2005 Cornell Football Media Guide by Jeremy Hartigan

GENERAL/MEDIA INFORMATION

Table of Contents General Information Table of Contents, Quick Facts ....................................... 1 General/Media Information ...................................... 2-3 Ivy Composite Schedule/Football Directory/Future Cornell Schedules ........... 4

Coaching and Support Staff Head Coach Jim Knowles ........................................ 6-7 AssistantCoaches ............................................. 8-12 RecruitingAreas ................................................ 12 SupportStaff ................................................ 13-14

2005 Outlook and Team OffensiveOutlook ............................................. 16-17 Defensive Outlook ............................................ 18-19 Special Teams Outlook ........................................... 19 2005 Preseason Roster ......................................... 20-22 Meet the Veterans ............................................ 23-37 2005 Newcomers ............................................. 37-44

2005 Opponents Opponent Information ......................................... 46-55 Cornell vs. All Opponents ......................................... 56

2004 in Review/Ivy League 2004Statistics ................................................. 58 2004 Game Summaries ........................................ 59-63 2004 Ivy Standings, All-Ivy Teams, Past Ivy Champions .................... 64 2004 Ivy League Team Statistics, Annual Awards ......................... 65 2004IvyLeagueIndividualStatistics ................................. 66

History/Records

Location .............. Ithaca, N.Y. 14853 Founded ........................ 1865 Enrollment ...................... 13,700 President ..... HunterR.RawlingsIII(Interim) Colors ........... Carnelian Red and White Affiliation ................... NCAA I-AA Conference .................. Ivy League Home Field ....... SchoellkopfField(25,597) AthleticAdministration AthleticDirector ......... J. Andrew Noel Jr. Associate AD ............... Anita Brenner Associate AD ............. Stephen P. Erber Associate AD/Business & Finance . Frank Araneo Asst. AD/Stud. Svcs./Compliance ChrisWlosinski Dir.AthleticAlumniAffairs&Dev. John Webster Compliance Coordinator ...... Patty Weldon Athletic Communications Staff InterimDirector ........... Jeremy Hartigan Office Phone ............ (607) 255-9788 Cell Phone ............. (607) 351-1675 FAX .................. (607) 255-9791 E-mail .............. jh295@cornell.edu Assistant .................. Eric Lawrence Office Phone ............ (607) 255-3753 Intern .................... TylerDenison Office Phone ............ (607) 255-5626 AccountsRepresentative ... Marlene Crockford Office Phone ............ (607) 255-3752 Hotline .................. (607) 255-2385 Press Box Phone ............ (607) 255-3535 World Wide Web ... www.CornellBigRed.com Credits: The 2005 Cornell football media guide is a publication of the Cornell Athletic Communications Office.Editorialcontent,layoutanddesignbyJeremy Hartigan with assistance from Marlene Crockford, Elli Harkness, Brian Kelley, Eric Lawrence, Tyler Denison and Nathan Lindberg. Photography: Tim McKinney, Patrick Shanahan, Darl Zehr, Heather Nichols, The Cornellian, Jeremy Hartigan, Steve Pike, C.W. Pack Sports, Jon Reis, Cornell University Photography, Division of Rare and Manuscript Collections-Kroch Library, Cornell University.

THE

COVERS: Front: Seniors Kevin Boothe (left), Brian Romney (top right) and Kevin Rex (bottom right) look to help Cornell continue its climb back to national prominence.

This is Cornell University/Cornell Athletics Realizing a Bold Dream ...................................... 110-111 Ithaca,N.Y. .................................................. 112 UniversityLeadership ........................................... 113 CornellAthleticsLeadership ...................................... 114 Meet the Big Red Coaches ....................................... 115 The Ivy League ................................................ 116 The Friedman Center ........................................... 117 SupportServices .............................................. 118 AthleticTraining .............................................. 119 Prominent Cornell Alumni ....................................... 120 SchoellkopfField .............................................. 121 BigRedFacilities ........................................... 122-123 Success in and out of the Classroom ................................. 124

Back: (Clockwisefromtopleft) Seniors Joel Sussman, PatrickPotts,MattPollock, Andre Hardaway, Chris Eckstein and Joshua Johnston will tackle a formidable 2005 schedule that includes five home games.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Over A Century of Tradition ..................................... 68-71 Cornell Football Legends ....................................... 72-74 PassingRecords ................................................ 75 Rushing Records ................................................ 76 Receiving Records .............................................. 77 Total Offense Records ............................................ 78 Scoring Records ................................................ 79 Defensive Records .............................................. 80 Special Teams Records ........................................... 81 Cornell Team Records ........................................... 82 Opponent Team Records ......................................... 83 Annual Leaders .............................................. 84-85 Single-Game Highs ............................................. 86 The Last Time It Happened ........................................ 87 All-TimeScores .............................................. 88-93 Cornell Head Coaches ........................................... 93 All-America,All-Ivy,AcademicAll-AmericaSelections ................... 94-95 National Football Hall of Fame/Cornell Athletic Hall of Fame Members ........ 96 Cornell Football Awards ........................................ 97-99 CornelliansinProFootball ....................................... 100 All-Time Letter Winners ...................................... 101-108

Cornell Quick Facts

GENERAL/MEDIA INFORMATION Jeremy Hartigan Director of Athletic Communications Office: (607) 255-9788 E-mail: jh295@cornell.edu

Eric Lawrence Athletic Communications Intern Office: (607) 255-3753 E-mail: etl8@cornell.edu

Tyler Denison Athletic Communications Intern Office: (607) 255-5626 E-mail: tjd43@cornell.edu

Marlene Crockford Athletic Communications Accounts Representative

WWW .CORNELL B IG R ED . COM

Office: (607) 255-3752 E-mail: mmc7@cornell.edu

Athletic Communications Student Assistants Mike Fortunato, Kristen Hughes, Trevor Johnson, Matt Leftwich, Nathan Lindberg, D.J. Mauch, Meghan McMahon, Steve Nelson, Heath Vincent.

Frequently Called Numbers (607 area code) Athletic Communications .... Athletic Communications Fax . Football Office ............ Football Office Fax ......... Athletic Department ........ Press Box (game day only) ...

255-3752 255-9791 255-0003 255-4008 255-5520 255-3535

Mailing Address Teagle Hall, Campus Road Ithaca, N.Y. 14853-6501 Overnight Address Schoellkopf House Campus Road Ithaca, N.Y. 14853-6501 Cornell Athletics Web www.CornellBigRed.com

CREDENTIALS Requests for working press credentials at Cornell home football games should be made in writing on station/newspaper/magazine letterhead to Jeremy Hartigan in the Cornell Athletic Communications Office. The mailing address is: Teagle Hall, Campus Road, Ithaca, NY 14853-6501. Requests may be sent via fax, but all requests, mailed or faxed, should be sent so that they reach the athletic communications office at least 10 days prior to the game. Media agencies that cover Cornell and the visiting school on a regular basis will receivetoppriority.Othercredentialswillbeissuedonthebasisofcirculationandthe availabilityofspace.Credentialswillbemailedifatallpossible.Otherwise,theymay be picked up before 5 p.m. on Friday at the athletic communications office. Those credentials not picked up by 5 p.m. on Friday will be left for Saturday pickup at the Schoellkopf Field Will Call booth, located at the northwest end of the west stands. PRESS BOX SERVICES Programs, flip cards, statistics and notes will be provided before each game. A playby-play and out-of-town scores will be distributed at the conclusion of each quarter. Halftime statistics will also be available. A scoring summary and complete team and individualstatisticswillbeprovidedaftereachgame.Lunchwillbeservedathalftime. Soft drinks and coffee will be available throughout the game. SIDELINE POLICY Photographers will not be allowed on the sidelines without proper credentials. Photo credentials are limited to daily newspaper, student newspaper, wire service and team photographers, along with a limited number of special passes which are given out on a space available basis. Freelance photographers must provide the Cornell Athletic Communications Office with a complimentary photo CD of the game with 10 action shots. Under NCAA and Ivy League guidelines, photographers are not allowed between the 25-yard lines and must remain outside the restraining lines surrounding the field. Credentialholdersnotworkingwillbeaskedtoleavethesidelines.Weaskforthesafety of others please do not leave equipment unattended on the sidelines. If you are shooting with a tripod, please keep a safe distance from the playing field. RADIO BOOTHS We have space in the press box for three radio stations. Priority is always given to Cornell’s commercial station. All visiting stations should contact the Athletic Communications Office at least one month before the game for information concerning phone lines. GAME DAY PARKING Allmediapeoplewillbeissuedparkingpassesfortheroofleveloftheparkinggarage, whichisbehindtheweststands.Allparkingpassesaremailedout10daysbeforethegame. POSTGAME INTERVIEWS After the game, the media will meet in the press room (press room information available in the press box on game days). The visiting coach will be brought in after the required 10-minute “cooling-off” period. Coach Knowles will follow the visiting coach, along with selected players. Requests for players should be directed to a member of the Athletic Communications staff during the fourth quarter of each game. Only members of the working press with proper credentials will be allowed in the press room. The Big Red locker room is closed. TELEPHONES There will be one telephone available for media use (607-255-2982) and one for Athletic Communications use during the game (255-3535). Several telephones are available to members of the working press in the Athletic Communications Office in Paul Schoellkopf House. Anyone desiring a private line should call Marlene Crockford at least one month before the game.

2005 FOOTBALL

GENERAL/MEDIA INFORMATION MIDWEEK SPORTS LUNCHEON Each Tuesday, the Tompkins County Chamber of Commerce will sponsor a luncheon at the Ramada Inn-Ithaca Airport featuring the head coaches of Cornell, Ithaca College and Ithaca High School. AVAILABILITY OF COACH KNOWLES All requests for interviews with Coach Knowles must be received by the Athletic Communications Office at least 24 hours in advance. He will accept interviews in his office, over the phone and prior to practice sessions as long as a request has been made in advance. PLAYER INTERVIEWS All player interviews must be arranged through the Athletic Communications Office so a time can be arranged that will not interfere with the student’s academic schedule. Players have been instructed to conduct no interviews unless they have been set up in this manner. All interviews are to be conducted on Wednesday only. Telephone interviews are conducted at the players’ convenience. Usuallytheyarehandledbyplayersreturningcallsimmediatelyafter practice on Wednesday (approximately between 8 and 10 p.m.). No home numbers for players will be given out and players have been toldnottoacceptcallsfromanyoneaskingfootball-relatedquestions. Please do not show up and wait for players unannounced on campus, at players’ housing or Schoellkopf Memorial. The players have been instructed to politely decline the request and refer the person to the Athletic Communications Office. Advance notice of your intentions to attend a practice session is appreciated.

Big Red On The Air Radio Coverage All 10 Cornell football games will be broadcast by WHCU 870 AMIthaca. BarryLeonardreturnsforhiseighthyearinthebooth and seventh season in the play-by-play chair. Buck Briggs returns as the Big Red’s analyst. Cornell on the Internet WHCU's broadcasts of Cornell football canBarry also be heard via Leonard the internet. To hear the game from your computer via the internet, go to http://www.CornellBigRed.com and follow the links to the broadcast that are located on the football schedule page. Keep checking CornellBigRed.com for broadcast updates

Buck Briggs ‘76 enters his fifth year as the color analyst for Cornell football and will join Barry Leonard in the radio booth again in 2005. An associate counsel for the NFL Management Counsel, Briggs is part of the team that is the collective bargaining representative for the NFL owners and handles all player-related legal issues. He also teaches sports law classes at both Cornell and Penn law schools.

NEWSPAPER Chris Feaver, Sports Editor IthacaJournal PO Box 430 Ithaca, N.Y. 14851-0430 Telephone: (607) 274-9214 Fax: (607) 272-4248

RADIO Sports Director WVBR (93.5 FM) 227 Linden Ave. Ithaca, N.Y. 14850 Telephone: (607) 273-4000 Fax: (607) 273-4069

Chris Mascaro, Sports Editor Cornell Daily Sun 139 West State St. Ithaca, N.Y. 14850 Telephone: (607) 273-3606 Fax: (607) 273-0746

News Director Eagle Broadcasting 1751 Hanshaw Road Ithaca, N.Y. 14850 Telephone: (607) 257-6400 Fax: (607) 257-6497

Steve Carlic, Sports Editor Syracuse Newspapers PO Box 4818 Syracuse, N.Y. 13221 Telephone: (315) 470-2152 Fax: (315) 470-3019

Bob Michaels WELM Radio 1705 Lake St. Elmira, N.Y. 14901 Fax: (607) 733-5627

Bud Poliquin, Columnist Syracuse Newspapers PO Box 4818 Syracuse, N.Y. 13221 Fax: (315) 470-3019

Sports Director WSYR Radio 500 Plum St. Syracuse, N.Y. 13204 Fax: (315) 472-1904

Charlie Jaworski, Sports Press & Sun Bulletin PO Box 1270 Binghamton, N.Y. 13902 Telephone: (800) 365-0077 Fax: (607) 798-1113

TELEVISION Chris Watson, Sports Director News 10 Now 815 Erie Boulevard East Syracuse, N.Y. 13210 Telephone: (315) 634-2352 Fax: (315) 634-4270

Jim Mandelaro, Sports Democrat & Chronicle 55 Exchange Blvd. Rochester, N.Y. 14614 Telephone: (716) 258-2406 Fax: (716) 258-2776

Sports Director WBNG-TV PO Box 12 Johnson City, N.Y. 13790 Telephone: (607) 729-8812 Fax: (607) 729-4022

John Moriello, Sports Rochester Newspapers 55 Exchange Blvd. Rochester, N.Y. 14614 Fax: (716) 258-2776

Sports Director WENY-TV PO Box 208 Elmira, N.Y. 14902 Telephone: (607) 739-3636 Fax: (607) 796-6171

Roger Neumann, Sports Editor Elmira Star-Gazette PO Box 285 Elmira, N.Y. 14902 Telephone: (607) 734-5151 Fax: (607) 734-3004 CORNELL BROADCAST CREW Barry Leonard Play-by-play 27 West Meadow Drive Ithaca, N.Y. 14850 Home Telephone: (607) 257-5938 Fax: (607) 257-5938 Buck Briggs Color analyst c/oCornellAthletics Teagle Hall, Campus Road CornellUniversity Ithaca, N.Y. 14853-6501 Telephone: (607) 255-9598 Fax: (607) 255-2969

Sports Director WETM-TV P.O. Box 1207 Elmira, N.Y. 14902 Fax: (607) 733-4739 Sports Director WIXT-TV 5904 Bridge St. Syracuse, N.Y. 13057 Fax: (315) 446-9283 JasonBristol,SportsDirector WSTM-TV 1030 James St. Syracuse, N.Y. 13203 Fax: (315) 474-5122 Kevin Maher, Sports Director WTVH-TV 980 James St. Syracuse, N.Y. 13203 Fax: (315) 425-0129

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Barry Leonard enters his eighth year as the play-by-play voice of Cornell football, basketball and lacrosse teams. Leonard returned to Ithaca radio in 1997 after a 10-year absence and his recognizable voice and affinity for Cornell is evident by his commitment to the university and the athletic programs. A 1980 graduate of Ithaca College with a degree in televsion and radio, Leonard resides in Lansing with his wife, Anne, and daughter, Keara.

They Cover the Big Red

GENERAL/MEDIA INFORMATION

Schedule Information/Directory 2005 Ivy League Composite Schedule Saturday, September 17 Colgate at Dartmouth 12:30 p.m. Bucknell at Cornell 1 p.m. Brown at Georgetown 1 p.m. Harvard at Holy Cross 1 p.m. Princeton at Lafayette 1 p.m. Yale at San Diego 7 p.m. Duquesne at Penn TBA Columbia at Fordham TBA Saturday, September 24 Duquesne at Columbia 12:30 p.m. Dartmouth at N. Hampshire 12:30 p.m. *Brown at Harvard 1 p.m. Villanova vs. Penn 7 p.m. San Diego at Princeton 1 p.m. *Cornell at Yale 1 p.m. Saturday, October 1 *Penn at Dartmouth 12:30 p.m. Lehigh at Harvard 12:30 p.m. Rhode Island at Brown 1 p.m. Cornell at Colgate 1 p.m. *Columbia at Princeton 1 p.m. Holy Cross at Yale 1 p.m.

