls. Sheldon also performs color guard duties with members of Harrisburg’s American Legion Post 45. Before Covid, Sheldon and Jan would spend time at the VA Hospital playing bingo and visiting with the residents there. He served six years in the Army National Guard at Fort Leonard Wood. He was a mortar squad leader and was two months away from going to Vietnam when President Nixon started pulling troops out of the country.
GARDEN
ApplePeachesPearsPicklessauce
• Put eggshells around the roots of tomatoes and peppers when planting to prevent blossom end rot
CarrotsCabbageBroccoliBlueberriesBeetsAsparagusApples StrawberriesRhubarbPotatoesPearsPeachesOnionsCucumbers
• To control blight on tomatoes, mix a half cup of hydrogen peroxide into a gallon of water Spray tomatoes with the mixture once a week
• In the fall, turn your garden’s soil and plant stalks Then rake it, level it off, and plant in the spring
IN THE AHRNDT IN JAN’S PANTRY
• Instead of wrapping fruit trees, paint the southwest half of the trunk with a 50% dilution of latex paint to prevent sun scalding and bark peels “Just use some old latex paint, interior or exterior, it doesn’t matter It works and it’s cheap .”
Sheldon and Jan moved to Harrisburg about 10 years ago to live close to their daughter, Laurie; her husband, Ryan Dokken; and their children – Mariah and Nate are both HHS graduates and Sam is a sophomore. Laurie works for the Sioux Falls School District and Ryan works for North Central Insurance. Sheldon and Jan have two other daughters, Roxanne, who lives in Des Moines, Iowa; and Andrea, who lives in Racine, Minn.
13THE BRIDGE | FALL 2022
Jan Ahrndt cans 500-1,000 jars of food per year, including almost everything grown in their garden . The shelves also include jars of homemade:
HamChili and bean soup Stuffed pepper soup Sauerkraut
• Pull your weeds and put them in the trash Don’t leave them on the ground where they can re-anchor or re-root themselves .
Six years ago, the Ahrndt’s hosted Master Gardeners for a tour of their garden. About 250-300 attended and many returned over the next several weeks to show their family members. “This one little lady who came over, she said, ‘I’ve got to tell you something. You know, when I die and I go to heaven, I hope it looks just like your backyard, because this is like heaven on earth.”
A SAMPLING OF SHELDON’S GARDEN TIPS
• Soak peas overnight before planting . “They’ll come up quicker .”
String WatermelonSunflowersSweetSweetSweetbeanscornpepperspotatoes
siouxfallshearing.comElizabeth“Libby” Benson, Au.D., CCC-A, FAAA
14 CONNECTING THE HARRISBURG COMMUNITY Hear what you’ve been missing. Melissa Baker, M.A., CCC-A, FAAA We are an advanced hearing practice that specializes in diagnosis, treatment, and prevention of hearing loss for all ages. Hours: Mon-Thurs 9am-5pm • Fri 9am-12pm 429 W 69th St • Sioux Falls, SD (Southwest Corner of 69th St. and Minnesota Ave.) 21-22 WINNER 605.610.2886 •
COMPLETEBENEFITSINC.COMSOCIALSECURITYDEATH&TAXESMATTMATHIESEN President & Owner of Complete Benefits Brandon,605-582-85131408ECedarStSD57005 Plan for retirement today with Matt, your Social Security expert. WE HAVE THE ANSWERS SPECIFIC TO YOUR NEEDS.
Sheldon also enjoys color guard duty at Harrisburg High School football games. “We put up 50 flags at the games. It’s fun to go out there, and I’ll tell you why: Every time we take the flags down after the game, there are always kids who come up and say ‘You need help? We’ll help you take the flags down.’”
In addition, he appreciates the programs involving veterans at HHS and the elementary schools. After the school’s homecoming parade, American Legion members always remark about the group of daycare kids who stand along the road and salute the flag and veterans. Appreciating youth is part of who Sheldon and Jan are. When they still lived near Benson, Minn., they started an archery club. “That was a lot of fun. We probably taught about 300 grade school kids. Quite a few of those kids shot in the state indoor tournament.” In the adult ranks, Jan was a two-time state archery champion and also finished second and third. Sheldon captured the state championship once. The family still owns their farm in Minnesota. The land is enrolled in the federal government’s Conservation Reserve Enhancement Program. Five ponds were added to the property and the rest was seeded with switchgrass, high and low bluestem, and coneflowers. His brother cares for the wildlife food plots. Sheldon has been tending apple trees in his backyard which he grew from seed. Those trees are going to be transplanted in the wilderness on the farm to help fatten up the deer he and his family enjoy hunting there.
15THE BRIDGE | FALL 2022 The best part of our job is turning dreams into plans and plans into reality. As your partner, we’re built to help execute your plan every step of the way. Let’s talk about your dream project and how we can make it happen.NOFiegenConstruction.comDREAMTOO BIG. NO DETAIL TOO SMALL. Sanford Clinic — Harrisburg Smart texting technology evaluates your input and searches keywords to provide you with assistance anytime, day or night. 24/7 Assistance Opt in today, text to: What to Expect: ▪ After the initial keyword is sent, you will receive a confirmation message asking you to reply YES to verify opt in. ▪ Message frequency varies. Message and data rates may apply. Check with your carrier for more details. use your mobile phone's text messaging service to quickly report issues and/or find information on the go. Connect Via Text View terms and privacy policy info at: textmygov.com/opt in terms conditions Get Started Text or any of the featured keywords to: 605.777.0110 Powered by Harrisburg Alerts! Receive City Text Message Notifications! 91896 How to Opt Out: ▪ Text STOP at any time to remove yourself from the notification list. Issues & Find Information (Additional Service Option) City of HarrisburgTree IssuesCode Water RoadsIssues Bill EventsOrdinancesPermitsPayContact Report ReportHi HARRISBURG CITY OF HARRISBURG The City of Harrisburg is excited to bring residents TextMyGov. TextMyGov was developed to open lines of communication with local government agencies and citizens. The system works 24 hours a day and connects with the city’s website and other communication methods. Using the regular messaging app on any smartphone, the smart texting technology allows the citizen to ask questions and get immediate responses, find links to information on the city’s website, address problems and report issues, upload photos, and receive notifications. Depending on what you are trying to accomplish, TextMyGov can provide various types of responses such as: • Receive a quick answer to your question. • For information that can be found on your city’s website, links will be provided to direct you to the correct place. • When reporting an issue to the city, TextMyGov will guide you through a series of steps that allows you to submit all the necessary info and even allows you to upload a picture. Users may visit www.harrisburgsd.gov for additional information. DISCOVER ‘TEXTMYGOV’ IN HARRISBURG
16 CONNECTING THE HARRISBURGMadduxBraxtonCOMMUNITYKuslerSchererLincoln Carlson TIGERS KNOCK IT OUT OF THE PARK Photos on pages 16-17 by Jon Klemme The Harrisburg Tigers boys baseball team had a strong season, capturing third place at the South Dakota State Baseball Association class A tournament A Cold? The Flu? We're here for you. ...during cold and flu season and throughout the year. Dr. Brad Hruby Family Care "A division of Sioux Falls Specialty Hospital" "Proud to be Physician Owned and Operated" WEEKDAYS: 8AMW5PM EEKDAYS: 8AM - 5PM 7600 S. Minnesota Ave. Sioux Falls, SD 57108 (85th & Minnesota) sfsh com/family medicine/ Most insurance accepted
3209 S. Marion Road | (605) 371-2760 1400 E. 77th St. | (605) 367-9088 UltimateAutoSF.comay - y 7:30 a.m. to 5:30 p.m. Your Sioux Falls Dealer Alternative... And yes, we do oil changes! Computerized Engine Tune-Ups | Maintenance | Electrical Service | Transmission Repair Tires | Air Conditioning Service | Complete Brake Service Motor Replacements | Brakes & Suspension | & Much More! HHS GIRLS BRING HOME THE GOLD! The HHS Tigers girls golf team captured the South Dakota AA State Championship! Reese Jansa was the individual champion at the State AA Girls Golf Tournament She won by three strokes Mattie Weidenbach finished sixth during individual play at the State AA Girls Golf Tournament The State AA Girls Golf Champions pose for a selfie with their trophy Pictured: Reese Jansa, Izzy Driscoll (partially hidden), Brinly Sanderson, Mya Johnson (holding trophy), Mattie Weidenback (back) and Izzy Werth .
Sioux Falls | Colton | Hartford | Humboldt | Tea Estelline | Hayti | Hazel | Watertown BANKING YOU CAN RELY ON Experienced lenders that are ready to help with all of your business and ag needs.
19THE BRIDGE | FALL 2022 Get an A+ (Noconnectivity.instudyingrequired.) Life’s about to get busier! Whether it’s homework, work or the few minutes your family has to sit down together, you need a home setup that can keep up. Get more pow! with the speediest internet, TV and phone services from Midco®. Midco.com Internet. TV. Phone.
In anticipation of growth, some changes were made to open up space at Liberty Elementary (the original “Harrisburg School”), but as of the writing of this article, seven new subdivisions are currently underway in the Liberty and Freedom Elementary school zones.
20 CONNECTING THE HARRISBURG COMMUNITY 1960 1970 1980 1990 2000 2010 2016 2020 8,000 6,000 4,000 2,000 0 TOGETHER. BETTER
Addressing District & Community Growth Together
The time is now to address the needs of students in the southernmost portion of the District.
The school board realized a new elementary school would quickly be needed, and while Explorer Elementary’s location in the northwest corner of the District may have seemed like an odd choice at the time, it soon became surrounded by houses and apartments, opening in 2005. The continued development of new neighborhoods resulted in an expansion at the new high school to also include 8th graders, and the construction of Journey Elementary which opened in 2008. In 2009, Harrisburg High School at its present location opened with 425 students in total, and the previous high school location transitioned to Harrisburg Middle School. Since that time two additional expansions at the high school were constructed to accommodate increasingly larger class sizes coming up through the ranks, as well as an alternative school.
Our District has seen a 629% increase in student population over two decades, much of the growth in southern Sioux Falls, but also expanding into Harrisburg. The Harrisburg School District's boundaries cover 70 square miles, stretching west of I-29, north as far as 57th Street in Sioux Falls, east to Iowa's border, and south to 276th Street. The single K-12 building that served the District for over 100 years has expanded to 13 buildings in the last two decades. In 2002, a new high school was built on South Cliff Avenue.
RECENT GROWTH
A QUANTUM LEAP
STAYING AHEAD OF THE GAME 784 5,719 7,633 313 ResidentHarrisburgPopulation Harrisburg School District Student Population
If you’ve lived in or around the city of Harrisburg for any length of time, you’ve seen farm fields transform into foundations in every direction. If you aren't one of the original 558 residents who were here in 1980 or a descendent of them, driving past the many subdivisions in the community may not give you pause, but some of those residents may have "walked beans" where your house now stands or could drive 55 MPH all the way to 57th Street without stopping.
FARM FIELDS TO FOUNDATIONS
The Right Size at the Right Time. Between 2011 and 2020, four additional elementary schools have been built. In 2013, North Middle School opened, and Harrisburg Middle School became South Middle School.
Both East Middle School and Freshman Academy are currently under construction to relieve overcrowding at the high school and both middle schools and are expected to open in the Fall of 2023. With every new building, the school board and administration have anticipated future growth and planned accordingly. The school board’s commitment has always been to build the right size at the right time, without raising the mill levy and imposing any new burdens on taxpayers. The District has been able to do this through the continued growth in property valuation with the addition of new neighborhoods and businesses coming into the community.
Through the passing of bond elections, Harrisburg School District citizens have shown they value the District's foresight to stay ahead of growth and provide quality learning facilities for students.
HARRISBURG: CITY & DISTRICT GROWTH
Our most recent growth challenges are in Harrisburg proper. The city of Harrisburg itself has gone from a mere 558 residents in 1980 to over 7,366 in 2020 with an ever-present increase in population over the past few years.
21THE BRIDGE | FALL 2022
LIBERTY
Liberty Elementary is at capacity. Three of the seven subdivisions are located in this school zone, accelerating the need for additional space. Last year the Tiger Reserve program was moved to Adventure to make more room at Liberty. Additionally, Head Start was moved from Liberty to Freedom, which at the time, had the space needed to accommodate the program. GROWTH CHALLENGES AT LIBERTY
ON STUDENT ENROLLMENT NUMBERS
Above: Current subdivisions currently underway in the Freedom & Liberty School zones.