Saturday, October 8 Fordham at Brown 1 p.m. *Harvard at Cornell 1 p.m. Columbia at Lafayette 1 p.m. Colgate at Princeton 1 p.m. *Dartmouth at Yale 1 p.m. Bucknell at Penn 3:30 p.m. Saturday, October 15 *Princeton at Brown 1 p.m. Georgetown at Cornell 1 p.m. Dartmouth at Holy Cross 1 p.m. Harvard at Lafayette 1 p.m. Yale at Lehigh 1 p.m. *Penn at Columbia 1:30 p.m. Saturday, October 22 #*Columbia at Dartmouth 12:30 p.m. *Princeton at Harvard 12:30 p.m. *Brown at Cornell 1 p.m. *Yale at Penn 3:30 p.m. *Ivy League Games #YES Network Games

Saturday, October 29 #*Cornell at Princeton 12 p.m. *Yale at Columbia 12:30 p.m. *Dartmouth at Harvard 12:30 p.m. *Penn at Brown 1 p.m. Saturday, November 5 *Penn at Harvard 12 p.m. *Harvard at Columbia 12:30 p.m. *Cornell at Dartmouth 12:30 p.m. #*Brown at Yale 12:30 p.m. Saturday, November 12 *Dartmouth at Brown 12:30 p.m. #*Penn at Harvard 12:30 p.m. *Columbia at Cornell 1 p.m. *Yale at Princeton 1 p.m. Saturday, November 19 *Brown at Columbia 12 p.m. *Harvard at Yale 12 p.m. *Cornell at Penn 12 p.m. *Princeton at Dartmouth 12:30 p.m.

WWW .CORNELL B IG R ED . COM

Cornell Football Directory (all area code 607)

A DMINISTRATION Athletic Director .................... Associate Director ................... Associate Director ................... Assistant Director - Stud. Svcs. & Compliance Dir. of Ath. Alumni Affairs and Dev. ....... Compliance Coordinator .............. Ticket Manager ..................... Facilities Manager ................... Operations Manager .................

NAME OFFICE PHONE J. Andrew Noel Jr .................... 255-8832 Anita Brenner ...................... 255-8283 Stephen P. Erber .................... 255-7442 Chris Wlosinski ...................... 254-7472 John Webster ....................... 255-5631 Patty Weldon ...................... 255-8874 Gene Nighman ..................... 255-3175 Pat Graham ........................ 255-1321 Matt Coats ........................ 255-1814

FOOTBALL STAFF Head Coach ....................... Offensive Coordinator/Wide Receivers Coach AssistantOffensiveCoord./OffensiveLineCoach Quarterbacks Coach .................. Tight Ends Coach .................... Running Backs Coach ................. Assoc. Defensive Coord./Defensive Line Coach SafetiesCoach/RecruitingCoordinator ..... Linebackers Coach ................... Cornerbacks Coach/Special Teams ....... DirectorofFootballOperations .......... Strength and Conditioning Coach ........ AdministrativeAssistant ............... RecruitingSecretary ..................

Jim Knowles (jk21@cornell.edu) ......... Clayton Carlin (cgc32@cornell.edu) ...... Brian Coon (bjc56@cornell.edu) ......... Scott Kavanagh (swk26@cornell.edu) ..... Zac Roper (zwr2@cornell.edu) .......... RickyRahne(rrr8@cornell.edu) .......... Pete DeStefano (pd30@cornell.edu) ...... Brad Beerwinkel (bwb28@cornell.edu) .... Tim Simpson (tas45@cornell.edu) ........ Roderick Plummer (rrp34@cornell.edu) .... Pete Noyes (ppn2@cornell.edu) ......... Tom Howley (tkh1@cornell.edu) ......... Karen Berkley (kmb63@cornell.edu) ...... Becky Hollenback-Miller (bh52@cornell.edu)

255-0026 255-5637 255-5640 255-2396 255-5222 255-5639 255-5638 255-5636 255-5641 255-5635 255-3486 255-3953 255-0026 255-0003

MEDICAL AND ATHLETIC TRAINING Team Physician ..................... Dr. David Wentzel ................... 255-6962 Head Athletic Trainer ................. Bernie DePalma ..................... 255-4237 Associate Head Athletic Trainer .......... Jim Case .......................... 255-4237 A REA A CCOMMODATIONS BestWesternUniversityInn ............................................... ClarionInn .......................................................... Comfort Inn .......................................................... Courtyard by Marriott .................................................. Econo Lodge ......................................................... Hilton Garden Inn ..................................................... HolidayInn .......................................................... Ramada Inn-Ithaca Airport ............................................... StatlerHotel ......................................................... Super 8 Motel ........................................................

2005 FOOTBALL

272-6100 257-2000 272-0100 330-1000 257-1400 277-8900 272-1000 257-3100 257-2500 273-8088

Future Cornell Schedules (2006-2010) Schedules are tentative and subject to change. For more information on future schedules, please visit the athletic departmentâ&#x20AC;&#x2122;s web site at www.CornellBigRed.com.

Sept. 16 23 30 Oct. 7 14 21 28 Nov. 4 11 18

2006 at Bucknell Yale Albany at Harvard Colgate at Brown Princeton Dartmouth at Columbia Penn

Sept. 15 22 29 Oct. 6 13 20 27 Nov. 3 10 17

2007 Bucknell at Yale at Georgetown Harvard Colgate Brown at Princeton at Dartmouth Columbia at Penn

Sept. 20 27 Oct. 4 11 18 25 Nov. 1 8 15 22

2008 at Bucknell Yale at Lehigh at Harvard Colgate at Brown Princeton Dartmouth at Columbia Penn

Sept. 19 26 Oct. 3 10 17 24 31 Nov. 7 14 21

2009 Bucknell at Yale at Colgate Harvard open Brown at Princeton at Dartmouth Columbia at Penn

Sept. 18 25 Oct. 2 9 16 23 30 Nov. 6 13 20

2010 open Yale at Bucknell at Harvard Colgate at Brown Princeton Dartmouth at Columbia Penn

2005 COACHING

AND

SUPPORT STAFF

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Coaching and Support Staff

2005 COACHING

J IM KNOWLES

Second Season As Head Coach 15th Season at Cornell Cornell ’87 The Roger J. Weiss ‘61 Head Coach of Football

WWW .CORNELL B IG R ED . COM

When Jim Knowles ‘87 stepped back onto campus in January 2004, his main goal was to revitalize the entire Cornell football program. From alumni and fans to players and parents — mission accomplished. Knowles was named The Roger J. Weiss ’61 Coach of Football by the Meakem!Smith Director of Athletics and Physical Education Andy Noel, becoming the 25th head footballcoachatCornell. The former Big Red assistant engineered one of the greatest turnarounds in Ivy League history, turning a 1-9 team that lost seven games by at least two touchdowns into a4-6squadthatdroppedallsixcontestsby10pointsorless, including four by a touchdown or less. The turnaround of 2004 couldn’t have been more dramatic. A team picked to finish last in the Ivy League finished in sole possession of third place, becoming just the second team in Ivy League history to record a winless season one year and a winning record the next. But even without the wins, the feeling around the program completely changed. TheBigReddefense,rankedlastintheIvyLeagueand104th outof121teamsnationallyinDivisionI-AAagainsttherunat205.0 yardsallowedpergamein2003,cutthataverageinhalf(101.1 ypg.)torankfirstintheIvyLeagueandseventhnationally. Theoffensecontrolledtheball,butalsostruck forbigplaysallseasonwiththreescoringpasses of greater than 50 yards. Cornell held the total time of possession advantage for the season and converted on an impressive 36 percent of its third-downs, keeping drives alive and the defensefresh. Cornellspecialteamsalsosetarecordwitheight kickblocksontheyear,whilethekickreturnsquad averaged20.6yards,itshighesttotalsince1978. Knowles,40,spentnineseasonsasanassistant coachatCornell(1988-96),helpingleadtheteam

2005 FOOTBALL

AND

SUPPORT STAFF

Education Cornell University B.A., Industrial and Labor Relations, 1987 Coaching Experience Cornell University Head Coach, 2004-present University of Mississippi Assistant Coach, 2003 Western Michigan University Defensive Coordinator, 2000-02 Assistant Coach, 1997-2000 Cornell University Assistant Coach, 1988-96

toIvyLeaguetitles in 1988 and 1990. He coached the Playing Experience linebackers(1995- Cornell University, 1983-86 Defensive Lineman 96) and running •Three-year letter winner backs(1989-94).He •Second-team All-Ivy League, 1986 also served as the •Honorable Mention All-ECAC, 1986 recruitingcoordinator (1995-96) and Head Coaching Highlights directed special • Tied greatest turnaround in Ivy history, going teams and spent from 0-7 to a winning mark (4-3) next year. • Led team picked to finish last in preseason one season direct- to third place finish. ing the defensive • Defense ranked seventh nationally and first line(1988). Along in Ivy League against run (101.0 ypg.). Moved with the 1988 Ivy up 97 spots nationally and jumped from last first in the Ancient Eight after cutting yards Leaguetitle,theBig to per game total in half. Red’s rushing • Team won three of its final four games. (113.8)andscoring defense (13.7) ranked No. 1 in the East and was 10th and seventh, respectively in the nation. In 1990, the team featured the No. 11 rushingoffense(237.0)inthecountry. Knowles served as the linebackers coach and recruiting coordinator at the University of Mississippi during the 2003 season. Ole Miss had a standout year,asitpostedits first10-winseason (10-3) since 1971 and claimed a victory at the Cotton Bowl with a 31-28 win over Oklahoma State. Defensively, the Rebels had the nation’s No. 14 defense vs. the run, allowingopponents 102.46 yards per game. The squad also recorded 106 tacklesforloss,including 28 sacks. Ole Miss posted a 7-1 mark in Southeastern Conference play and was co-champion of the SEC’s Western Division for the first time in 40 years. The team’s only conference loss was at the hands of national champion LSU. Prior to accepting the job at Ole Miss, Knowles spent six seasons at Western Michigan University, where he served his last two years as defensive coordinator. He coached the WMU linebackers in 2002 after working the previous five seasonswiththedefensiveline. In his second year as defensive coordinator, Knowles helped the 2002 Broncos finish first in the Mid-American Conference (MAC) and 28th nationally in total defense

2005 COACHING

AND

SUPPORT STAFF

(330.7),playingaschedulethatincluded three Top 25 teams. The defensive unit, which included MAC Defensive Player of the Year Jason Babin, ranked second in the MAC in sacks (33) and pass defense (179.5). Babin went on to become WesternMichigan’sfirst-everfirstroundNFL pick (Houston Texans). The WMU defense held three teams to less than 100 yards rushing and limited three others to less than 100 yards passing. The Broncos held opponents to 217 first downs, fewest in the MAC, and the defensive line extended its quarterback sack streak to 33 games. Knowles’firstyearasdefensivecoordinatorin2001sawthe Broncosrankfirstinpassdefense(179.8yardspergame)inthe MAC and 17th nationally. WMU also paced the MAC with quarterbacksacks(33).Hisdefensivelineunitwasratedasthe secondbestintheleaguebyonepreseasonpublicationasAllMAC performers Anthony Allsbury (first team) and Jason Babin (second team) ranked among the top eight players in sacks. Prior to being named defensive coordinator at Western Michigan on Jan. 17, 2001, Knowles worked exclusively with the down linemen. During the 2000 season, his defensive line unitwaspartiallyresponsibleforhelpingtheBroncoscompile 38 sacks and 15 forced fumbles in 12 games. In addition, the Broncos held opponents to 139 points and posted three

As An Assistant Coach

shutouts — the most scoreless games since 1971. By season’s end, Western Michigan ranked among NCAA Top 20 units in four categories: scoring defense (fourth, 11.5 ppg), total defense (ninth, 283.3 ypg), pass defense (13th, 178.0 ypg) and rushing defense (20th, 105.3 ypg). Two of Knowles’ players, Allsbury and Chris Browning, earned All-MAC first and second-team honors, respectively, asfirst-yearstarters. In 1999, Knowles worked closely with Jeremy Johnson, who went on to earn All-MAC honorable mention. He also developedatwo-timeall-leagueselection in Dan Falcon (1997-98) and the MAC’s leading sack rusher in 1997 with all-league pick Ryan Bauer. During Knowles’ six seasons at WMU, the Brown & Gold generated 207 sacks — including a high of 41 in 1997 — which averages to 34.5 per season. Athree-yearletterwinneratdefensiveendasaplayerforCornell,Knowles earned All-Ivy honors and honorable mention All-Eastern College Athletic Conference accolades in 1986. He ranked second on the team in tackles forloss(11.5)andthirdinsacks(6.5)in hisfinalseason,closingouthisfinal season with64totaltackleswhilealso forcing and recovering a fumble. He was awarded the team’s Frank “Doc” Kavanagh Training Room Athlete of the Year Award as the player who gives his all throughout the season,distinguishinginjuryfrompain. Duringhisthreeseasons,Knowlesrecorded107tackles,16 tacklesforlossand11sacks.Knowleshelpedthe1986teamunder head coach Maxie Baughan to a surprise 8-2 campaign, including a 6-1 mark in Ivy play. As a freshman, Knowles was named the most valuable defensive player on the freshman squad He graduated in 1987 with a bachelor’s degree from the SchoolofIndustrialandLaborRelations. Knowles,aPhiladelphia,Pa.,native,earnedAll-Catholic andAll-CityselectionasalinebackeratSt.Joseph’sPrep.He also competed in crew and wrestling. Knowles and his wife, Nancy ’83 (MBA ’89), have a daughter, Halle, and two sons, Luke and Jack.