CURRENT
LIBERTY ZONE Dynamic FREEDOM ZONE CMillsreek Creekside FDevittarms Mydland Tiger Meadows Greyhawk Google Maps
CURRENT
WHAT CAN BE DONE? In order to maximize use of current facilities and ensure the right size is built at the right time without raising taxes, the District and school board held two public meetings in August and will consider holding a bond election this fall for the construction of a new elementary school. The location of the new building would be on the west side of South Cliff Avenue, about a half mile south of South Middle School. At present, the location is undeveloped, and would be annexed into the Liberty zone, without having to redraw boundary lines. WILL THIS SOLVE OUR GROWTH CHALLENGES? 1st or 2nd Grade* through 5th Grade NEW ELEMENTARYSCHOOL EARLY CHILDHOOD CENTER (CURRENT LIBERTY BUILDING) Pre-K, Head Start, Kindergarten, 1st Grade* FREEDOM ELEMENTARY Moving Early Childhood to current building would free up space at Freedom*DEPENDING E F
CURRENT GROWTH CHALLENGES AT FREEDOM Over the course of 100 years, Liberty Elementary was expanded with no fewer than eight additions, creating a multitude of wings. Classrooms in the building average about 720 square feet, while more modern classrooms in the District are about 25% larger. Recent school designs make better use of space and scheduling of those spaces, and include common learning areas. Though smaller classrooms do accommodate early childhood education well with smaller bodies and class sizes, it does create a disparity between the upper elementary grade students’ learning environments around the District.
E F Near Capacity At Capacity SOUTH END GROWTH
The Early Childhood programs including Head Start and Junior Kindergarten classes are currently housed at Freedom, which adds to the building’s current space shortage. The four subdivisions currently underway in this school zone will also push Freedom toward capacity in the near future. FELEMENTARY REEDOM ELEMENTARY
HOW
Dividing grades would give Freedom more room immediately and keep Liberty and Freedom students in their current school boundaries with their peers. Liberty's current upper elementary students will also benefit from larger classrooms.
WHY SPLIT THE GRADES INSTEAD OF BUILDING A NEW SCHOOL WITH NEW BOUNDARIES?
Combining resources between the District and city is a better use of taxpayer dollars than separate projects with separate price tags. It also lends itself to unlimited potential for the future of Harrisburg’s downtown corridor and future opportunities for business and community growth.
I HAVE KIDS IN BOTH PRIMARY GRADE LEVELS. HOW WILL THIS EFFECT PICK-UP/DROP-OFF?
CAN'T THE CITY JUST BUILD ADDITIONAL SPACE AND A COMMUNITY CENTER?
TIMELINE
22 CONNECTING THE HARRISBURG COMMUNITY 2001 2002 2003 2004 2005 2006 2007 2008 2009 2010 2011 2012 2013 2014 2015 2016 2017 2018 2019 2020 2021 2022 $15 $10 $5 $0 Design Phase WINTER 2022-2023 SPRING 2023 New ConstructionBuilding FALL 2024 Opening of New Elementary Building Liberty EarlyBecomesBuildingChildhoodCenter Renovation of Liberty North Wing to HSD Administrative Offices FALL/WINTER 2024 SPRING/SUMMER 2025 HSD Administrative Offices HarrisburgBecomecity Hall HSD Staff Move to North Wing of Liberty WHY DOES THIS PLAN WORK? YOU MAY BE WONDERING...
A UNIQUE OPPORTUNITY 11.970TAX LEVY PER $1,000
A unique opportunity exists for the Harrisburg School District and city of Harrisburg to create a partnership that would serve both entities and their patrons well into the future.
The District has plans to shuttle students between the new school and Early Childhood Center for ease of drop-off and pick-up for parents with students at both locations.
Demolishing the original school building and replacing it on the current campus would not be feasible economically, logistically, or in the spirit of preserving the heart and soul of what has made Harrisburg what it is today. Building two schools simultaneously would result in raising taxes.
Under a long-term lease with the District, the city of Harrisburg and residents would have use of secure spaces for community and library programming and additional office spaces. This plan would allow the city to utilize capital funds for infrastructure needs.
During non-school hours, the community would also have access to shared-use spaces including the Gym, Commons, and current Band Room. This would allow the District and/or city to offer Community Education classes, community event meeting locations, and indoor walking spaces - long-standing desires of both institutions. Another advantage would be decreased traffic at Liberty Elementary.
Equitable facilities for Liberty students Built with the future in mind as a full K-5 School if/when necessary Utilizing the current building for Early Childhood makes the best use of classrooms
HSD's commitment to a tax levy of less than $12.00 per $1,000 has been honored for over 20 years. No new boundaries would need to be made to elementary zones
Harrisburg community members and District patrons will also benefit from this plan.
Together the District and city can address their immediate needs while planning for future growth in a fiscally responsible manner. WHY NOT JUST TEAR DOWN THE OLD SCHOOL AND BUILD TWO NEW ONES?
23THE BRIDGE | FALL 2022 High School 1300 W. Willow, Harrisburg North Middle School............ 2201 W. 95th St., Sioux Falls South Middle School 600 S. Cliff Ave., Harrisburg Adventure Elementary 27220 472nd Ave., Sioux Falls Endeavor Elementary 2401 W. 95th St., Sioux Falls Explorer Elementary 4010 W 82nd St, Sioux Falls Freedom Elementary 1101 Tom Sawyer Trail, Harrisburg Horizon Elementary 5800 S. Bahnson Ave., Sioux Falls Journey Elementary 6801 S. Grange Ave., Sioux Falls Liberty Elementary 200 E. Willow St., Harrisburg HARRISBURG SCHOOL DISTRICT For all schools, call 200www.harrisburgdistrict41-2.org605-743-2567E.WillowSt.,HarrisburgSD57032 • 6 Weeks 12 Years • Mon Fri., 6:30am 6:30pm • Nutritious Meals/Snacks • Exclusive Curriculum • Highly Trained Teachers • Interactive Technology • Health & Safety Certified • Secure Online Parent Viewing 2201 W Trevi Pl Sioux Falls, SD 57108 605 215 1341 https://kidsrkids.com/prairie -hills/ Of Prairie Hills Continuing forward with Caring, learning and inspiring a world that matters. SCHOOLHARRISBURGDISTRICT SCHEDULE OF EVENTS Scan the QR code to see the HHS athletic event schedule Follow Harrisburg High School on Facebook . Scan the QR code to download the rSchoolToday App for iPhone
After reviewing the proposal, Showplace gave seed funding to get the league off the ground in the fall of 2007. Once the support set the wheels in motion, the real work started as Blaine and Jon started spreading the word around Harrisburg and surrounding communities. Phone calls were made to Canton, Tea, Sioux Falls Christian, Hawarden, Lennox and others. The response from these communities was great and teams were quickly assembled. That first season 23 boys teams grades 3-6 committed to play.
24 CONNECTING THE HARRISBURG COMMUNITY YOUTH SPORTS
BIG SIOUX BASKETBALL & VOLLEYBALL LEAGUES
There are times when the status quo is simply just not good enough. This was the reality in the spring of 2007 when several Harrisburg parents wanted more opportunities for their children to play basketball. At the time, there was really only one league for elementary age kids and that was at the YMCA in downtown Sioux Falls. For decades “The Y” had offered a league option for kids, but over the course of those years Sioux Falls’ population grew substantially and the number of kids who wanted to play exceeded the capability of what that organization could handle. Subsequently, the realities of gym space, practice time, referee availability and overall quality of the product was not at a high standard. This is when Harrisburg residents, Blaine Corlett and Jon Klemme, both parents of elementary-aged boys at the time, started talking on Blaine’s porch. “We simply knew we could do better for our kids than what was currently available,” said Blaine. This was also at a time when a sharp curve for population growth in Harrisburg was on the horizon. More and more and more kids would be facing the same issue that Blaine and Jon’s kids faced.
Showplace has always understood their role in community leadership and strives to support initiatives that promote youth, recreation and community engagement. Consequently, the idea for the league was a natural fit for them.
So they called their friend Bill Allen of Showplace Cabinetry. Bill is a lifelong Harrisburg resident who has been active in local sports as an athlete, coach and supporter his entire life. He was well aware of the situation regarding youth sports in the community. So the three of them started talking and put together a proposal of what they thought an elementary-aged, community-based league might look like. Bill took the idea to then-Showplace President Tony Bour and presented the plan.
A COMMUNITY SUCCESS STORY
As the years went on, more community members got involved and helped as the organization grew. These growing pains were eased by the vision of key contributors in leadership
The initial funding from Showplace went to uniforms, scoreboards, referees and gym space.
Adam Birger, Owner of SERVPRO of Sioux Falls Graduate of Harrisburg High School
“Our goal that first year was to provide a great value for the families and the best possible product for the kids,” Blaine said. “We wanted referees to show up on time, teams to have nice uniforms and gyms that were good for kids to play in.”
The second year of the league the number of teams doubled and the year after that the girls league was started which again greatly increased the number of kids involved in the program.
The early years of the league paralleled the period when the Harrisburg School District was opening a new elementary or middle school almost every year. This additional gym space was a great resource as the league grew and more courts were needed. The school district also bought into the vision of Big Sioux. Support from the district, it’s building administration, and work done by the building and grounds staff, played a huge part in the league’s success. The Harrisburg District and its activities directors have supported Big Sioux’s mission to ensure all kids have a fun, safe place to play recreational sports. Initially, concessions were run by the league, however over time this became too great an undertaking with multiple gyms and many trips to Sam’s or Costco. The board eventually partnered with area organizations and other entities to give them the responsibility for concessions which also turned into a fundraising opportunity for many groups.
25THE BRIDGE | FALL 2022 • Water Damage Restoration • Fire Damage Cleanup • Mold Remediation • Carpet Cleaning • Duct Cleaning • Basement Finishing (605) 231-5854 [servprowestsiouxfalls.com CONTACT US ]
Over the past 15 seasons, teams from communities as far as Mitchell, Pipestone and Sioux City have brought teams to play in the league. The basketball league is for boys and girls in grades 2 through 6. Big Sioux also offers a volleyball league September through November. It is estimated that over 30,000 kids have played in Big Sioux leagues, and now there are over 3,000 players playing basketball and volleyball each season.
Both leagues continue to epitomize the community spirit that Blaine, Jon and Bill set out to build when they first started talking on the porch in 2007. Big Sioux is an organization the community should take pride in; it epitomizes an example of a community working together to improve opportunities for kids of all skill levels and backgrounds both locally and regionally. Big Sioux will continue to make impacts on youth and the community far beyond after the games are finished.
26 CONNECTING THE HARRISBURG COMMUNITY
Big Sioux Basketball Association founders Jon Klemme, Bill Allen and Blaine Corlett
303 W Willow Street, Harrisburg, SD, 57032 Call (605) 767 7463 today to schedule your appointment.
Ashley Mayland, DC At Harrisburg Family Chiropractic, we are dedicated to helping you achieve your personal goals— combining skill and expertise in chiropractic and massage therapy. For more information, www.harrisburgfamilychiropractic.comvisit
Ashley Mayland, DC
Call 605-767-7463 today to schedule your appointment.
Big Sioux Basketball and Volleyball are two great examples of what can happen when a community works together to find solutions. The road to build the organization to what it is today didn’t happen on its own and it wasn’t easy. Many volunteers and board members put in countless hours of work to make it all happen. The organization operates as a nonprofit and truly is a community founded and run entity. If you’d like to learn more about either the volleyball or basketball leagues for the upcoming season, check out www.bsyvl.com and www.bsybl.com
At Harrisburg Family Chiropractic, we are dedicated to helping you achieve your personal goals combining skill and expertise in chiropractic and massage therapy. For more information, visit www harrisburgfamilychiropractic com Facebook com/HarrisburgFamilyChiropractic
303 W Willow Street, Harrisburg, SD Proudly serving the community of Harrisburg since 2006. such as Matt Van Holland and Kyle Hanisch. Initially, schedules and game locations were done on paper and spreadsheets but, with Matt and Kyle’s guidance, the use of better technology and communication infrastructure has improved this important task. The Board of Directors have also played an invaluable role to the success of Big Sioux. The Board has included volunteers such as Colin McKenzie, Tammy Harms, Pat Knecht, Wendy Knecht, Jeremy Decurtins, Brent Aday and Ronette Costain. It’s taken an army of volunteers to build the program to what it is today.