School Cornell Cornell Cornell Cornell Cornell Cornell Cornell Cornell Cornell

Coaching Position Def. Line/Special Teams Running Backs Running Backs Running Backs Running Backs Running Backs Running Backs Recruiting Coord./LBs Recruiting Coord./LBs

Head Coach Maxie Baughan Jack Fouts Jim Hofher Jim Hofher Jim Hofher Jim Hofher Jim Hofher Jim Hofher Jim Hofher

Record 7-2-1 (6-1 Ivy, t-1st) 4-6 (2-5 Ivy, t-5th) 7-3 (6-1 Ivy, t-1st) 5-5 (4-3 Ivy, t-4th) 7-3 (4-3 Ivy, 4th) 4-6 (3-4 Ivy, t-4th) 6-4 (3-4 Ivy, t-4th) 6-4 (5-2 Ivy, t-2nd) 4-6 (4-3 Ivy, t-3rd)

1997 1998 1999 2000 2001 2002

Western Michigan Western Michigan Western Michigan Western Michigan Western Michigan Western Michigan

Defensive Line Defensive Line Defensive Line Defensive Line Def. Coordinator/DL Def. Coordinator/LBs

Gary Darnell Gary Darnell Gary Darnell Gary Darnell Gary Darnell Gary Darnell

8-3 (6-2, 2nd MAC West) 7-4 (5-3, t-2nd MAC West) 7-5 (6-2, 1st MAC West) 9-3 (7-1, 1st MAC West) 5-6 (4-4, 4th MAC West) 4-8 (3-5, 5th MAC West)

2003

Mississippi

Linebackers

David Cutcliffe

10-3 (7-1 SEC West, t-1st)

Overall Record 4-6 (.400)

League Record 4-3 (.571)

League Finish 3rd

As Head Coach Year 2004

School Cornell

WWW .CORNELL B IG R ED . COM

Year 1988 1989 1990 1991 1992 1993 1994 1995 1996

2005 FOOTBALL

2005 COACHING

AND

SUPPORT STAFF

CLAYTONCARLIN

Second Season At Cornell Juniata ’87 Assistant Head Coach & The John B. and Ann M. Rogers ‘45 Offensive Coordinator/Wide Receivers

After helping the Big Red defense become one of the most feared in DivisionI-AAaseasonagoasdefensive coordinator,second-yearassistantClaytonCarlinwillattempttobring someofthatmagictotheoffenseinhisfirstseasonastheJohnB.and Ann M. Rogers Offensive Coordinator and wide receivers coach. This willbehisfirststintcoachingontheoffensivesideoftheballsince1999. Carlin’s 2004 defense was stingy against the run, allowing opponents just 101.1 yards per game. The Big Red defense, ranked last in the Ivy League and 104th out of 121 teams nationally in Division I-AA against the run at 205.0 yardsallowedpergamein2003,cutthataverageinhalftorankfirst in the Ivy League and seventh nationally. The Big Red did not allow an opposing running back break the 100-yard barrier all season and ranked among the national leaders in scoring defense (18.1 ppg.). The Big Red created 20 turnovers in 2004 after forcing just eight opponent miscues the season before. The defense posted 23 sacks on the year, nearly twice as many as in 2003 (12). Carlin joined the Cornell football staff after spending the 2003 season as the secondary and special teams coach at New Mexico State, where he also served as an assistant from 1997-99. He left NMSU after the 1999 season and was an assistant for one year at Villanova before heading to Buffalo, where he worked for two years. Carlin was secondary coach at Buffalo and in 2001 the Bulls ranked 18th in the nation in pass defense, allowing just 180 yards per game. He was wide receivers coach all three seasons in his first

stop at NMSU and also served as specialteamscoordinatorin1999.Priorto his arrival at NMSU, CarlinspentthreeseasonsasagraduateassistantatNebraskawhere he worked primarily with the defensive backs. He was a part of the two Husker national championship teams in 1994 and 1995. A nativeofPhiladelphia, Pa.,CarlinjoinedtheNebraskastaffafter serving two seasons as the secondary coach at Delaware Valley College in Doylestown, Pa. For five seasons, from 1987 to 1991, Carlin coached at his prep alma mater, St. Joseph’s Preparatory High School in Philadelphia. After one season as secondary coach in 1987, Carlin spent four years as St. Joseph’s head coach. He produced 42 players who were selectedtotheAll-CatholicteaminPhiladelphia. A1987graduateofJuniataCollegeinHuntingdon,Pa.,Carlinwas a three-year starter at defensive back for the nationally ranked Eagles. Carlin earned his master’s degree in 1998 from Nebraska in educationaladministration. Carlin and his wife, Kathleen, reside in Lansing with their four children,Carsen,Julia,ClaytonJr.andBrady.

B RIAN COON

Second Season At Cornell Albion ’92

WWW .CORNELL B IG R ED . COM

Assistant Offensive Coordinator/ Offensive Line Coach

Brian Coon enters his second season as the Big Red’s offensive line coachandthisseasonwilltakeonthedualresponsibilityofassistant offensivecoordinator.Ifhisfirstseasonisanyindication,hewillbe building an even tougher, stronger and more technically sound quintet in 2005. Coonwillhavethechallengeofreplacingthreestartersandfour letterwinnersontheline,butreturnstwo-timefirst-teamAll-Ivy selection Kevin Boothe to anchor a young, but talented, group. Coon served as offensive coordinator and offensive line coach at Kalamazoo for the previous six years before coming to Cornell, working under former Big Red offensive coordinator Tim Rogers. His offenses averaged 31.5 points and 385.5 yards per game over his finalthreeseasonsthere,andhecoachedtheschool’sall-timecareer leadersinpassing,receivingandrushing. The Watervliet, Mich., native coached at St. Joseph’s College in Rensselaer, Ind., from March 1995 to July 1998. During his tenure, the Pumas were ranked as high as No. 3 in the nation in rushing offense (299.7 ypg.) and No. 9 in scoring offense (36.7 ppg.). Coon

2005 FOOTBALL

alsoservedasquarterbacks,defensive backs and special teams coach and was recruiting coordinator at St. Joseph’s. Coon served as agraduateassistant coach at Western Michigan from 1993-95 and received a master’s degree in athletic administration from WMU in 1997. A 1992 graduate of Albion College, he earned a degree in communications and exercise science. Coon was a four-year letter winner as an outside linebacker for the Britons. He was also named the squad’s Special Teams Player of the Year as a senior. Coon and his wife, Heather, reside in Freeville with their two children,AlexisandTJ.

2005 COACHING

AND

SUPPORT STAFF

PETEDeSTEFANO 16th Season At Cornell Slippery Rock ‘78

Associate Defensive Coordinator/ Defensive Line Coach Pete DeStefano has been a constantonthesidelinesfortheBigRed since1993andwilltakeovertherole of associate defensive coordinator in 2005. The 2004 season was a banner one for Cornell’s defensive line, which dominated the line of scrimmage all season. UsingoneofthedeepestrotationsintheIvyLeague,Cornellheld opponentstojustover100yardspergameontheground,withAll-Ivy second-teamselectionRyanLempaleadingtheway.Thedefensiveline chippedinwith35tacklesforlossand10sacks.DeStefano’skickblock schemesalsohelpedCornelltoaschool-recordeightblocksin2004. The Big Red has now blocked 34 kicks in DeStefano’s tenure. DeStefano believes that hard work brings success, and often points to his former charge, Seth Payne ’97, a defensive tackle with the Houston Texans, as proof. After recruiting Payne, who barely weighed in over 225 pounds, DeStefano watched the tackle blossom into a fourth-round NFL draft pick, showing that the months studying film and dissecting opposing offenses is worth it. DeStefanostartedhisCornellcareerastheheadfreshmancoachand academiccounselorfortheathleticdepartmentinMay1990.Priorto coming to Cornell, he was associate head coach and defensive coordinatorinchargeofthelinebackersatRensselaerPolytechnicInstitute from 1986-90. He was also an assistant track coach at Rensselaer. BeforeRensselaer,DeStefanowasdefensivecoordinatorandlinebacker coach at Allegheny College from May 1984 to June 1986, and he wasalsoheadtrackcoach.

Priortohisstint at Allegheny, DeStefano coached at Edinboro(Pa.)University,servingasheadjuniorvarsitycoachanddefensivecoordinator in 1981, with the varsity offensive line in 1982 and with the defensive ends in 1983. He was also strength coach and helped with recruiting. A1978graduateofSlipperyRock(Pa.)Universitywithabachelor of science degree in physical education and health, DeStefano receivedhismaster’sineducationaladministrationfromEdinboroin 1982.Whileanundergraduate,heplayedtightendforthreeyearsand received honorable mention All-Western Pennsylvania Conference. From 1978-81, DeStefano coached at Clinton (N.Y.) Central High School. As the head varsity coach, he directed the team to the TriValley League championship in 1979 and was named Coach of the Year. He also coached track at Clinton. A 1974 graduate of New Hartford (N.Y.) High School, DeStefano wasall-leagueinfootballandtrack.Hisbrother,Jim,co-captained the 1979 Cornell football team and was an AP All-America honorable mention linebacker in 1980. DeStefanoandhiswife,Joanne,resideinIthaca.Theirson,Peter, isasenioratJohnsonandWalesUniversity,studyinghotelrestaurant management. Joanne received her master’s of business administration degree from Cornell’s Johnson School of Management in 1997.

BRADBEERWINKEL Second Season At Cornell Texas ’97 Recruiting Coordinator/ Safeties Coach The Brenham, Texas,nativepreviously spent four seasons at Blinn Junior College in Texas,workingfulltime with the quarterbacks,receivers and running backs. He also served as recruiting coordinator and coached four players who advanced to the NFL. Beerwinkel earned a bachelor of science degree in kinesiology fromtheUniversityofTexasin1997.WhileinAustin,heworkedfour years as a student coach/equipment manager. Beerwinkel earned a master’s degree in sports administration from Western Michigan in 2003 and a master’s degree in health and human performance from Prairie View A&M in 2001. Beerwinkel resides in Ithaca with his wife, Amanda.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

BradBeerwinkelentershissecond season as an assistant coach working with the team’s safeties and this season assumes the added responsibilityofrecruitingcoordinator. Beerwinkel coached a group that had several linebackers switching positions and turned them into one of the hardest-hitting defensivebackfieldsintheAncientEight. When All-Ivy candidate Joel Sussman went down with an injury midway through the season, Beerwinkel plugged in Kevin Rex, who came from nowehere to earn second-team All-Ivy status. The Big Red safeties became big-time playmakers in Cornell’s new defensive schemes. The group was responsible for 18 tackles forloss,17passbreakups,sevenforcedfumbles,fiveblockedkicks and three interceptions. They also played key roles in the run defense,whichranked11thnationallyallowingjust101.1yardsper game. BeerwinkeljoinedtheCornellstaffafterservingasthedirectorof football operations at Western Michigan in 2003. He also worked as a defensive graduate assistant with the Broncos for three seasons, including time during Coach Jim Knowles’ tenure at WMU.

2005 COACHING

AND

SUPPORT STAFF

S C O T T KAVANAGH Second Season At Cornell Wisconsin ’01 Quarterbacks Coach Scott Kavanagh enters his second season on Jim Knowles’ staff. He will take over as the team’s quarterbacks coach in 2005 after working with the Big Red receiving corps a season ago. In his first season, Kavanagh worked with All-Ivy receiver Brian Romney and big-play specialist Chad Nice, who combined for 103 catches and more than 1,400 receiving yards. In all, 11 different players caught passes for the Big Red in 2004, including six of the top seven who were underclassmen. KavanaghjoinedtheBigRedstaffafterhavingspenttheprevious two seasons as a graduate assistant coach working with the quar-

terbacksattheUniversityof Wisconsin. Afour-yearletterwinner for the Badgers (1996-99), Kavanagh’s teams won back-to-backBigTentitles (1998 and 1999), won two Rose Bowl championships (1999 and 2000) and compiled a 37-13 recordoverhisfouryears. AnativeofNaperville,Ill.,Kavanaghearnedhisbachelor’sdegree in life sciences and communication in 2001 from Wisconsin. He is currentlyworkingonamaster’sdegreeineducationadministration.

RODERICKPLUMMER Second Season At Cornell Washington State ‘93

WWW .CORNELL B IG R ED . COM

Defensive Backs Coach/ Special Teams Coordinator

Roderick Plummer enters his second season on head coach Jim Knowles’ staff and will continue coachingthespecialteams,butwillswitchsidesoftheballin2005. Plummer will move from running backs coach to defensive backs coach. His addition to the coaching staff a season ago paid immediatedividends. With 11 different players running the ball in 2004, the Big Red’s grind-it-out running game was highlighted by upperclassmen Andre Hardaway and Joshua Johnston, who combined for more than 800 yards rushing and eight touchdowns. Cornell special teams set a record with eight kick blocks on the year, while the kick return squad averaged 20.6 yards, its highest total since 1978. The Big Red enjoyed an outstanding year in the kicking game as well. Cornell booted eight field goals and Trevor MacMeekin was named Ivy League and national Special Teams Player of the Week after his school-record four field goals in a win overYale.Inall,threedifferentplayersearnedIvyLeagueSpecial Teams Player of the Week during the season. Plummer joined the Big Red staff after serving as an assistant coach at Kutztown University. He was the team’s linebacker coach and special teams coordinator for two seasons, and he also served as the running backs coach at Kutztown from 1994-95. In June 1996, he moved on to James Madison for one season and

2005 FOOTBALL

then to Hampton through1998,serving as running backs coach at both schools.Duringthe 1997 and 1998 seasons at Hampton, his running backs ledtheMid-Eastern Athletic Conference. After his stint at Hampton, Plummer moved to Michigan State, where he served as a graduate assistant coach from 1999-2001 whilepursuingamaster’sdegreeinathleticadministration.Before returning to Kutztown, Plummer coached linebackers and special teams at Wayne State in Michigan. Plummer has also served NFL fellowships with the San Francisco 49ers (2003) and the Cleveland Browns (1992). Plummer graduated in 1993 from Washington State University with a bachelor’s degree in sociology. He was a four-year letter winnerandstartinglinebackerfortheCougars.ACalifornianative, he was inducted into the St. Mary’s High School (Berkeley, Calif.) Athletic Hall of Fame in 2002.

2005 COACHING

AND

SUPPORT STAFF

RICKYRAHNE

First Season As Assistant Coach Fifth Season at Cornell Cornell ’02 Running Backs Coach

Ricky Rahne, one of the greatest quarterbacks inCornellhistory,returnstohisalmamateronJimKnowles’staffasrunningbackscoach. Hewillhaveplentyofoptionsinhisfirstseason,astheBigRedreturns six of its top seven rushers from a season ago. Rahne spent the 2004 campaign as a defensive assistant at Holy Cross,primarilyworkingwiththedefensiveends.Inhisonlyseason withtheCrusaders,Rahneassistedwiththejuniorvarsityteam,while also playing important roles in film breakdown and preparing scouting reports for each week’s opponent. RahnefinishedhiscareerastheBigRed’sall-timeleaderinnearly every passing category and earned the team’s MVP honors three times. The three-year starter remains the career leader in completions (678), yards (7,710), touchdown passes (54) and 200-yard

passing games (25).Hefinishedhis careerrankedasthe Ivy League’s third all-timecareerpassingleader. A 2002 Cornell graduate with a degree in industrial andlaborrelations, Rahne worked as an intern in the National Football League office during the summer before his senior year. Before his stint at Holy Cross, Rahne worked at the Cintas Corporation as a part of the company’s management trainee program.

Z AC ROPER

First Season At Cornell Mississippi ’01 Tight Ends Coach points) that also ranked sixth alltimeinSEChistory. Healsofinishedhis careerwithastreak of 117 consecutive PATs made. Priortoarriving in Oxford, Roper served as an undergraduateassistantcoachforJohnBlake’sstaff,whileattendingthe University of Oklahoma from 1996-1998. While in Norman, Roper prepared scouting reports and assisted in the preparation of the offensive game plan. Roper was a recipient of the 1996 Presidential Leadership Scholarship as an entering freshman at Oklahoma. AnativeofKnoxville,Tenn.,RopergraduatedfromMississippiin 2001 with a degree in political science and went on to receive his master’s in higher education/student personnel two years later. He was a four-time member of the Chancellor’s Honor Roll.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Zac Roper, who spent the last four years on the staff at Mississippi, will begin his first year as an assistant coach on Jim Knowles’ staff. He will work with the Big Red tight ends, including All-Ivy candidates Chris Eckstein and Troy Follmar. RoperjoinstheBigRedcoachingstaffafterworkingasagraduate administrative aide and graduate assistant coach at Mississippi, workingwithwidereceivers,tightendsandkickers.Healsoassisted in the preparation of scouting reports. Roper was part of the 2003 Ole’ Miss squad that won the Cotton Bowl and finished the season with a 10-3 record and a 7-1 mark in SEC play. Two players coached by Roper, place-kicker Jonathan Nichols and punter Cody Ridgeway, were ranked among the nation’s top special teams players. Nichols, the 2003 Lou Groza Award winner asthenation’stopkicker,earnedfirstteamAll-AmericaandAll-SEC honors in 2004, while Ridgeway earned second team All-SEC accolades after ranking third in the SEC and 11th nationally by averaging 44.2 yards per punt. Nichols finished his career with 15 school records, including the school’s career scoring mark (344

2005 COACHING

AND

SUPPORT STAFF

T IM SIMPSON

First Season As Assistant Coach Fifth Season at Cornell Cornell ’94 Linebackers Coach

Tim Simpson returns to his alma materandwillbeginhisfirstseasonas anassistantcoachonJimKnowles’staff,workingwiththelinebackers. Simpson spent the 2004 season at Marist coaching the defensive line coach. He mentored the Metro Atlantic Athletic Conference’s RookieoftheYear,aswellasafirst-teamall-leagueselectionandtwo second-team picks. One of his players was named to the Mid-Major All-America second team. Simpson helped guide a defense that recorded 29 sacks on the year for the Red Foxes, which went 3-1 in MAAC play to finish second in the league. Simpson came to the Red Foxes having spent the previous season as the defensive coordinator at Washingtonville High School, leadingthevarsitysquadtoaSectionIXClassAADivisionchampionship. In that role, he oversaw and implemented the defensive scheme for

the program, and lowered the program’spointsallowed by 17 points per game from the previous season. Simpson has also worked as a senior associate at Pricewhaterhouse Coopers LLP and as a hospitality appraiser at Cushman & Wakefield. A1994graduateofCornellwithadegreeinhoteladministration, Simpson played four seasons at defensive tackle for the Big Red. The Washingtonville, N.Y.,native,andhiswife,Dina,haveadaughter, Taylor.