or send money. 360º AdviceFinancialDesigned to Last. Because putting clients first isn’t just our motto – it’s our mission. TOPTOPWEALTHMARINERADVISORSRANKEDFIVEMARINERWEALTHADVISORSRANKEDFIVE marinerwealthadvisors.com | 605-271-6627 7001 South Lyncrest Place, Suite 103 Sioux Falls,
carefully
Please
Investment
*Barron’s awarded the 2021 and 2020 #5, 2019 #4 and 2018 #3 Top RIA Firms rankings to Mariner Wealth Advisors based on data compiled for Mariner Wealth Advisors and the 2017 #2 and 2016 #1 rankings to Mariner Holdings based upon data compiled for Mariner Holdings’ registered investment adviser subsidiaries. The number of firms included in the rankings were: 20 (2016), 30 (2017), 40 (2018), 50 (2019) and 100 (2020 and 2021). Barron’s publishes rankings based upon a number of criteria and the firms’ filings with the SEC were used to cross-check the data provided. The listing includes numbers of clients, employees, advisors, offices and state locations. The award is not indicative of future performance and there is no guarantee of future investment success. For additional information visit www.barrons.com. Mariner Wealth Advisors (“MWA”) is an SEC registered investment adviser with its principal place of business in the State of Kansas. Registration of an investment adviser does not imply a certain level of skill or training.For additional information about MWA, including fees and services, please contact MWA or refer to the Adviser Public Disclosure website (www.adviserinfo. sec.gov). read the disclosure statement before invest SD Which would win in an arm wrestling match between your wallet and your alarm clock? This is a strongly individual question that everyone can weigh in on. It is not a lifeor-death situation so please don’t bet your firstborn on this match, but it is important so make sure the stakes are high. Let’s see – I’d bet my very last quart jar of my friend Lorna’s homemade salsa and a bag of the thin and tasty Tostitos that my alarm clock would win. Your turn. Which is more important in your life – time or money? The two run proportionally through the streets of our lives. The job is overwhelming, and it takes all your time but the bills are paid. Meanwhile, all those thoughtful things that run through your mind are just thoughts really. You meant it when you thought about visiting your sick friend or spending time playing scrabble with your kids. Those are important things and certainly you would do them if you had the time. Imagine if you had one of those part-time jobs. The pay is low, but the flexibility is fabulous. You can pay your mortgage if you only buy what is on sale for groceries and you have plenty of time to plot and plan how to scrimp and save to help you get by. The world is a brighter place because you come along side your friends in need with thoughts and words and random acts of kindness. All that time you spend with those kids, they love it but you feel guilty because a trip to Disney World is definitely not in the budget. Those are two very different worlds, but there is a place where they converge for almost everyone. Time and money are of absolutely no consequence when it comes to your health. When your doctor’s nurse calls and the news is bad, then all of your time and money are spent improving your health. It is the obvious decision. So let your alarm clock and your wallet wrestle. You don’t need to pick a side – neither one has arms! Do the best you can with your time and your money. Do what is right for your family. Learn to live within your means – budget time and money but don’t let them define you.
57108 PERSPECTIVE DON’T LET TIME OR MONEY DEFINE YOU
you
27THE BRIDGE | FALL 2022
Jane Klemme
Let’s talk internet safety
. Whether it’s protecting your kids, your devices or your home network, Midco Wi-Fi can help your family navigate the digital world at home safely .
“Because I said so.”
THE TECH YOU CAN TRUST. Monitoring your kids’ online activities can end up becoming another full-time job. You are much too busy already – what with taking care of them, yourself and all the other things life throws your way. Instead, trust Midco Wi-Fi to do most of the work for you. Via a user-friendly app and sophisticated pods strategically placed throughout your home, Midco Wi-Fi places the power in your control. Not only can you monitor your home network, but you can also monitor all your connected devices.
28 CONNECTING THE HARRISBURG COMMUNITY
It’s a phrase every parent is guilty of saying. But when it comes to whole home Wi-Fi safety, the saying alone can only go so far. While the internet offers many benefits for kids, like entertainment, creative outlets and learning opportunities, it can also be a scary place that requires vigilance and boundaries. Imagine a child wandering around without limits. The same holds true on the world wide web. In the digital age, parents need an extra helping hand – or pod – beyond what your router or mobile device settings can do. This is where Midco Wi-Fi can help.
SPONSOR SPOTLIGHT | MIDCO LET’S TALK INTERNET SAFETY WIN AT PARENTING WITH WI-FI CONTROLS
What does that mean for your family? More safety and security. Less worry and stress. PARENTAL CONTROLS FOR THE WIN. Parenting is all about setting healthy boundaries. By reinforcing tech rules, you are developing and teaching your kids good habits. With the Midco Wi-Fi app, you can control what kids see at the device level or by user profile. Manage your kids’ online usage with parental controls. Need to block a specific website? Regulate screen time? Restrict social media? No problem! With Midco Wi-Fi, you have an advanced, whole-home system that can do it all.
Customizable internet filter settings come with options to limit content, such as restricting inappropriate websites for young family members, setting screen time rules, blocking ads and more.
29THE BRIDGE | FALL 2022 Big ItproblemTransmissionorminoradjustment?takesanexperttoknow!freetowingCall Jim's National Transmission Repair and Service today! 605.231.5884 (Within a 25-mile radius of facility) 605 E 4th Street, Sioux Falls, SD 57103 www.jimsautotrans.com | 605-231-5884 SAY NO TO ADS WITH ADBLOCKING. It’s easier than ever for kids to click on an ad and make a purchase. You can activate adblocking for your network, an individual user or a specific device. This feature blocks known advertising servers from displaying web and video advertisements. A great feature to prevent marketing to young kids. Content access rules help filter which online content is suitable. You’re able to manually block up to 50 total sites. Or automatically block content based on the following levels: • No limits – All content is accessible. • Kids appropriate – Filters content deemed inappropriate for young children. • Teenager friendly – Filters content deemed inappropriate for teenagers. • No adult content – Filters all adult content. TAKING TIME OUTS. Too much time online undermines mental wellness and negatively affects sleep. Limit screen time – for you and your kids – with Midco Wi-Fi. Stop your kids from endlessly scrolling by scheduling an internet break, whether that’s on a custom device freeze schedule or in 15-minute intervals. Plus, you can see data consumption stats and monitor each user’s online behavior. Meaning, if they find a way to cheat on the time out, you’ll know!
EASILY MANAGE USERS AND DEVICES. Prioritize family safety and quality time at home with content restrictions. This can be done for users or devices connected to your Midco Wi-Fi network. Setting permissions allow you to customize schedules, pause internet access and see when kids were last at home and online. LASTLY, IT’S YOUR FIRST LINE OF DEFENSE. In addition to all the other features, Midco Wi-Fi guards your network against cyber threats. It can:
• Filter inappropriate websites with content access rules. Midco Wi-Fi knows which domains your smart home devices are supposed to regularly access. If a connected device tries to access a previously unknown domain, it is immediately quarantined so it cannot infect other network devices, and you receive a notification. That’s instant peace of mind. That’s one less thing to think about. That’s confidence that your whole-home network is protected! That’s MidcoReadyWi-Fi.for Midco Wi-Fi? Visit Midco.com/Wi-Fi to learn more.
• Protect devices against malware, spyware, botnets, adware, SPAM, ransomware, crypto-mining and phishing.
• Automatically block unusual behaviors and quarantine infected devices.
“Sioux Valley Coop is excited to be part of the Harrisburg community. We positioned to serve customers now and into the future as Cliff Avenue continues to develop,” he said. “The Coop’s leadership chose to expand in this location to be part of this great, growing community. The store will be a long-term staple in Harrisburg.”