Cornell Recruiting Territories 2005-06

WWW .CORNELL B IG R ED . COM

Below is the list of the Big Red football staff’s primary recruiting areas. If you are, or know of, a prospect in those areas that might be a good fit for the Cornell football program, please contact the recruiting contact for that area. Information for each of the coaches is located on page 4 of this guide.

Area Coach Alabama ................ Zac Roper Alaska ................ Ricky Rahne Arizona ............... Ricky Rahne Arkansas ................ Zac Roper California - Northern .... Rod Plummer California - Southern .... Clayton Carlin Colorado .............. Ricky Rahne Connecticut ........... Tim Simpson Washington D.C. .......... Zac Roper Delaware ............. Clayton Carlin Florida ................. Zac Roper Georgia ................ Zac Roper Hawaii ............... Ricky Rahne Idaho ................ Ricky Rahne Illinois ................. Brian Coon Indiana ................ Brian Coon Iowa ................. Ricky Rahne Kansas ............... Ricky Rahne Kentucky ............... Brian Coon Louisiana ............... Zac Roper Maine .............. Pete DeStefano

2005 FOOTBALL

Area Coach Maryland ............... Zac Roper Massachusetts ........ Pete DeStefano Michigan (Central/West) ... Brian Coon Michigan (Detroit) ..... Scott Kavanagh Minnesota ........... Scott Kavanagh Mississippi .............. Zac Roper Missouri ............... Brian Coon Montana .............. Ricky Rahne North Carolina ........... Zac Roper North Dakota .......... Ricky Rahne Nebraska .............. Ricky Rahne Nevada ............... Ricky Rahne New Hampshire ....... Pete DeStefano New Jersey (South/Central) .. Clayton Carlin New Jersey (North) ...... Rod Plummer New Mexico ........... Ricky Rahne New York (local) ........ Clayton Carlin New York (Albany, Utica) . Pete DeStefano New York (Downstate) .... Tim Simpson New York (Upstate) .... Brad Beerwinkel Ohio (North) ......... Scott Kavanagh

Area Coach Ohio (South) ............ Brian Coon Oklahoma ............. Ricky Rahne Oregon .............. Rod Plummer Pennsylvania (Philadelphia) Clayton Carlin Pennsylvania (Central) .. Pete DeStefano Pennsylvania (West) .... Scott Kavanagh Rhode Island ......... Pete DeStefano South Dakota .......... Ricky Rahne South Carolina ........... Zac Roper Tennessee ............... Zac Roper Texas .............. Brad Beerwinkel Utah ................. Ricky Rahne Vermont ............ Pete DeStefano Virginia ................. Zac Roper Washington .......... Rod Plummer West Virginia ......... Scott Kavanagh Wisconsin ........... Scott Kavanagh Wyoming ............. Ricky Rahne Canada ............. Brad Beerwinkel Junior Colleges ........ Rod Plummer

2005 COACHING

AND

SUPPORT STAFF

PETENOYES

28th Season At Cornell Bridgeport ’68

Director of Football Operations A fixture in Schoellkopf Hall for over 27 years, Pete Noyes has spent thepastsevenseasonsasthedirector offootballoperations. Heisresponsibleforcoordinatingthedayto-day operations, including administrative duties such as alumni andparentrelationsandfootballfundraising.Healsoservesasthe liaisontotheCornellFootballAssociation,andwashonoredwiththe Lou Conti ‘41 Lifetime Achievement Award in 2001. His efforts were also recognized on the national level in 2003, when he received the All-American Football Foundations’s Mike Campbell Top Assistant Coach Award. Because of Noyes’ work, the Big Red program runs like a welloiled machine both on and off the field. Since being named the Director of Football Operations, Noyes has helped Cornell Football Association (CFA) membership rise from 250 to 1,400 while nearly triplingthefootballprogram’sannualfund.TheBenMintz/CFAGolf and Tennis Outing he runs has grown from 50 to 300 golfers, while net income has rise from $4,000 to $128,000. Noyes came to Cornell in 1977 as head defensive and linebacker coach and in 1981 was named by coach Bob Blackman as his first defensivecoordinatorbytitlein32yearsofcoaching.Upuntil1998, hefilledavarietyofroles,servingasdefensivecoordinator,recruiting coordinator (1983-93), offensive line coach and defensive backs coach. He was also the assistant head coach from 1986 to 1989. Noyes’ hard-nosed approach to the game enabled him to coach the Cornell defense to Division I-AA runner-up for fewest

points allowed per game in 1986, a seventh-place finishinI-AAin1988. In both 1986 and 1988, Noyes’ defense topped the Ivy League and the East in the same category. The defense’s 1986 performance was also the best-ever at Cornell since the formation of the Ivy League. In 1990, while Noyes was the offensive line coach, Cornell had three first-teamAll-Ivylinemenforthefirsttimeever. In1993,theBigRed defense was sixth in the nation in total defense, 13th in scoring defense,17thinrushingdefenseand21stinpassefficiencydefense. Overall, his teams recorded 21 career shutouts, including 12 with Cornell. During his 21 years of coachign at Cornell, Noyes recruited 18 captainsandcoachedofrecruited25first-teamAll-Ivyselections. He recruited 10 starters on the 1988 Ivy championship team and 14 starters from the 1990 championship squad. NoyespreviouslyservedasthedefensivecoordinatoratBucknell for six seasons under the late Fred Prender and Bob Curtis with emphasis on the linebackers. A 1968 graduate of the University of Bridgeport, he was cocaptain of the football team as a senior. The former linebacker was a three-year starter and was named to the school’s all-time team in 1969. Peteandhiswife,Carol,resideinIthacaandhavethreechildren: Jennifer Noyes ‘98; Justin Brion; and the late Ronnie Brion ‘00.

TOMHOWLEY

10th Season At Cornell Tulane ’88

Head Coach of Strength and Conditioning Bowl and the 1991 Peach Bowl champions. Howley also served as an assistant coach with the specialteams. A 1988 graduate of Tulane, Howley earned a bachelor ofartsdegreeinhistory and was a three-year letterman and two year starting offensive lineman on the football team. The Green Wave played in the 1987 Independence Bowl his senior year. He was the recipient of the New Orleans Quarterback Club Student-Athlete Award as a senior. HowleyisanactiveparticipantintheCornellUniversity/Ithaca College chapter of the Fellowship of Christian Athletes. He and his wife, Amanda, reside in Ithaca with their daughter, Anna Corrine.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

2005 COACHING B ERNIE DePALMA

AND

SUPPORT STAFF

JIMCASE

25th Season at Cornell Quinnipiac ’78

18th Season at Cornell Central Michigan ’86

The Doc Kavanagh Head Athletic Trainer/Physical Therapist

Associate Head Athletic Trainer

BernieDePalma’stopprioritiesarethehealth andsafetyofthestudent-athletes,andproviding them with a safe environment for training and competition.Hehasbeenanintegralmemberoftheathleticstaffashead ofphysicaltherapy,athletictrainingandrehabilitationforCornellUniversityHealthServicessinceAugust1980andheadathletictrainersince1983. DePalmagraduatedfromQuinnipiacCollegewithabachelorofscience degree in physical therapy in 1978 and received his master’s degree in athletictraining-sportsmedicinefromtheUniversityofVirginiain1980. DePalma was a founding member of the Cornell Sports Nutrition Discussiongroupwhichexaminestherolenutritionplaysinthestudentathlete’s well-being and performance. He also manages programs he developedforgraduateassistantshipswithIthacaCollegeandathletic trainer internships from Ithaca and other area colleges. He supervises seven full-time staff members and numerous part-time assistants. DePalma’sexpertise impacts national athletics legislation. He has served on numerous NCAA committees, including the committee on competitive safeguards and medical aspects of sport safety, which he chaired;theNCAAspecialcommitteeonstudent-athletewelfare,access andequity;andthenationalathletictrainer’staskforcewhichdeveloped medicalcoverageguidelinesforallintercollegiateathleticprograms. Hewashonoredin2001bytheNationalAthleticTrainers’Association (NATA) with the Most Distinguished Athletic Trainer Award. The award recognizestheNATA’scertifiedmembersfortheiroutstandingcontributionstotheprofessionofathletictrainingandtotheassociation. DePalma and his wife, Mary, have a daughter, Taylor, and a son, Turner.

Administrative Staff

Karen Berkley

Becky Hollenback-Miller

Administrative Assistant

Recruiting Secretary

Faculty Advisers

JimCaseentershis18thseasonasanathletic trainer for the Big Red. He joined the Cornell trainingstaffinAugust1988,andhisresponsibilitiesincludeworkingwiththefootballandlacrosseteams. A 1986 graduate of Central Michigan University, he earned his bachelor of science degree in sports medicine with a minor in exercise science. Case received his master of arts degree in physical education from Western Michigan University in June 1988, with a concentration in athletictraining. Case spent the summer of 1989 as an intern with the Detroit Lions of the NFL and was also appointed to the training staff for the 1990, 1994 and 1998 World Lacrosse team tryouts. He served as the trainer for 1994 Team USA at the World Lacrosse Championships in Manchester, England, and served in the same capacity for Team USA at the 1998 world championships in Baltimore, Md. Caseandhiswife,Ladeen,resideinIthacawiththeirdaughter,Devin, and sons, Carson and Collin.

D ALE STRAUF 27th Season at Cornell Cortland State ’79 Head Equipment Manager

Dale Strauf has been in charge of the equipmentforCornellathleticssince1979. The2005 season is his 27th with Big Red football, and he has attended every football game during his tenure, an amazing 258 straightcontests. As the head equipment manager, Strauf is responsible for equipment purchasing for Cornell athletics, physical education, intramurals and recreation. He oversees a staff of eight, with seven holding national certification. These professionals equip 24 men’s and women’s teams. Strauf attended Cortland State and graduated magna cum laude in 1979. He received a master’s degree in education from Cortland in 1982. In 1992, Strauf was named National Equipment Manager of the Year by his peers. He is currently serving his second three-year term as the president of the Athletic Equipment Managers Association (AEMA). Apastassociateexecutivedirectoroftheorganization,hehaspublished 20 articles in the field of equipment management. Strauf was one of five equipment managers who developed a certification program for athletic equipment management. Strauf and his wife, Jerra, have a daughter, Tam, and a son, Bo, and two granddaughters, Sue and Lexi.

Dr. Rosemary J. Avery

WWW .CORNELL B IG R ED . COM

College of Human Ecology WeissPresidentialFellow Professor

Equipment Staff

David DeVries Assoc. Dean for Undergraduate Admissions and Education

Dr. Matthew Miller CollegeofEngineering AssociateProfessor

Eve Woodman Tominey CenterforLearning and Teaching Lecturer

2005 FOOTBALL

Doug Vorhis

Dick Randall

EquipmentAssistant

2005 OUTLOOK

AND

TEAM

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

2005 Outlook and Team

2005 OUTLOOK 2005

AND

TEAM

The Offense Cornell will continue to spread out its opponents, but this year will focus on the running game with a pair of talented senior running backs, Andre Hardaway and Joshua Johnston. The duo will be able to run behind All-America candidate Kevin Boothe as the Big Red offense looks to break out in 2005. Running Backs

Quarterbacks

WWW .CORNELL B IG R ED . COM

No. 11 17 12 19 15 16

Name Shane Connolly Nathan Ford RYAN KUHN Todd Lisowski Tyler Lucas Tom Piselli

Cl. Fr. Fr. Sr. So. Fr. Fr.

Ht. 6-1 6-1 6-4 6-1 6-2 6-1

Wt. 181 188 237 191 204 224

Exp. — — 1L — — —

The Big Red is expected to turn to senior Ryan Kuhn behind center. A very mobile quarterback, Kuhn can make plays with his feet or with his arm, in the pocket or on the run. He started four games a season ago, with the Big Red going 3-1 when he opened under center and RyanKUHN brings the confidence of his teammates into the 2005 season. Despite splitting time with D.J. Busch, Kuhn finished the season 54-for-105 (.514) for 615 yards and three touchdowns. He also ran for three scores. Kuhn tossed for a career-high 208 yards and two touchdowns in the Big Red’s win over Princeton and rushed for two scores and a career-high 48 yards against Brown. He had six rushes on the season for 10 or more yards and had two passes of at least 50 yards in his limited time. A spot as Kuhn’s backup will be a dogfight in the fall, with the early favorite being sophomore Todd Lisowski. The 6-1, 191-pound Lisowski quarterbacked the junior varsity team a season ago and has good poise in the pocket. Lisowski will compete with several incoming freshmen for playing time. Cornell brought in four freshmen that will compete with Lisowski for the backup spot while pushing Kuhn. Heading the list is Shane Connolly, the New York State Class A player of the year who led nearby Maine-Endwell HS to a state title last year. Nathan Ford, a heavily recruited Division I baseball prospect, tossed for 6,357 yards and 72 touchdowns as a varsity starter at Palo Alto HS in California. Tyler Lucas and Tom Piselli were both all-league selections who bring significant size and strong arms to the position.

AndreHARDAWAY

2005 FOOTBALL

No. 46 14 28 3 26 32 28 33 81 40 25 49

Name Jamie Germani Andre Hardaway Chi Chi Ibegbu JOSHUA JOHNSTON Shane Kilcoyne Anthony Macaluso Aaron Mumford Brian Ostrowsky Kyle Perez Todd Rusinkovich Luke Siwula Dan Wasser

Cl. Fr. Sr. So. Sr. Fr. Jr. Fr. Fr. So. Jr. So. So.

Ht. 5-10 6-0 5-8 6-1 5-11 5-7 6-0 6-1 5-10 6-0 6-0 5-9

Wt. 181 220 185 214 187 196 175 203 240 231 191 222

Exp. — 3L — 2L — 1L — — — — 1L —

The offensive backfield is in tremendous shape, as returning starters Joshua Johnston and Andre Hardaway will bring their varied skills back for their senior seasons. Both players bring great size and strength to the position. The bruising Johnston emerged as the team’s starter the last two seasons and is 79 yards shy of becoming a 1,000-yard rusher for his career. Despite missing two games due to injury in 2004, Johnston grinded out 475 yards and scored three touchdowns. He rushed all three of his TDs in the team’s final two games. Johnston also had a season-high 142 all-purpose yard and 93 yards on the ground in the Ivy win over Yale. He also emerged as a threat to catch the ball out of the backfield, hauling in 14 passes for 86 yards. Hardaway’s speed and athleticism led him to break out when Johnston was injured, rushing for 348 yards and a team-leading five touchdowns while gaining 665 all-purpose yards. Hardaway racked up a career-high 130 rushing yards and two touchdowns while totaling 255 all-purpose yards as Cornell gave undefeated Harvard all it could handle in Cambridge, then posted 84 yards and a touchdown in a near-defeat of Colgate. Hardaway ranked fourth on the team with 14 catches for 113 yards and was second in kick return yardage with nine returns for 204 yards to show his allaround ability. A pair of sophomores got their feet wet as rookies and will attempt to break into the regular rotation of running backs in 2005. Luke Siwula and Chi Chi Ibegbu combined for just eight carries on the year, but in practices and scrimmages proved they could be the Big Red’s backfield of the future. Freshmen Jamie Germani, Shane Kilcoyne, Aaron Mumford and Brian Ostrowsky will also look for carries after award-filled prep careers. Mumford (Oregon) and Ostrowsky (Pennsylvania) were both first-team all-state picks as seniors, while Kilcoyne is the son of a former Cornell gridder and a third-team all-state selection in California. Germani rushed for more than 3,500 career yards and scored 36 touchdowns. Junior Anthony Macaluso lettered in 2004 as a blocking fullback and a tremendous special teams contributor. He is expected to continue in that role and could also see additional carries. He is a great change-of-speed back who can also plow over defenders. Juniors Todd Rusinkovich and sophomores Kyle Perez and Dan Wasser will also attempt to see time on the field at fullback.

2005 OUTLOOK

AND

TEAM

Wide Receivers No. 21 82 24 7 13 22 9 8 4 1 23

Name Jesse Baker Patrick Blakemore Horatio Blackman Zac Canty Chris Gallagher Joshua Hulseberg Steve Hyland ANTHONY JACKSON Colin Nash BRIAN ROMNEY Zach Vredenburgh

Offensive Line Cl. Fr. Jr. Fr. Fr. Jr. Fr. Fr. Jr. So. Sr. Fr.

Ht. 6-2 6-2 6-1 5-8 5-10 5-8 6-2 5-8 5-11 5-9 6-2

Wt. 184 204 170 164 188 152 200 173 169 166 199

Exp. — — — — — — — 2L 1L 1L —

When Kuhn looks deep, he will have several big-play receivers to choose from as Cornell returns six of its top seven receivers from a year ago. All-Ivy selection Brian Romney and junior Anthony Jackson headline the deep threats. Romney led the team and finished among the Ancient Eight leaders in receptions (60) and receiving yards (766) while catching three touchdowns. A speedy receiver with great hands, the senior runs precision routes and isn’t afraid to catch the ball over the middle. Romney’s 12.8 yards per catch ranks behind only Jackson, who caught 23 passes for 13.7 yards per grab. He also served as the team’s primary kickoff returner, averAnthony aging 21.9 yards per return. He had at least JACKSON three catches in each of the team’s last five games and proved to be an improving deep threat, hauling in passes of 41 yards at Columbia and 50 yards against Penn. Juniors Patrick Blakemore and Chris and sophomore Colin Nash will fight for time as the third receiver. The Big Red also added six freshmen at wideout, as Jesse Baker, Horatio Blackman, Zac Canty, Joshua Hulseberg, Steve Hyland and Zach Vredenburgh eye playing time.

Tight Ends No. 87 89 84 48 18 85 80

Name Ryan Adams CHRIS ECKSTEIN Troy Follmar Stu Homan William Macias Jeff Rosage Alex Spooner

Cl. Fr. Sr. Sr. Jr. Fr. So. Fr.

Ht. 6-5 6-3 6-2 6-2 6-3 6-3 6-1

Wt. 235 243 240 229 215 235 227

Exp. — 2L 1L 1L — — —

Name Ed Anthes-Washburn JoshBarvin John Bazzo KEVIN BOOTHE Matt Cosh Matt Lundy Kevin Marchut Brian McGuire EricMiller JON MOODY Justin Mortensen Babak Motamedi Loren Rosenberg TED SONNENBERG Steve Valenta Patrick Wu Rob Zingale

Cl. Jr. Fr. Sr. Sr. So. Fr. Jr. Jr. Jr. Sr. Fr. Fr. So. Jr. Fr. Jr. Fr.

Ht. 6-3 6-7 5-11 6-5 6-6 6-2 6-5 6-3 6-5 6-0 6-1 6-5 6-2 6-4 6-5 6-3 6-2

Wt. 291 257 263 315 269 292 301 314 283 267 287 327 248 278 297 300 246

Exp. — — — 3L — — — — — 1L — — — 1L — — —

No name is bigger on offense than senior offensive lineman Kevin Boothe, an NFL prospect and three-time All-Ivy selection. Boothe will be the rock that Knowles will rebuild his offensive line around after losing three starters. At 6-5, 315-pounds, Boothe has quick hands and feet, tremendous athleticism and a mean streak in blocking in both the running and passing games. Boothe made the transition from right guard to right tackle with ease last season and was the only unanimous first-team All-Ivy selection on the line in 2004. He will once again be a tremendous presence and leader on a young line for the Big Red this season. Junior Ted Sonnenberg (right guard) and senior Jon Moody (center) combined to start 10 games and bring some much-needed experience into the season. Sonnenberg started the final six contests and will join with Boothe to form a formidable right side of the line. Junior Patrick Wu, a transfer from Oregon State, will also have a chance to earn a starting spot after serving as a reserve for the Beavers for two years. He brings great size (6-3, 300) and skill, but will need to quickly pick up the new blocking schemes. Several players showed great potential and had a chance in spring ball to make a great impression. Juniors Kevin Marchut (6-5, 301) and Eric Miller (6-5, 283) are early leaders to earn a starting position, while senior John Bazzo, juniors Ed Anthes-Washburn, and Brian McGuire, and sophomores Matt Cosh and Loren Rosenberg will all have opportunities to break into the rotation as well. The Big Red and assistant offensive coordinator Brian Coon will have a chance to develop six freshmen who already bring in great size, averaging 6-3 and 275 pounds. The group includes first-team all-state selections Justin Mortensen (Wisconsin), Babak Motamedi (Michigan) and second-team all-state pick Steve Valenta (Illinois), as well as imposing 6-7, 257-pound Josh Barvin. Matt Lundy and Rob Zingale will also attempt to earn snaps protecting the quarterback.

JonMOODY

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Cornell utilized the tight end in the passing game much more last year than in previous campaigns, and the Big Red return its top two threats from that position. Seniors Chris Eckstein and Troy Follmar combined to haul in 16 passes for 184 yards and a touchdown in 2004 and will be even bigger targets this season. Special teams star Stu Homan and sophomore Jeff Rosage also possess good size and can also catch passes in the flat. All four are also strong blockers when they stay in for pass protection and have shown the requisite toughness to become leaders of the offense. Also looking to earn time at tight end are freshmen Ryan Adams, William Macias and Alex Spooner. All three are outstanding athletes, with Macias having played quarterback throughout high school. Spooner also has the skills to be a long snapper, while Adams was a star on both the football and basketball teams and at 6-5, brings tremendous size to the receiving position.

No. 76 63 60 77 73 62 75 72 71 50 64 78 74 68 79 59 61

2005 OUTLOOK 2005

AND

TEAM

The Defense A year ago, the revamped Big Red defense ranked among the most fearsome in all of Division I-AA. With big-play performers like Kevin Rex and Joel Sussman returning, Cornell hopes to build on its reputation and take its standing among the top defenses to play on historic Schoellkopf Field. Linebackers

Defensive Line

WWW .CORNELL B IG R ED . COM

No. 91 65 95 93 54 52 56 94 90 67 92 69 98 56 66 99 70 96

Name Dario Arezzo Scott Boone Pete Burnham Brendan Daly Matt Darby JeffDicks Rick Greco Spencer Hansen Ryan Kiscadden Frank Kunis JONATHAN LUCAS Mike Pittore MATT POLLOCK Graham Rihn Jonathan Ruch John Stathas Mark Thompson Wade Wolowiec

Cl. Fr. Fr. Fr. So. Jr. Jr. So. So. Jr. Fr. Jr. So. Sr. Fr. Fr. Fr. So. Fr.

Ht. 6-1 6-2 6-3 6-1 6-2 6-1 6-1 6-0 6-3 6-0 6-2 5-11 6-1 6-2 6-2 6-3 6-1 5-11

Wt. 228 240 235 244 240 260 234 235 224 235 240 232 267 240 216 277 232 245

Exp. — — — — — 1L — — — — 2L — 2L — — — — —

The heart and soul of Cornell’s defense a season ago, the Big Red’s front four was as imposing as any group in the Ivy League. Not one running back gained 100 yards against the Big Red in 2004, and the squad cut opponents’ rushing yards in half from the season before to just 101 yards per game to rank seventh nationally. This season, two starters return, but both are among the very best at their positions. Senior Matt Pollock and junior Jonathan Lucas will look to continue to win the war up front with several experienced reserves taking up spots on the other side. Pollock played at an All-Ivy level in 2004, starting all 10 games. He is extremely strong and powerful with quick hands, and has become a strong pass rusher and well as a run-stuffer. Pollock was dominant at times, recording 31 tackles, making 7.5 stops for loss and registering a sack. Pollock also forced a fumble, broke up three passes and blocked a pair of kicks, including a fourth-quarter extra-point block against Princeton that helped the Big Red win 2120. Lucas developed into one of the Ivy League’s top run-stoppers from his spot on the defensive line in 2004, ranking first on the team in tackles for loss (nine) and fifth in total tackles (50). He added five pass breakups, a forced fumble and a sack. Junior Jeff Dicks is one of the leading candidates to earn a starting slot in 2005. He saw action in eight contests as a sophomore, impressing with six tackles, including one for loss, and added a pass breakup. After Dicks, none of the other candidates to start has garnered much experience, but associate defensive coordinator Pete DeStefano has plenty of talent. Junior Ryan Kiscadden and sophomores Brendan Daly, Matt Darby, Rick Greco, Spencer Hansen, Mike Pittore and Mark Thompson will be in a dogfight with freshmen Dario Arezzo, Scott Boone, Pete Burnham, Frank Kunis, Graham Rihn, Jon Ruch, John Stathas and Wade Wolowiec for playing time. DeStefano’s philosophy of rotating a large number of linemen will help Cornell quickly gain experience and keep the team fresh late in games. 2005 FOOTBALL

No. 55 50 51 45 53 58 83 43 35 42

Name Ryan Blessing Garrett Grove Doug Lempa Lucas McCarthy Evan McGuire PATRICK POTTS Kyle Reidy Ed Sabia JOEL SUSSMAN Rich Trumka

Cl. So. Fr. So. Fr. So. Sr. So. Sr. Sr. Sr.

Ht. 5-10 6-3 5-11 6-2 5-11 6-2 6-1 6-1 6-4 5-11

Wt. 203 204 199 235 217 227 213 227 234 208

Exp. — — — — — 2L — 1L 2L 2L

Aftermissingmostoflastseasonwithinjury,seniorJoelSussman’s return to linebacker will put one of the most feared hitters in the Ancient Eight back on the field for one more go-around. An NFL prospect at 6-4, 234 pounds, Sussman was having a dominant campaign at the whip position in 2004, posting 31 total tackles and blocking three field goal attempts in just four games. Sussman increased his school record total of blocked kicks to six, earning Ivy League Special Teams Player of the Week after posting 10 tackles, blocking two field goal attempts, recovering a fumble and posting a tackle for loss in the team’s opener vs. Bucknell. Sussman’s return at linebacker overshadows the emergence of fellow senior Patrick Potts. The three-year starter at linebacker has been one of the team’s most consistent players. Potts ranked fourth on the team in tackles a season ago with 55 to go along with six tackles for loss and three sacks. He was also named an ESPN The Magazine Academic All-District selection after posting a 3.45 grade point average in history. Seniors Rich Trumka and Ed Sabia also return to the team’s most experienced position. Trumka is one of the team’s most relentless special teams performers as a long snapper. He made four tackles a season ago while seeing game Rich action in all 10 contests. Sabia reTRUMKA turns to the field after missing the 2004 season with injury. He was expected to compete for a starting slot a season ago after making 25 total tackles in nine games in 2003. Rising sophomores Ryan Blessing, Doug Lempa, Evan McGuire and Kyle Reidy all showed the talent and understanding of the defense to allow them to become productive linebackers for the Big Red and will battle it out for playing time. Joining the mix will be freshmen Garrett Grove and Lucas McCarthy.

2005 OUTLOOK

AND

TEAM

Defensive Backs/Safeties No. 27 37 5 2 20 6 30 9 31 23 18 29 24 19 36 41 38 21 34

Name Tim Bax Michael Boyd Jordan Calaguire JASON CLOYD BrianFitzPatrick MATT GRANT Jeff Hahn Adam Hollier Jared Ison JarinJackson Brandon Kerns Gus Krimm Chi Chi Madu Matt Malleo Brant McKown JakeMerrill Kawika Nakoa KEVIN REX Anthony Sabo

Cl. Fr. So. Sr. Sr. Fr. Jr. Sr. Jr. So. Jr. So. Fr. So. Fr. Fr. So. So. Sr. Fr.

Ht. 6-1 5-11 5-9 5-10 5-10 5-9 5-10 5-7 6-3 5-10 5-11 6-0 6-1 5-10 5-10 6-0 5-11 6-2 5-11

Wt. 165 189 191 198 174 168 196 186 189 167 191 189 202 167 195 198 202 211 194

Exp. — — 1L 1L — 1L 2L — — — — — — — — — — 2L —

Cornell saw plenty of position movement a season ago with the move to a 4-2-5 defense that features three safeties and two cornerbacks. This season, players will be able to better know their roles, which should help the Big Red’s pass defense, which at times was suspect in 2004. Leading the charge will be senior Kevin Rex, a second-team All-Ivy pick a season ago. Rex earned his first league honor after pacing the team in tackles (86) and standing among the team leaders in tackles for loss (7.5), sacks (3.0), interceptions MattGRANT (2) and passes defended (5). He also forced a league-high four fumbles and recovered another. He did all of that despite changing positions mid-year after an injury to Sussman. Senior Jason Cloyd and junior Matt Grant will likely man the corner spots as the team’s incumbent starters. Cloyd came out of relative obscurity to become the Big Red’s top corner late in the year, starting the final six games of the season, making 38 tackles and 3.5 stops for losses. Grant

opened up nine games as a starter, making 28 tackles and intercepting a pass. The two combined for 12 pass breakups and stood second and third on the team, respectively, in special teams tackles. Senior Jeff Hahn also benefitted from a move to safety in 2004, seeing action in all 10 contests and making a career-high 15 tackles, including 12 in the final four games of the year. He will have a chance to continue in the role of big-play safety beside Rex. Several young players will also have a chance to make their marks in the defensive backfield. Senior Jordan Calaguire, juniors Adam Hollier and Jarin Jackson and sophomores Michael Boyd, Jared Ison, Brandon Kerns, Chi Chi Madu, Jake Merrill and Kawika Nakoa all return looking to break into the regular rotation. Calaguire, who lettered as a defensive back in 2003 before injuries forced him out of action a season ago, Jackson, Boyd and Madu have all seen reserve action in the past and are the favorites to step up their roles and earn a starting position this season. Also looking to make an impression in fall practice will be freshmen Tim Bax, Brian FitzPatrick, Gus Krimm, Matt Malleo and Brant McKown. Malleo is the only true corner of the bunch, but Bax, Krimm and McKown have the size, speed and athletic talent to make a mark at safety.

Special Teams No. 97 47 10 88 39

Name Michael Bolling Jay Harding Nick Maxwell A.J. WEITSMAN Peter Zell

Cl. So. So. Fr. Sr. So.

Ht. 6-2 6-1 5-10 6-2 6-2

Wt. 229 171 200 192 186

Exp. — — — 2L —

The Big Red special teams will be in a state of flux this season after losing four-year starters Mike Baumgartel (punter) and Trevor MacMeekin (place-kicker). Several players are lined up to take their shots at taking control of the position. Sophomore Michael Bolling and freshman Nick Maxwell will attempt to earn the punting spot after Baumgartel broke nearly every Cornell punting record after four years of uninterrupted service. Bolling spent his freshman season punting for the junior varsity, while Maxwell comes in as one of the most decorated punters on the West Coast. The place-kicking position is just as hard to handicap, as senior A.J. Weitsman has made three field goals and all 12 of his extra points the last two seasons. He will compete against sophomore PeterZell. Weitsman’s powerful leg will be put to use as the kickoff specialist again this season, while Romney is again expected to return punts. Hardaway and Anthony Jackson will be the primary kick returners. Trumka will again provide the long snapping duties, something he has done effectively each of the last two years.