SIOUX VALLEY COOP OPENS NEW C-STORE
After much anticipation, Sioux Valley Coop opened a new convenience store on Cliff Avenue in Harrisburg on June 9th. This is the sixth location in South Dakota for the Watertown-based co-op.
The new location has Cenex brand gasoline and diesel fuels as well as E-30 and E-85 blends. Sioux Valley Coop offers benefits such as a rewards program and a local charge account program for both commercial and non-commercial customers. The Coop also offers patronage which is a year-end bonus based upon how much an account spends.
Currently the business has more than 20 employees. “Our staff is amazing and they’ve been crucial to a successful opening,” Licktieg said. People interested in learning more about employment, the rewards program or customer charge accounts are encouraged to stop by the store and ask for Trevor.
Harrisburg native Trevor Licktieg is the general manager of the new Sioux Valley Coop
30 CONNECTING THE HARRISBURG COMMUNITY
The decision to expand the Coop’s footprint to the Harrisburg area has been in the works for several years. Cliff Avenue is a main route to and from Harrisburg into Sioux Falls and this location has easy access on-and-off Cliff. In addition, the location features a Godfather’s Pizza Express which offers both personal pan pizzas and full-sized pizza options. Fresh breakfast pizzas are served daily as early as 6 a.m. Carry out orders are taken until 8 p.m. Orders can be placed by 605-213-1027. Every morning, fresh Flyboy Donuts are available as well as Caribou Coffee that is brewed on-site. There is a dining area for guests to enjoy a cup of coffee or to visit with others. During lunch time and throughout the day, there is a wide selection of fresh made deli sandwiches and other grab and go lunch options.
LOCAL BUSINESS PROFILE | SIOUX VALLEY COOP
The station’s general manager is Trevor Licktieg, a native of Harrisburg and 2013 graduate of Harrisburg High School. He and his wife, Taylor, along with their two children, Quentyn, 4, and Lincoln, 1, live in the neighborhood near the store. Licktieg has managed other C-Stores in the Sioux Falls market for several years, so it was a natural fit for him to lead the team in his hometown. “We take pride in having a clean store with friendly staff and providing great service for our customers,” he said.
The store has a large section of beverages, both alcoholic and non-alcoholic. There is a Beer Cave with a wide selection of domestic and local craft beers. Other services offered include propane tank exchange, firewood and 24-hour gas pump availability with credit/debit cards. Standard business hours are 5 a.m.-10 p.m., seven days a week.
The new Sioux Valley Coop on Cliff Avenue in Harrisburg features Cenex brand gasoline and diesel fuels as well as E-30 and E-85 blends
31THE BRIDGE | FALL 2022 Wireless World South Sioux Falls 85th & Minnesota 605.789.8722 $25 OFF any case or screen protector $39.99 or higher. In stock items only. Only valid at Wireless World/Verizon. www.WirelessWorld.com Wireless World is a Verizon Authorized Retailer. DONE RIGHT, DONE ON TIME, DONE WITH COMMERCIALRESIDENTIALSINCEPRIDE1979.✓✓INDUSTRIAL✓POWER UP Switch on success. With nextpartneryou’veElectricAmericanConstruction,gottherighttomakeyourprojectsoar. AMERICANELECTRIC CONSTRUCTION.COM 301 Shadow Creek Place Harrisburg, SD 57032 605-336-8310
32 CONNECTING THE HARRISBURG COMMUNITY ACCOUNTING, BOOKKEEPING, PAYROLL Numbers & Such Prof. LLC (605) courtney@numbersandsuchprofllc595-5315 com ADVERTISING Including mailing, marketing, printing, promotional Fully Promoted (605) sfsd@fullypromoted274-0105 com Performance Press (605) info@performancepressinc582-7070 com PromoLogo USA (605) john@promologousa578-0800 com Sioux Valley News (605) SiouxValleyNews@vastbb764-2000 net Qualified Presort Service, LLC (605) jeffpeterson@qualifiedpresort965-3210 com Sisson Printing Inc. (605) denny@sissonprintinginc336-6136 com AG BayerSERVICESCropScience (605) 743-5459 x 5604 erin baker-daggett@bayer com APARTMENTS, RENTAL PROPERTY Sawyer Pointe Apartments (605) info@residepropertymanagement275-4245 com Select Companies (605) info@selectcompanies743-4865 co Solutions Property Management, LLC (605) Linda@yourrentalsolution988-8496 com AUTOS, RVs AND AUTO REPAIR Clean Ride Auto Spa/The Clean Bean (605) coffee@cleanrideautospa306-2266 com J & M Transmission & Auto Services Inc. (605) maryellen@jmtransmissionservice368-2050 com Jim’s National Transmission Service (605) jimsautotrans@gmail213-1313 com Noteboom RV (605) office743-4002.noteboomrv@gmail com Valvoline Instant Oil Change (605) pnelsen@dakota321-9900 net BANKING / FINANCIAL SERVICES American State Bank (605) 444-6000 ryan mulder@myasb com Black Hills Federal Credit Union (605) aprilm@bhfcu937-4515 net Bluestone Federal Credit Union (605) codyn@bluestonefcu367-7070 org Central Bank (605) awalsh@centralbankonline782-1818 com CorTrust Bank (605) tdehaven@cortrustbank336-3900 com CU Mortgage Direct - Chris Pater (605) cpater@cumortgagedirect275-1777 com First Bank & Trust (605) breanna978-3030garbers@bankeasy com First International Bank & Trust (605) JAPPel@fibt321-5615.com The First National Bank in Sioux Falls (605) KAAspaas@fnbsf782-5881 .com Frontier Bank (605) traceyh@frontierbk331-2889 .com Quoin Financial Bank (605) gharrell@quoinbank275-5000 .com Reliabank (605) jeremyk@reliabank306-2000 com Security National Bank of South Dakota (605) gdybsetter@snbsd977-9000 com BUILDING Including electrical, painting, plumbing Albers Electric, LLC (605) alberselectric@yahoo366-9561 com BHI Construction, LLC (605) accountspayable@bhi-construction743-2152 com B.J. Construction (605) JNBL@midco743-5167net Fiegen Construction (605) lucas@fiegenconstruction335-6000 com G. A. Johnson Construction, Inc. (605) corey@gajci361-8800com Janus Home Solutions (605) todd@janushomesolutions743-4233 com J.Wahl Home Inspection (605) jwahl@jwahlhomeinspection368-4650 com KN Construction (605) lexie@nielsonconstruction767-3500 .net One Hour Heating & Air Conditioning (605) kcd99@hotmail271-1419 com Select Companies (605) info@selectcompanies743-4865 co Sioux Falls Plumbing LLC (605) jason@siouxfalls-plumbing731-9019 com Showplace Cabinetry (605) 743-2200 heidi bowers@showplacecabinetry com CELL NoblePHONESWireless Group DBA AT&T (407) 242-6265 bob chabot@nobleamerica com Wireless World (605) phock@wirelessworld789-8722 com Creator’sCHILDCAREKids (605) stina@atysolutions231-5520 com Early Explorers Learning Center (605) teasupertitans@gmail498-1541 com Kids ‘R’ Kids of Prairie Hills (605) info@kidsrkidsprairiehills215-1341 com CHURCHESHarrisburgUnited Methodist Church (605) humc@harrisburgumc767-2253 com NewDay Church (605) randy@sf-newday368-9894 org Shalom Lutheran Church/Preschool (605) office@shalomlc767-5382 com St. John Paul II Catholic Church (605) office1@jp2sd988-3750.org CLEANING SERVICES Mustang Disaster CleanUp (605) 370-1990 devon@mustangdisastercleanup .com DIRECTORY OF MEMBERS AND BUYER’S GUIDE Local businesses invest in the community by supporting sports teams, school and youth activities, and the local tax base PLATINUM MEMBERS GOLD MEMBERS SILVER MEMBERS BRONZE MEMBERS
United States Postal Service (605) 743-2791
com The Clean Bean (605) 306-2266
Sioux Falls Chamber of Commerce (605) 336-1620
EmBe Avera (605) abakke@embe362-9438
Harrisburg SD Optimist Club (605) harrisburgsdoptimist@gmail520-4158
com
Harrisburg Community Foundation (605) info@harrisburgcf940-4393 org Harrisburg Community Library (605) 767-7910
Sioux Valley Cooperative (605) ap@siouxvalleycoop886-5829 com DANCE STUDIO Pulse Dance Studio (605) pulsedanceteams@gmail408-6246 com ENGINEER or ARCHITECTURE SERVICES Co-op Architecture (605) josh@co-oparch334-9999 com EAPC Architects Engineers (605) 444-1600 leap chear@eapc net Infrastructure Design Group, Inc. (605) KariJ@infrastructuredg271-5527 com Stockwell Engineers (605) jbrown@stockwellengineers338-6668 com TSP, Inc. (605) lorenzenll@teamtsp336-1160 com EVENT AmericanSITESLegion Post 45 & Auxiliary Unit 45 (605) axe@sio261-2621midco net Riviera Events and Catering (605) mattsapari8@gmail413-8780 com The Harrisburg Event Center (605) contact@harrisburgeventcenter366-0863 com The Meadow Barn (605) events@themeadowbarn370-2786 com FAMILY FUN, ENTERTAINMENT Country Apple Orchard (605) morethanapples2021@gmail743-2152 com Dakota Entertainment (605) garner@dakotaentertainment331-1404 com Great Shots (605) jonathan312-7950buckley@greatshots golf The Fireworkz Store (605) m4heavyd@yahoo261-9403 com The Sandlot (605) thesandlotpark@gmail370-0507 com FOOD / GROCERIES Dollar Fresh (605) amack@dollar-fresh213-2222 com Fareway (605) u1781@farewaystores743-9071 com Hy-Vee Inc. (605) cvenenga@hy-vee271-7171 com GARAGE DOOR REPAIR PS Garage Doors of South Dakota (605) jlangenstein@psgaragedoorssd743-3667 com GOLFSpring Creek Country Club (605) gsumma@sio743-2000midco net GRAPHIC DESIGN Design Loft (605) 376-7430 jp design@midco net HARDWARE, BUILDING MATERIALS Harrisburg Ace Hardware (605) 213-0600 frosin acehardware@outlook com Schoeneman’s Building Materials Center (605) 213-1100 al schoeneman@schoenemans com HEALTH Including medical and fitness Athletico Sioux Falls East (605) Nancy213-5590Rausch@athletico com Avera Medical Group Harrisburg (605) 213-8000 erica arends@avera org Evolve Chiropractic & Rehab (605) evolvechiropracticsd@gmail767-1610 com GreatLIFE (605) dustin213-1600derry@joingreatlife com Harrisburg Eye Care (605) info@harrisburgeyecare213-2020 com Harrisburg Family Chiropractic (605) drmayland@harrisburgfamilychiropractic767-7463 com Harrisburg Family Dental (605) 213-1230 Seth schr@gmail com Heroic Fitness (605) 759-5083 mal herofitness@gmail com Neighborhood Dental Clinic (605) sheitzler@neighborhooddentalcare767-0285 com Prairie Rehabilitation – Harrisburg (605) ljohnson@prairierehab767-3008 com Sioux Falls Dental Implant Center (605) info@siouxfallsdentalimplantcenter799-2929 com Wermerson Orthodontics (605) info@wermersonorthodontics274-0555 com INSURANCE AND/OR INVESTMENTS American Family InsuranceTerra Koupal & Associates LLC (605) tkoupal@amfam361-2020 com Ascend Financial, Inc. (605) kris@ascendfinancial553-9620 .com Brock Aldrich - Edward Jones Brock605-214-1079.aldrich@edwardjones .com Daniele Heyn - Aflac (605) daniele_heyn@us777-1566 aflac .com Casey Van BeekInnovative Employer Solutions (605) casey321-6733vanbeek@ies-sd com Lloyd Nickel Allstate Insurance Agency (605) lloydnickel@allstate937-6500 com Perspective Insurance (605) steveo@perspectiveinsurance444-6070 com RightQuote (605) 213-0024 amy schulz@rqthatswho com
COMMUNITY, SERVICE ORGANIZATIONS
vicki a johnson@usps gov CONVENIENCE STORES
Harrisburg Lion’s Club (605) asjtimmer@yahoo201-9361 com
Sioux Falls Rotary - South medevany@gmail com
org Harrisburg Aquatics Foundation (605) harrisburgaquaticsfoundation@gmail728-3564 com Harrisburg Area Food Pantry (605) harrisburgareafoodpantry@yahoo929-0599
THE BRIDGE | FALL 2022 Merrill’s Window Cleaning, LLC (605) merrillswindowncleaningllc951-1954@outlook com SERVPRO of Sioux Falls (605) 213-3303 Scooter’sCOFFEE Coffee Drive Thru (605) travis@scooterssiouxfalls271-0964