A.J.WEITSMAN

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

JasonCLOYD

2005 OUTLOOK 2005

2005 Big Red Numerical Roster No. 1 * 2 * 3 ** 4 * 5 *

Name Romney, Brian Cloyd, Jason Johnston, Joshua Nash, Colin Calaguire, Jordan

Pos. WR DB TB WR W

Cl. Sr. Sr. Sr. So. Sr.

Ht. 5-9 5-10 6-1 5-11 5-9

Wt. 166 198 214 169 191

Hometown/School PleasantGrove,Utah/PleasantGroveHS/SnowCollege St. Louis, Mo./Cardinal Ritter College Prep Centerport, N.Y./Harborfields HS Fairport, N.Y./Fairport HS Medfield, Mass./Medfield HS

6 * 7 8 ** 9 9 ^

Grant, Matt Canty, Zac Jackson, Anthony Hollier, Adam Hyland, Steve

DB WR WR S WR

Jr. Fr. Jr. Jr. Fr.

5-9 5-8 5-8 5-7 6-2

168 164 173 186 200

Baldwinsville, N.Y./Baker HS Naperville, Ill./Naperville North HS Waterford, Mich./Brother Rice HS Detroit, Mich./Renaissance HS Islip, N.Y./Choate Rosemary Hall

10 11 12 * 13 14 ***

Maxwell, Nick Connolly, Shane Kuhn, Ryan Gallagher, Chris Hardaway, Andre

P QB QB WR TB

Fr. Fr. Sr. Jr. Sr.

5-10 6-1 6-4 5-10 6-0

200 181 237 188 220

Lacey, Wash./Timberline HS Johnson City, N.Y./Maine-Endwell HS New Fairfield, Conn./New Fairfield HS Valencia, Pa./Mars Area HS Plymouth, Mass./Milton Academy

QB QB QB DB TE

Fr. Fr. Fr. So. Fr.

6-2 6-1 6-1 5-11 6-3

204 224 188 191 215

Montgomery, Texas/Montgomery HS Rockville Centre, N.Y./South Side HS Palo Alto, Calif./Palo Alto HS Martinsburg, W.Va./Hedgesville HS North Bergen, N.J./High Tech HS

Lisowski, Todd Malleo, Matt FitzPatrick,Brian Rex, Kevin Baker,Jesse

QB DB DB W WR

So. Fr. Fr. Sr. Fr.

6-1 5-10 5-10 6-2 6-2

191 167 174 211 184

Dover, Ohio/Dover HS Manasquan, N.J./The Hun School Collegeville, Pa./Episcopal Academy Thousand Oaks, Calif./Thousand Oaks HS Platteville,Wis./PlattevilleHS

22 23 23 24 24

Hulseberg, Joshua Jackson,Jarin ^ Vredenburgh, Zach Madu, Chi Chi ^ Blackman, Horatio

WR DB WR DB WR

Fr. Jr. Fr. So. Fr.

5-8 5-10 6-2 6-1 6-1

152 167 199 202 170

Wilbraham, Mass./Minnechaug Regional HS New Orleans, La./Benjamin Franklin HS Chenango Forks, N.Y./Chenango Forks HS Fairfield,Conn./FairfieldHS Albany, N.Y./Albany HS

25 26 27 28 28

* Siwula, Luke Kilcoyne, Shane Bax, Tim Ibegbu, Chi Chi ^ Mumford, Aaron

TB TB S TB TB

So. Fr. Fr. So. Fr.

6-0 5-11 6-1 5-8 6-0

191 187 165 185 175

Cortland, N.Y./Homer HS San Diego, Calif./Torrey Pines HS Chicago, Ill./Mount Carmel HS Getzville, N.Y./Williamsville North HS Gresham, Ore./San Barlow HS

15 16 17 18 18

Lucas,Tyler Piselli,Tom Ford, Nathan Kerns, Brandon ^ Macias, William

WWW .CORNELL B IG R ED . COM

19 19 ^ 20 21 ** 21 ^

29 30 ** 31 32 * 33

Krimm, Gus Hahn,Jeff Ison,Jared Macaluso, Anthony Ostrowsky, Brian

S SS FS TB TB

Fr. Sr. So. Jr. Fr.

6-0 5-10 6-3 5-7 6-1

189 196 189 196 203

Columbus, Ohio/Upper Arlington HS Chester, N.Y./Warwick Valley HS Powell, Ohio/Olentangy HS Middletown, N.J./Middletown South HS Wyoming, Pa./Bishop Hoban HS

34 35 ** 36 37 38

Sabo, Anthony Sussman, Joel McKown, Brant Boyd, Michael Nakoa, Kawika

DB LB S FS SS

Fr. Sr. Fr. So. So.

5-11 6-4 5-10 5-11 5-11

194 234 195 189 202

Novi, Mich./Detroit Catholic Central HS Great Neck, N.Y./Great Neck North HS Tampa, Fla./Tampa Jesuit HS Pasadena, Texas/Deer Park HS Honolulu, Hawaii/Iolani School

39 40 41 42 ** 43 *

Zell,Peter Rusinkovich, Todd Merrill,Jake Trumka, Rich Sabia, Ed

PK FB SS LB/LS LB

So. Jr. So. Sr. Sr.

6-2 6-0 6-0 5-11 6-1

186 231 198 208 227

Ft. Myers, Fla./Bishop Verot HS San Clemente, Calif./San Clemente HS Kentfield, Calif./Marin Catholic HS Rockville, Md./Thomas S. Wootton HS Lafayette Hill, Pa./LaSalle College HS

45 46 47 48 49

McCarthy, Lucas Germani, Jamie Harding, Jay * Homan, Stu Wasser, Dan

LB TB PK TE FB

Fr. Fr. So. Jr. So.

6-2 5-10 6-1 6-2 5-9

235 181 171 229 222

Hood River, Ore./Hood River Valley HS Macugnie, Pa./Emmaus HS State College, Pa./State College Area HS Meridian, Idaho/Eagle HS Thousand Oaks, Calif./Viewpoint School

50 50 51 52 53

* Moody, Jon ^ Grove, Garrett Lempa, Doug * Dicks,Jeff McGuire, Evan

OL LB LB DL LB

Sr. Fr. So. Jr. So.

6-0 6-3 5-11 6-1 5-11

267 204 199 260 217

Columbus, Ohio/Northland HS Loganville, Ga./Loganville HS PointPleasantBeach,N.J./PointPleasantBeachHS Bellevue, Wash./Bellevue HS White Plains, N.Y./White Plains HS

DE LB DE DL LB

Jr. So. Fr. So. Sr.

6-2 5-10 6-2 6-1 6-2

240 203 240 234 227

Thornwood, N.Y./Westlake HS Oneida, N.Y./Oneida HS Allison Park, Pa./Pittsburgh Central Catholic HS Pottsville, Pa./Mount Carmel Area HS Kenton, Ohio/Kenton Senior HS

54 55 56 56 ^ 58 **

Darby, Matt Blessing, Ryan Rihn, Graham Greco, Rick Potts,Patrick

2005 FOOTBALL

AND

TEAM

2005 Big Red Alphabetical Roster No. N a m e ........... Pos. 87 76 91 21 63 27 60 24 82 55 97 65 77 37 95 5 7 2 11 73 93 54 52 89 20 84 17 13 46 6 56 50 30 94 14 47 9 48 22 9 28 31 8 23 3 18 26 90 29 12 67 51 19 92 15 62 32 18 24 19 75 10

Adams, Ryan ....... TE Anthes-Washburn, Ed O L Arezzo, Dario ...... DE Baker,Jesse ........ W R Barvin,Josh ........ O L Bax, Tim ........... S Bazzo, John ........ O L Blackman, Horatio .. W R Blakemore, Patrick .. W R Blessing, Ryan ...... LB Bolling, Michael ..... P Boone, Scott ....... DL Boothe, Kevin ...... O L Boyd, Michael ...... FS Burnham, Pete ..... DE Calaguire, Jordan ... W Canty, Zac ........ W R Cloyd, Jason ....... C B Connolly, Shane .... Q B Cosh, Matt ........ O L Daly, Brendan ...... DL Darby, Matt ....... DE Dicks,Jeff ......... DL Eckstein,Chris ...... TE FitzPatrick,Brian ... ATH Follmar, Troy ....... TE Ford, Nathan ...... Q B Gallagher, Chris .... W R Germani, Jamie ..... RB Grant, Matt ....... D B Greco, Rick ........ DL Grove, Garrett ..... LB Hahn,Jeff ......... SS Hansen, Spencer .... DL Hardaway, Andre ... TB Harding, Jay ....... PK Hollier, Adam ....... S Homan, Stu ....... TE Hulseberg, Joshua ... W R Hyland, Steve ...... W R Ibegbu, Chi Chi .... RB Ison,Jared ......... FS Jackson, Anthony .... W R Jackson,Jarin ....... C B Johnston, Joshua .... TB Kerns, Brandon ..... D B Kilcoyne, Shane ..... RB Kiscadden, Ryan .... DL Krimm, Gus ........ S Kuhn, Ryan ........ Q B Kunis, Frank ....... D T Lempa, Doug ...... LB Lisowski, Todd ..... Q B Lucas, Jonathan ..... DL Lucas,Tyler ........ Q B Lundy, Matt ....... O L Macaluso, Anthony .. TB Macias, William .... TE Madu, Chi Chi ..... D B Malleo, Matt ...... ATH Marchut, Kevin ..... O L Maxwell, Nick ...... P

2005 OUTLOOK

AND

TEAM

2005 Big Red Numerical Roster No. 59 60 61 62 63

Name Wu, Patrick Bazzo, John Zingale, Rob Lundy, Matt Barvin,Josh

Pos. OL OL OL OL OL

Cl. Jr. Sr. Fr. Fr. Fr.

Ht. 6-3 5-11 6-2 6-2 6-7

Wt. 300 263 246 292 257

64 65 66 67 68

Mortensen, Justin Boone, Scott Ruch, Jonathan Kunis, Frank * Sonnenberg, Ted

OL DL DT DT OL

Fr. Fr. Fr. Fr. Jr.

6-1 6-2 6-2 6-0 6-4

287 240 216 235 278

69 70 71 72 73

Pittore, Mike Thompson, Mark Miller,Eric McGuire, Brian Cosh, Matt

DL DL OL OL OL

So. So. Jr. Jr. So.

5-11 6-1 6-5 6-3 6-6

232 232 283 314 269

74 Rosenberg, Loren 75 Marchut, Kevin 76 Anthes-Washburn, Ed 77 *** Boothe, Kevin 78 Motamedi, Babak

OL OL OL OL OL

So. Jr. Jr. Sr. Fr.

6-2 6-5 6-3 6-5 6-5

256 301 291 315 327

79 80 81 82 83

Valenta, Steve Spooner, Alex Perez, Kyle Blakemore, Patrick Reidy, Kyle

OL TE FB WR LB

Fr. Fr. So. Jr. So.

6-5 6-1 5-10 6-2 6-1

297 227 240 204 213

84 ** 85 87 88 ** 89 **

Follmar, Troy Rosage,Jeff Adams, Ryan Weitsman, A.J. Eckstein,Chris

TE TE TE PK TE

Sr. So. Fr. Sr. Sr.

6-2 6-3 6-5 6-2 6-3

240 235 235 193 243

90 91 92 ** 93 94

Kiscadden, Ryan Arezzo, Dario Lucas, Jonathan Daly, Brendan Hansen, Spencer

DL DE DL DL DL

Jr. Fr. Jr. So. So.

6-3 6-1 6-2 6-1 6-0

224 228 240 244 235

95 96 97 98 ** 99

Burnham, Pete Wolowiec, Wade Bolling, Michael Pollock, Matt Stathas, John

DE DL P DL DL

Fr. Fr. So. Sr. Fr.

6-3 5-11 6-2 6-1 6-3

235 245 229 267 277

*varsitylettersearned;^duplicatenumber

Hometown/School No. N a m e ........... Pos. Dallas, Texas/Plano HS/Oregon State Alta Loma, Calif./Rancho Cucamonga HS 45 McCarthy, Lucas .... LB Hubbard, Ohio/Hubbard HS 72 McGuire, Brian ..... O L Lancaster, Pa./J.P. McCaskey HS 53 McGuire, Evan ...... LB Houston, Texas/Phillips Exeter Academy (Mass.) 36 McKown, Brant ...... S Rothschild, Wis./D.C. Everest HS 41 Merrill,Jake ....... SS Naperville, Ill./Benet Academy 71 Miller,Eric ........ O L Emmaus, Pa./Allentown Central Catholic HS 50 Moody, Jon ........ O L East Hanover, N.J./Seton Hall Prep 64 Mortensen, Justin ... O L Holgate, Ohio/Holgate School 78 Motamedi, Babak ... O L Lafayette, Calif./De La Salle HS 28 Mumford, Aaron .... RB Vineland, N.J./Vineland HS 38 Nakoa, Kawika ..... SS Marengo, Ohio/Highland HS 4 Nash, Colin ........ W R Princeton Jct., N.J./West Windsor-Plainsboro HS 33 Ostrowsky, Brian .... RB Canandaigua, N.Y./Canandaigua Academy 81 Perez, Kyle ........ FB Oak Park, Calif./Oak Park HS 16 Piselli,Tom ........ Q B Succasunna, N.J./Roxbury HS 69 Pittore, Mike ....... DL Worchester, Mass./Burncoat HS 98 Pollock, Matt ....... DL Plantation, Fla./Pine Crest School 58 Potts,Patrick ....... LB Rochester, Mich./Rochester Adams HS 83 Reidy, Kyle ........ LB Orland Park, Ill./Carl Sandburg HS 21 Rex, Kevin ......... W Rocky River, Ohio/St. Edwards HS 56 Rihn, Graham ...... DE Patterson, Calif./Modesto Central Catholic HS 1 Romney, Brian ...... W R Boulder, Colo./Fairview HS Scarsdale, N.Y./Edgemont HS 85 Rosage,Jeff ........ TE 74 Rosenberg, Loren ... O L Saratoga, Calif./Saratoga HS 66 Ruch, Jonathan ..... D T Panama, N.Y./Panama Central HS 40 Rusinkovich, Todd ... FB Roxbury, N.J./Roxbury HS Saratoga, Calif./Saratoga HS 43 Sabia, Ed ......... LB Harrisonburg, Va./Harrisonburg HS 34 Sabo, Anthony .... ATH 25 Siwula, Luke ....... TB Landisville, Pa./Hempfield HS 68 Sonnenberg, Ted ... O L North Syracuse, N.Y./Christian Brothers Academy Wheat Ridge, Colo./Arvada West HS 80 Spooner, Alex ...... TE Victor, N.Y./Victor HS 99 Stathas, John ....... D T Lakewood, Colo./Bear Creek HS 35 Sussman, Joel ...... LB 70 Thompson, Mark .... DL Danvers, Mass./St. John’s Preparatory School Wexford, Pa./North Allegheny HS 42 Trumka, Rich ..... LB/LS Ann Arbor, Mich./Ann Arbor Pioneer HS 79 Valenta, Steve ..... O L Fulton, N.Y./G. Ray Bodley HS 23 Vredenburgh, Zach .. W R Dallas, Texas/St. Mark’s HS 49 Wasser, Dan ....... FB 88 Weitsman, A.J. ..... PK 96 Wolowiec, Wade .... D T 59 Wu, Patrick ........ O L 39 Zell,Peter ......... PK 61 Zingale, Rob ....... O L

STAFF

Pronunciations Dario .......... DARR-e-o Arezzo ......... a-REEZ-o Calaguire ... cal-ah-JEER-ee DeStefano . dee-STEF-an-oh Eckstein ........ ECK-stine Germani .... gerr-MONN-e Hollier ............ OY-ay Hulseberg .. HULL-sah-berg Kavanagh ...... KAV-in-aw Kiscadden ..... kis-COD-an Knowles .......... NOLLS Leonhard ........ LEN-ard Macaluso ... mac-a-LOO-so

Macias ....... muh-SEE-us Marchut ....... mar-SHUT Babak ......... bob-BACK Motamedi . Moto-MUDD-ee Kawika ....... ka-WEEK-ah Nakoa ........ nah-KO-ah Pittore ........ pit-TOR-ee Rahne .......... RAH-knee Rosage ........ Raw-SEGE Rusinkovich .. rus-in-KO-vich Siwula ...... suh-WUH-luh Wasser .......... WAH-ser Wolowiec ... WOLL-oh-wick

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Head Coach: Jim Knowles (Cornell ‘87) Assistant Head Coach: Clayton Carlin (Juniata ‘87) - Offensive Coordinator/Wide Receivers Coach Assistant Coaches: Brad Beerwinkel (Texas ‘97) - Safeties Coach/Recruiting Coordinator Brian Coon (Albion ‘92) - Asst. Offensive Coord./Offensive Line Coach Pete DeStefano (Slippery Rock ‘78) - Assoc. Def. Coord./Def. Line Coach Roderick Plummer (Washington State ‘93) - Def. Backs Coach/Special Teams Coord. Scott Kavanagh (Wisconsin ‘01) - Quarterbacks Coach Zac Roper (Mississippi ‘01) - Tight Ends Coach Tim Simpson (Cornell ‘94) - Linebackers Coach Ricky Rahne (Cornell ‘02) - Running Backs Coach Director of Football Operations: Pete Noyes (Bridgeport ‘68) Head Strength and Conditioning Coach: Tom Howley (Tulane ‘88) Head Athletic Trainer/Physical Therapist: Bernie DePalma (Quinnipiac ‘78) Associate Head Athletic Trainer: Jim Case (Central Michigan ‘86) Head Equipment Manager: Dale Strauf (Cortland ‘79) Equipment Assistants: Doug Vorhis, Dick Randall Administrative Assistants: Karen Berkley, Becky Hollenback-Miller

2005 OUTLOOK 2005 Who Was Lost ...

Who Returns ...

Starters Lost ........... 13 Offense ................ 5 David Archer (C), Zach Beadle (LG), D.J. Busch (QB), Tim Doherty (LT), Chad Nice (WR).

Starters Returning ...... 11 Offense ................ 6 Kevin Boothe (RT), Chris Eckstein (TE), Anthony Jackson (WR), Joshua Johnston (TB), Brian Romney (WR), Ted Sonnenberg (RG).

Defense ................ 6 Dan Collins (LB), Brad Kitlowski (SS), Ryan Lempa (DE), Mike McGinty (DT), Sean Nassoiy (RCB), Nate Tarsi (FS). Specialists .............. 2 Mike Baumgartel (P), Trevor MacMeekin (PK)

Defense ................ 5 Jason Cloyd (LCB), Jonathan Lucas (DE), Matt Pollock (DT), Patrick Potts (LB), Kevin Rex (W).

Letter Winners Lost ..... 23 Offense ............... 11 Dave Archer, Zach Beadle, Marcus Blanks, D.J. Busch, Trent Carvolth, Tim Condon, Tim Doherty, Clayton Fitzsimmons, Gabe Newell, Chad Nice, Jason Stadnik. Defense ............... 10 David Blanks, Dan Collins, Brad Kitlowski, Ryan Lempa, Mike McGinty, Sean Nassoiy, Paul Pardi, Earl Richardson, Patrick Starleper, Nate Tarsi.

Defense ............... 12 Jordan Calaguire, Jason Cloyd, Jeff Dicks, Matt Grant, Jeff Hahn, Jonathan Lucas, Matt Pollock, Patrick Potts, Kevin Rex, Ed Sabia, Joel Sussman, Rich Trumka.

Specialists .............. 2 Mike Baumgartel, Trevor MacMeekin.

Specialists .............. 1 A.J. Weitsman

TEAM

Big Red By Class ... Seniors ............... 19 John Bazzo, Kevin Boothe, Jordan Calaguire, Jason Cloyd, Chris Eckstein, Troy Follmar, Jeff Hahn, Andre Hardaway, Joshua Johnston, Ryan Kuhn, Jon Moody, Matt Pollock, Patrick Potts, Kevin Rex, Brian Romney, Ed Sabia, Joel Sussman, Rich Trumka, A.J. Weitsman.

Specialists .............. 0 Letter Winners Returning 27 Offense ............... 14 Kevin Boothe, Chris Eckstein, Troy Follmar, Andre Hardaway, Stu Homan, Anthony Jackson, Joshua Johnston, Ryan Kuhn, Anthony Macaluso, Jon Moody, Colin Nash, Brian Romney, Luke Siwula, Ted Sonnenberg.

AND

Juniors ............... 19 Ed Anthes-Washburn, Patrick Blakemore, Matt Darby, Jeff Dicks, Chris Gallagher, Matt Grant, Adam Hollier, Stu Homan, Anthony Jackson, Jarin Jackson, Ryan Kiscadden, Jonathan Lucas, Anthony Macaluso, Kevin Marchut, Brian McGuire, Eric Miller, Todd Rusinkovich, Ted Sonnenberg, Patrick Wu. Sophomores ........... 27 Ryan Blessing, Michael Bolling, Michael Boyd, Matt Cosh, Brendan Daly, Rick Greco, Spencer Hansen, Jay Harding, Chi Chi Ibegbu, Jared Ison, Brandon Kerns, Doug Lempa, Todd Lisowski, Chi Chi Madu, Evan

McGuire, Jake Merrill, Kawika Nakoa, Colin Nash, Kyle Perez, Mike Pittore, Kyle Reidy, Jeff Rosage, Loren Rosenberg, Luke Siwula, Mark Thompson, Dan Wasser, Peter Zell. Juniors ............... 40 Ryan Adams, Dario Arezzo, Jesse Baker, Josh Barvin, Tim Bax, Horatio Blackman, Scott Boone, Pete Burnham, Zac Canty, Shane Connolly, Brian FitzPatrick, Nathan Ford, Jamie Germani, Garrett Grove, Joshua Hulseberg, Steve Hyland, Shane Kilcoyne, Gus Krimm, Frank Kunis, Tyler Lucas, Matt Lundy, William Macias, Matt Malleo, Nick Maxwell, Lucas McCarthy, Brant McKown, Justin Mortensen, Babak Motamedi, Aaron Mumford, Brian Ostrowsky, Tom Piselli, Graham Rihn, Jonathan Ruch, Anthony Sabo, Alex Spooner, John Stathas, Steve Valenta, Zach Vredenburgh, Wade Wolowiec, Rob Zingale.

2005 Big Red By State California (12) Bazzo (Alta Loma), Follmar (Saratoga), Ford (Palo Alto), Kilcoyne (San Diego), Merrill (Kentfield), Perez (Patterson), Pittore (Lafayette), Rex (Thousand Oaks), Rosenberg (Oak Park), Rusinkovich (San Clemente), Wasser (Thousand Oaks), Weitsman (Saratoga).

Maryland (1) Trumka (Rockville).

Colorado (3) Blakemore (Boulder), Hansen (Lakewood), Lucas (Wheat Ridge).

Michigan (5) Bolling(AnnArbor),Hollier(Detroit),A.Jackson (Waterford), Motamedi (Rochester), Sabo (Novi).

WWW .CORNELL B IG R ED . COM

Connecticut (2) Kuhn (New Fairfield), Madu (Fairfield).

Florida (3) Boothe (Plantation), McKown (Tampa), Zell (Ft.Myers). Georgia (1) Grove (Loganville). Hawaii (1) Nakoa (Honolulu). Idaho (1) Homan (Meridian). Illinois(4) Bax (Chicago), Boone (Naperville), Canty (Naperville), Valenta (Orland Park). Louisiana (1) J. Jackson (New Orleans).

2005 FOOTBALL

Massachusetts (5) Anthes-Washburn (Worchester), Burnham (Danvers), Calaguire (Medfield), Hardaway (Plymouth), Hulseberg (Wilbraham).

Missouri (1) Cloyd(St.Louis). New Jersey (9) Adams (Roxbury), Kunis (East Hanover), Lempa (Point Pleasant Beach), Macaluso (Middletown), Macias (North Bergen), Malleo (Manasquan), Marchut (Succasunna), B. McGuire (Princeton Junction), Thompson (Vineland). New York (21) Arezzo (North Syracuse), Blackman (Albany), Blessing(Oneida),Connolly(JohnsonCity),Cosh (Canandaigua), Daly (Victor), Darby (Thornwood), Grant (Baldwinsville), Hahn (Chester), Hyland (Islip), Ibegbu (Getzville), Johnston (Centerport), E. McGuire (White Plains),Nash(Fairport),Piselli(RockvilleCentre),Pollock(Fulton),Reidy(Scarsdale),Rosage (Panama), Siwula (Cortland), Sussman (Great Neck), Vredenburgh (Chenango Forks).

Ohio (9) Ison (Powell), Krimm (Columbus), Lisowski (Dover), Miller (Marengo), Moody (Columbus), Potts (Kenton), Sonnenberg (Holgate), Spooner (Rocky River), Zingale (Hubbard). Oregon (2) McCarthy (Hood River), Mumford (Greshman). Pennsylvania (12) FitzPatrick(Collegeville),Gallagher(Valencia), Germani (Emmaus), Greco (Pottsville), Harding (StateCollege),Kiscadden(Landisville), Lundy (Lancaster), Ostrowsky (Wyoming), Rihn (Allison Park), Ruch (Emmaus), Sabia (Lafayette Hill), Wolowiec (Wexford). Texas (5) Barvin (Houston), Boyd (Pasadena), T. Lucas (Montgomery), Stathas (Dallas), Wu (Dallas). Utah (1) Romney (Pleasant Grove). Virginia(1) Eckstein(Harrisonburg). Washington (2) Dicks (Bellevue), Maxwell (Lacey). West Virginia (1) Kerns (Martinsburg). Wisconsin (2) Baker(Platteville),Mortensen(Rothschild).

2005 OUTLOOK

AND

TEAM

E D ANTHES-WASHBURN

#76

Junior Offensive Line • 6-3 • 291 Worcester, Mass. Burncoat HS Urban and Regional Studies

At Cornell: Anthes-Washburn brings great sizeandstrengthtotheoffensivelineandwill compete for a spot in the rotation in the fall. He is enrolled in the College of Architecture, Art, and Planning. At Burncoat: A threeyear letter winner in football, Anthes-Washburn was an all-city selectionasbothajuniorandsenior.Histeamwent17-5inhisfinal two seasons, including a league title as a junior. Anthes-Washburn was named his team’s top offensive lineman as a senior and was a DivisionIIall-star.Healsocompetedintrackandfield,earninga combined seven letters in the shot put indoors and outdoors. Personal: Edward Charles Anthes-Washburn is the son of Frances Anthes and Charles Washburn and has an older brother and sister, both of whom are Cornell graduates.

J O H N BAZZO

#60

Senior Offensive Line • 5-11 • 263 Alta Loma, Calif. Rancho Cucamonga HS Applied Economics and Management

At Cornell: Bazzo is a utility player on the offensiveline,possessingtheabilitytobe effective at any position on the line. He served as the backup at center on the two-deep a season ago, but his versatilty allows him to play wherever the coaching staff needs him. He is enrolled in the College of Agriculture and Life Sciences. At Rancho Cucamonga: Bazzo played football for four years at Rancho Cucamonga HS, earningthreevarsityletters.Asasenior,hewasthestartingright tackle,andhadexperienceatcenterandastheteam’slongsnapper. As a senior, he captained the team to the league title. A National Football Foundation and College Hall of Fame Scholar-Athlete, he was selected to play in the Australia Down Under Bowl following his senior season. Bazzo was the president of his senior class and also competed for the wrestling, track and field and baseball teams during his high school career. Personal: John Anthony Bazzo is the son of James and Jane Bazzo and has an older sister who attended IthacaCollege.

P ATRICK BLAKEMORE

#82

Year 2004 Totals

GP 9 9

Rec 1 1

Yds 1 1

Avg 1.0 1.0

TD 0 0

RYANBLESSING

LP 1 1

#55

Sophomore Linebacker • 5-10 • 203 Oneida, N.Y. Oneida HS Applied Economics and Management

At Cornell: A talented performer with a high motor,Blessingwillattempttobreakintothe linebacking corps. Blessing saw action in each of the team’s final five games, all on special teams. He finished the season with three tackles,includingsolostopsagainstPrincetonandPenn.Blessing is enrolled in the College of Agriculture and Life Sciences. At Oneida: Blessing was a three-time letter winner who excelled at both running back and linebacker. A three-year starter, he was named a first-team all-league linebacker and a third team AllCentralNewYorklinebackerasasenior.Hisjuniorseason,Blessing was named a first-team all-league running back and linebacker, as well as a second-team all-state linebacker. Personal: Ryan James Blessing is the son of Jeff and Laura Blessing and has two younger brothers.

MICHAELBOLLING

#97

Sophomore Punter • 6-2 • 229 Ann Arbor, Mich. Ann Arbor Pioneer HS Undecided

AtCornell:Bollingwillcompetefortheopen punting job when camp opens in the fall. He spentthe2004seasononthejuniorvarsityteam.Bollingisenrolled in the College of Arts and Sciences. At Ann Arbor Pioneer: Bolling was an honorable mention all-state selection in football at Ann ArborPioneerHS,letteringtwicewhilepunting,kickingandplaying bothoffensiveanddefensiveline.Teamcaptainasasenior,Bolling was a scholastic All-American as a senior. He was also a four-year letter winner in swimming while competing in the backstroke. Personal: Michael Huey Bolling is the son of Steven and Cheryl Bolling and has a younger sister.

At Cornell: Blakemore will challenge for time at wideout after playing in nine contests in 2004. Possessing good size (6-2) and soft hands, Blakemore has quickly improved in the Big Red’s new offensive schemes and has the ability to become a big-play receiver. He made his first career catch in the win over Princeton. Blakemore is enrolled in the College of Arts and Sciences. At Fairview: Blakemore was a four-year letter winner as a wide receiver for the Fairview HS football team. He was twice named all-league and finished his career with all-region, all-state and All-Colorado honors. As the team’s captain his senior year, he was a National Football Foundation 2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Junior Wide Receiver • 6-2 • 204 Boulder, Colo. Fairview HS English

College Hall of Fame Scholar-Athlete. Blakemore was also the team captain for the basketball team, where he was a two-time allleague and all-region selection. Personal: Patrick Wyatt Blakemore is the son of Kit and Wendy Blakemore and has an older sister, Katy, who was a member of the swimming and diving team at Stanford.

2005 OUTLOOK 2005 KEVINBOOTHE***

#77

Senior Offensive Line • 6-5 • 315 Plantation, Fla. Pine Crest School Hotel Administration

AtCornell:Theanchoroftheoffensiveline, Bootheisatwo-timefirst-teamAll-IvyLeague selection and is widely considered the top lineman in the league. A true All-America candidate, Boothe’s tremendous size and quickness along with a great understanding of the game has put him on the NFL radar screen entering his final season. Boothe, who was grantedafifth-yearofeligibilitythispastspring,madethetransition from right guard to right tackle with ease last season and was the only unanimous first-team selection on the line in 2004. He will once again be a tremendous presence and leader on a young line for the Big Red this season. As a sophomore, he was named to the All-Ivy second team, becoming one of just three Ivy second-year players on offense to be named to the squad. Boothe is a student intheSchoolofHotelAdministration. AtPineCrest: Bootheplayed on both the offensive and defensive lines at the Pine Crest School. A team co-captain as a senior, he was a first-team all-county selectionaswellasasecond-teamall-statepick. Hehad40tackles and caused two fumbles in 2000. Personal: Kevin Mark Boothe is the son of Charles and Pat Boothe and has an older brother, Charles, whoplayedfootballatEastCarolinaUniversity.