Friendlys Fuel Stop (605) 767-7561
33
com
Harrisburg School District (605) joanne743-2567vermulm@k12 sd us
Casey Hatch - Keller Williams Realty (605) caseyhatch@kw777-9090
Codi Realty Group/My Home My Harrisburg (605) codi@codirealtygroup370-9991 com
Grapes Liquor
Solutions Property Management, LLC (605) Linda@yourrentalsolution988-8496 com Tim Allex Realty Group (605) clientcare@timallex759-3996 com Van Buskirk Companies (605) kristi@vbclink361-8211.com RELOCATION ASSISTANCE Welcome Sioux Falls (605) info@welcomesiouxfalls799-5072 com BigRESTAURANTSB&GMilkywayJ’sRoadhouse (605) bigjroadhouseBBQ@gmail767-8000 com CNC Food Factory, LLC (605) cncfoodfactory@yahoo322-5325 com Fresh Horses Saloon (605) patrick767-5908miller1975@gmail com Harrisburgers (605) harrisburgers@yahoo767-1900 com Squealers Smoke Shack (605) Squealerssmokeshack@gmail679-7675 com Subway (605) coleshawd@gmail213-1009 com SANITATION SERVICES Novak Sanitary Service (605) melissaw@wcnx338-7126 org Roo’s Sanitation (695) Roossanitation@gmail498-1588 com SIGNAGE/WRAPSCustomeyezDesign (605) customeyez@live521-5239 com Redline Wraps & Signs (605) redlinewrapssd@gmail595-2023 com SPORTS EQUIPMENT, UNIFORMS Daubys Sports Center (605) brian-daubys@qwestoffice332-8041 net TAXIDERMYDiggersTaxidermy (605) kcnew6@hotmail881-8474 com TECHNOLOGY OR COMPUTER SERVICES Big D Technology Solutions, Inc. (605) danderson@bigdtechnology271-9885 com ELBO Computing Resources, Inc. (605) kyle@teamelbo361-3720 com TRAVEL AGENT Sioux Empire Travel LLC (605) tyson@siouxempiretravel777-9781 com NorthWesternUTILITIES Energy (605) 978-2913 paul mantz@northwestern com Xcel Energy (800) 895-4999 eric pauli@xcelenergy com WEB, SOCIAL MEDIA Firelink Online Media (725) mychelle@firelinkdigital696-3473 com YOUTH SERVICES Boys & Girls Clubs of the Sioux Empire (605) rwimmer@bgcsiouxempire338-8061 org Harrisburg Baseball Association (605) adrienne978-2101hba@gmail com Junior Achievement of South Dakota (605) 336-7318 kelli rogotzke@ja org Pulse Dance Studio (605) pulsedanceteams@gmail408-6246 com Wings Gymnastics Academy (605) frontdesk@wingsgym271-8242 com
Landscaping, LLC (605) rudyslandscapingsd@yahoo728-9399 com Yardscapes, LLC (605) SFYardscapesLLC@gmail929-2000 com RADIO STATION Dells Empire Country (605) sschramm@gwtc842-3333
contact@harrisburgsd743-5872
Rudy’s
The Experience Real Estate (605) Tiffany@TheExperience940-5544
com
LIQUORGrains& House (605)
grainsgrapesliquorhouse@outlook213-0182 .com
Broadband
com
Amber Ellingsen Realty (605) amberellingsen@kw360-6707
INTERNET
com
Julie Roth Real Estate (605) julieroth@hegg740-0645 com
SERVICES
OFFICE EQUIPMENT
South
smokendakotakennels@gmail743-5824
Kaylee Van Middendorp - 605 Real Estate (507) kaylee@605advantage220-1615 com
clarissa@digitsf231-9000
net REAL ESTATE AND DEVELOPERS
com PROPERTY, LANDSCAPE AND LAWN MAINTENANCE All Season’s Property Maintenance (605) allseasons605@gmail743-5912 com
Thomas Farmers Insurance
PET CARE FACILITY
SerenitySALONNail Spa
Terra Koupal (605) com
com A (605) com
com
Misty Glen Mobile Home Community (605) mistyglen1@hotmail362-4705 com NAI Sioux Falls (605) mmahlen@naisiouxfalls357-7100
PHOTOGRAPHY CMAC (605) cmacprod@yahoo201-4609
The Greg Doohen Realty GroupKeller Williams (605) carrierandazzo@kw215-2085 com Infrastructure Design Group, Inc. (605) philG@infrastructureDG271-5527
Crabapple Homes LLC (605) lisa@meierhenrylaw201-7598 com
OR VIDEO SERVICES
Digit-All Technologies
wthomas1@farmersagent275-3935
& B Business Solutions
gwestemeier@glesch221-0102
gov NAIL (605)
tkoupal@amfam361-2020
Gordon Flesch (605) com SDK (605)
Company
jeffrey306-3043larson@vastbroadband
serenitynailspa21@gmail213-0147
Wade C Agency (605)
kim@triviewquality371-5475 .com
& Associates: American Family Insurance
andrew888-1300curley@midco com
Quality Telecommunications
com / CABLE TV (605) com Midco (800) Vast (605) com (605)
Production
34 CONNECTING THE HARRISBURG COMMUNITY
com
com
MUNICIPAL City of Harrisburg (605)
johnny335-8520noel@abbusiness
Jim Dunham & Associates (605) ashley@jimdunhamassociates275-8500 com
Looking for a Place to Call Home? Give us a call to schedule a tour or learn about our other locations! (605) 743-4865 | selectcompanies.co | info@selectcompanies.co PROSPECT TOWNHOMES Brand new high-end townhomes! Located on the East side of Harrisburg—just minutes from Freedom Elementary School! 3 Bed/ 2 Bath | 1,453 Sq. Ft. TIGERWAY TOWNHOMES High-end townhomes, located on the edge of Harrisburg right off HWY 273. Easy access to Harrisburg High School, Walmart, and right off 273.
36 CONNECTING THE HARRISBURG COMMUNITY “ “ ” ” TEXT BRIDGE TO 855-659-3339 SCAN QR CODE OR to get a copy of this publication mailed to your home each quarter. An SMS developedplatformbyAGE Media and Promotion By texting BRIDGE, you agree to receive promotional messages sent via an autodialer. This agreement isn’t a condition of any purchase. Terms and Privacy Policy can be found at www.age-texting.com. You may receive up to 4 msgs/mo. Reply STOP to end or HELP for help. Message & data rates may apply. HARRISBURGSANFORD CLINIC OPENING SEPTEMBER 7, 2022 425-470-737 7/22 MORE WAYS TO CARE FOR YOU This new 16,000-square-foot clinic will be located at the corner of Cliff Ave. and Willow St. and will have a Lewis Drug store and pharmacy attached. Services will include: • Family Medicine • Pediatrics • OB/GYN • Lab, X-Ray & Ultrasound • 3D Mammography Now accepting appointments. Call (605) 213-9700 to schedule.