M ICHAEL BOYD

#37

WWW .CORNELL B IG R ED . COM

Sophomore Free Safety • 5-11 • 189 Pasadena, Texas Deer Park HS Civil Engineering

At Cornell: A hard-hitting safety with good speed and football sense, Boyd has a chance toearnplayingtimeinthedefensivebackfieldandonspecialteams in 2005. He saw action in three games as a freshman, making one special teams tackle. He was the recipient of the team’s Daniel N. Bondareff Freshman Scholar-Athlete Award. Boyd is enrolled in the College of Engineering. At Deer Park: Boyd was a three-sport athlete and football letter winner at Deer Park HS. He played both quarterback and safety as a senior, earning a 235A honorable mention while serving as the team’s captain. A member of the Touchdown Club, Boyd was named the Houston Scholar Athlete of the Year for the 2003 season. He also played baseball and track. Personal: Michael George Boyd is the son of Mike and Joyce Boyd and has a younger brother.

JORDANCALAGUIRE*

Senior Safety • 5-9 • 191 Medfield, Mass. Medfield HS Hotel Administration

At Cornell: Calaguire rejoins the Big Red squad after missing last season with an injury. He had moved from cornerback to safety last spring and will seetimeatthewhipposition. Calaguireisaphysicalandaggressive player who runs well and will be the fourth safety in the team’s nickle-D package. He’ll provide solid backup for Joel Sussman and 2005 FOOTBALL

AND

TEAM

will also see plenty of action on special teams. As a cornerback in 2003, he saw actoin in five games and made five tackles. Jordan is a student in the School of Hotel Administration. At Medfield: Calaguire played football and baseball and was also a member of thetrackteamatMedfieldHS.Athree-yearstarterandletterwinner forthefootballteam,hewasathree-timeTri-ValleyLeagueall-star and a two-time MetroWest all-star. The team’s captain as a senior, he was the MetroWest MVP in 2000 and 2001. Calaguire was also selected to captain the baseball and track teams and was a league all-star on the diamond. He was a National Football Foundation scholar-athlete. Personal: Jordan Michael Calaguire is the son of Frank and Judith Calaguire and has a younger sister. His father graduated from Cornell in 1973 and was a member of the baseball team. Year 2003 2004 Totals

GP 5 Injured 5

Tackles 3

Assists 2

Int 0-0

Passes Def 0-0

0-0

JASONCLOYD*

Senior Cornerback • 5-10 • 198 St. Louis, Mo. Cardinal Ritter Prep Sociology

At Cornell: Cloyd was one of the team’s most improved players a season ago, moving from special teams player to starting the final six games at cornerback. With good speed and reaction time, Cloyd became one of the Big Red’s better cover corners, ranking seventh on the team with 38 tackles and second on the squad with seven pass breakups. He added 3.5 tackles for loss on the season. Cloyd had 25 tackles intheteam’slastfourgames,includingacareer-bestseventackles and two pass breakups in the dramatic comeback victory at Columbia. He also had his first career interception in the win over Princeton. His play on special teams (eight tackles) earned him a spotontheteam’sElite11specialteamsplayeraward.Cloydplayed in three games on special teams as a sophomore. Cloyd is enrolled in the College of Arts and Sciences. At Cardinal Ritter: Cloyd was afour-yearstarterforthefootballteamatCardinalRitterCollege Prep and was the squad’s captain as a junior and senior. He saw action as a quarterback and defensive back during his career. As a QB, he smashed several school records as a senior, including passing yards with 2,641 (old record 1,615) and touchdown passes with 26. A first-team all-conference pick in 2001, he was selected as the conference offensive player of the year and the North Area player of the year, while also earning second-team All-Metro and all-statehonors.Histeamwonthedistricttitlein2001.Cloydwas also a member of the track team and ran a leg on the state championship 4x400 relay. Personal:Jason Carroll Cloyd is the son of Harvey and Selena Cloyd and has four older brothers and an older sister.Hisbrother,Cori,isaseniorontheJacksonStatetrackandfield team. Year 2003 2004 Totals

GP 3 10 13

Tackles 0 24 24

Assists 0 14 14

Int 0-0 1-0 1-0

Passes Def For Loss 0 0-0 7 3.5-7 7 3.5-7

2005 OUTLOOK

AND

TEAM

M A T T COSH

#73

CHRISECKSTEIN**

Sophomore Offensive Line • 6-6 • 269 Canandaigua, N.Y. Canandaigua Academy Applied Economics and Management

At Cornell: Cosh had a productive freshman season,gainingweight(13pounds)andstrength whileadjustingtothespeedoftheDivisionIgame. Coshwillhavea chancetoearnsomeplayingtimewithagoodfallcamp.Heisenrolled intheCollegeofAgricultureandLifeSciences.AtCanandaigua:Cosh played football for four years at Canandaigua Academy and won two varsityletters.Asasenior,hewastheteam’scaptainandwasafirst-team FingerLakesAll-StarandplayedintheEddieMeathExceptionalSenior game.Coshalsoletteredinbasketballandtrackandfield.Personal: Matthew Thomas Cosh is the son of Andrew and Margaret Cosh, and hehasayoungerbrotherandayoungersister.

MATTDARBY

#54

Junior Defensive End • 6-2 • 240 Thornwood, N.Y. Westlake HS Industrial and Labor Relations

At Cornell: Darby will look to break into the lineup at defensive end as a junior after showing continued improvement a season ago as a linebacker. Darby saw his first varsity action last season at Harvard, making a tackle. He is a student in the School of Industrial and Labor Relations. At Westlake: Darby was a three-year letter winner and starter for the football and basketball teams at Westlake HS. As a linebacker on the football squad, he was a two-time all-section pick and was twice named all-state. The team’s captain his final year, he was named the league’s best defensive player as a junior and senior. He was also a two-year all-league pick in basketball. Personal: Matthew W. Darby is the son of Thomas and Donna Darby and has a brother and two sisters.

JEFFDICKS*

GP 8 8

Tackles 3 3

Assists 3 3

Year 2003 2004 Totals

GP 10 10 20

Rec 5 11 16

For Loss 1-1 1-1

Sacks 0-0 0-0

Yds 51 122 173

Avg 10.2 11.1 10.8

TD 0 0 0

TROY FOLLMAR**

LP 27 22 27

#84

Senior Tight End • 6-2 • 240 Saratoga, Calif. Saratoga HS Economics

At Cornell: Follmar developed intoatremendouscomplementtoChrisEcksteinattightend, seeingactioninninegames,withhisfirstcareerstartagainstTowson. He ended the 2004 season with five catches for 62 yards and a touchdown,includingacareer-bestthreereceptionsinthewinoverYale. Hehauledina23-yardtouchdown,hisfirstcareerscore,atTowsona weeklater.Follmarhasgoodsizeandsofthandstogoalongwithhis typicaltightendbuild.Hisstrengthandblockingabilitywillallowhim tochallengeforthestartingspot.HeisenrolledintheCollegeofArtsand Sciences. At Saratoga: Follmar was a member of the football and wrestlingteamsatSaratogaHS.Atwo-yearstarterandletterwinneron thegridiron,heearnedfirst-teamall-leaguehonorsasatightendin2000 and2001.HewasselectedtoplayintheSiliconValleyYouthClassicAllStar game. As a wrestler, he was a two-time league champion at 215 pounds and finished fifth at the sectional championships. Follmar captainedbothteamsasasenior. Personal:TroyScottFollmaristheson of Ken and Debbie Follmar and has two older brothers and a younger sister.Hisbrother,Keith,isa2003Cornellgraduate. Year 2003 2004 Totals

GP 10 9 19

Rec 0 5 5

Yds 0 62 62

Avg 0.0 12.4 12.4

TD 0 1 1

LP 0 23 23

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

At Cornell: Dicks saw action in eight contests as a sophomore, impressing with six tackles, including one for loss, and a pass breakup. An integral part of the squad’s defensive line rotation, Dicks will be looking to earn a starting position in 2005. He is enrolled in the College of Agriculture and Life Sciences. At Bellevue: Dicks helped lead his Bellevue HS football team to the state title in 2001 and 2002. As the team’s captain his senior year, he was named the conference’s lineman of the year en route to earning all-state honors. He was a two-time all-league and all-area pick and also earned all-state honors as a junior, when he was also named co-MVP of the state title game. Dicks was also captain of the basketball team. Personal: Jeffrey Bingham Dicks is the son of Les and Mary Dicks and has an older brother, Daniel, who was the starting center for the University of Washington football team. Year 2004 Totals

AtCornell:Ecksteinwillopenhisseniorseason asathree-yearstarterattightendandoneof the team’s most integral special teams players. A developing pass catcher, Eckstein had 16 career receptions for 173 yards and has averagednearly11yardspercatch.Hescoredhisfirstcareerpointswith atwo-pointconversionatTowsonandhadacareer-highthreecatches againstPrinceton,includingakeyfirstdowngrablateinthecontest to help Cornell run out the clock. He has good hands and runs good routes,so lookforhimtotakemorepassesoutofthebackfieldin2005. Hebringssizetothepositionanddoesagoodjobgettingofftheline. Lookforhimresumehisstartingjobagainthisfall.Heisenrolledinthe SchoolofHotelAdministration. AtHarrisonburg: Ecksteinwasatwotimeall-districtselectionatboththetightendanddefensiveend positionswhileplayingfootballforHarrisonburgHS. Athree-year starterforthesquad,hecaptainedtheteamtothestatetitleasasenior. HewasalsoselectedtoplayintheVirginiastateall-stargameandwas a National Football Foundation and College Hall of Fame ScholarAthlete. Eckstein was also a member of the basketball and soccer teams. The goalkeeper for the soccer team, he was a two-time alldistrictandall-regionpick. Personal: ChristopherMichaelEckstein isthesonofBryanandTheresaEcksteinandhasthreebrothersanda sister.

#52

Junior Defensive Line • 6-1 • 260 Bellevue, Wash. Bellevue HS Applied Economics and Management

#89

Senior Tight End • 6-3 • 243 Harrisonburg, Va. Harrisonburg HS Hotel Administration

2005 OUTLOOK 2005 C HRIS GALLAGHER

#13

R ICK GRECO

Junior Wide Receiver • 5-10 • 188 Valencia, Pa. Mars Area HS General Studies

WWW .CORNELL B IG R ED . COM

Junior Cornerback • 5-9 • 168 Baldwinsville, N.Y. C.W. Baker HS Economics

At Cornell: After being converted from running back to wide receiver to cornerback to take advantage of his athleticism, Grant has found a permanent spot in the defensive backfield. Grant saw action in all 10 games, with eight starts at cornerback. While learning on the job, Grant still found a way to impress with his raw ability, making 28 tackles with five pass breakups. He had an electric 50-yard interception return at Brown and broke up two passes in wins over Yale and Princeton. He is enrolled in the College of Arts and Sciences. At C.W. Baker: A football letter winner for three seasons at C.W. Baker HS, Grant was also a member of the track and field team for three years. On the gridiron, he was a three-time letter winner, earning all-league, All-CNY and all-state honors as a running back his junior and senior years. He was also recognized as an all-league defensive back in 2000. His team won the league title for three straight years. As a member of the track team, he was a first-team allleague high jumper and was a member of the section championship 4x100 relay. Personal: Matthew A. Grant is the son of Stanley Grant and Carol Grant and has two brothers and a sister. His brother, Andrew, played football at Mercyhurst College. Year 2004 Totals

GP 10 10

2005 FOOTBALL

Tackles 16 16

Assists 12 12

Int 1-50 1-50

TEAM #56

Sophomore Defensive Line • 6-1 • 234 Pottsville, Pa. Mount Carmel Area HS Biological Sciences

At Cornell: A tremendously athletic wide receiver, Gallagher will attempt to break into the lineup as a junior after moving from defensive back this past spring. He gained valuable experience in his final three games as a freshman and will also challenge for playing time on special teams to go along with his responsibilties in the passing game. With a year in the program’s new schemes, Gallagher’s speed and strength will help him battle for a position as a deep threat in the Big Red’s receiving corps. He is enrolled in the College of Agriculture and Life Sciences. At Mars: Gallagher was a three-year starter and letter winner for the Mars Area HS football team. His team won the conference title in 2001 and went on to the WPIAL championship game in 2002. A first-team all-conference defensive back and second-team running back as a senior, he was also a county allstar. As a senior, he was a team captain and finished the year as the MVP. Gallagher was also a top track and field athlete, competing at the state meet three times. In 2002, he was a medalist at the state championships as a member of the 4x800 relay. During his career, he was on three WPIAL championship relays and medaled in two individual events. Personal: Chris Brian Gallagher is the son of Dr. Larry Cimperman and Dr. Agnes Gallagher and has two brothers. His older brother, Sean, was a track and field athlete at Westminster College.

M A T T GRANT*

AND

Passes Def For Loss 5 0-0 5 0-0

AtCornell:Grecoshowedpromiseasarookie, earningpraiseforhisabilitytoquicklylearn the defensive schemes. He will see time on the defensive line as he continuestoaddstrength.HeisenrolledintheCollegeofAgricultureandLifeSciences. AtMountCarmel:Afour-timeletterwinner, Greco started on the football team for three years at Mount Carmel Area HS. As a senior, he was selected to the Pennsylvania Football News’ second-team all-state squad as a linebacker after making the second-team as a defensive tackle the year before. He also started for the 2002 Class AA state championship team that went 15-0. Greco was selected to play in the Pennsylvania Scholastic Football CoachesAssociationEast/WestAll-Stargameasasenior.Personal: Richard Alan Greco is the son of Dr. Richard and Janet Greco and has a younger brother.

JEFFHAHN**

#30

Senior Safety • 5-10 • 196 Chester, N.Y. Warwick Valley HS Industrial and Labor Relations

At Cornell: Hahn’s move to safety paid big dividends in 2004, becoming a big-play defender in Cornell’s new defensive schemes. This season he will have an opportunity to earn a starting position. Hahn saw action in all 10 games as a junior, making 15 tackles, including 3.5 for loss and 1.5 sacks. He played his best football over the final four games of the campaign, making 12 tackles. Hahn played the best game ofhiscareerinthewinoverPrinceton,makingthreetackles,forcing a fumble and breaking up two passes. He answered that with both ofhissacksandallofhistacklesforlossesinthefollowingtwoweeks against Dartmouth and Columbia, both victories. Hahn saw action in all 10 games in 2003 and had 15 total tackles, including 10 solo efforts.HeisenrolledintheSchoolofIndustrialandLaborRelations. At Warwick Valley: Hahn was a two-time all-state linebacker at Warwick Valley HS, earning second-team honors in 2000 and firstteam honors as a senior. Along with the state honors, he was also an all-tri-county first-team pick as a linebacker and running back and earned all-section honors for his performance on offense. The team’s captain in 2001, he completed his career ranked second on the school’s all-time rushing list and has two of the school’s top seasonperformancesfortotaltackles.Hewasselectedtoplayinthe annual Governor’s Bowl, which features the top players from New York vs. New Jersey. Hahn was also a four-year letter winner as a catcher for the baseball team and competed for the track squad. Personal:JeffPhillipHahnisthesonofMarkandChristineHahnand hasanoldersister. Year 2003 2004 Totals

GP 10 10 20

Tackles 10 9 19

Assists 5 6 11

For Loss 1-2 3.5-14 4.5-16

Sacks 0-0 1.5-8 1.5-8

2005 OUTLOOK

AND

TEAM

S PENCER HANSEN

#94

Sophomore Defensive Line • 6-0 • 235 Lakewood, Colo. Bear Creek HS Biological Sciences

GP 9 9 6 24

KickRet. 5 29 9 43

KOR Yds 79 588 204 871

Avg 15.8 20.3 22.7 20.3

TD 0 0 0 0

JAYHARDING

At Cornell: Hansen brings a tremendous amount of energy to the defensive line position. A strong pass rusher, Hansen possesses the technique and speedtomakeplaysalloverthefield. HeisenrolledintheCollege of Arts and Sciences. At Bear Creek: Hansen was a four-year letter winner at Bear Creek HS. A three-year starter on the football team, he totaled 153 tackles and 17 sacks in his career. Hansen set career highs with 60 tackles (57 solo) and nine sacks as a senior. He also lettered in track and wrestling. Personal: Spencer Kontny Hansen is the son of Lee and Debra Hansen and has two brothers.

A NDRE HARDAWAY***

Year 2002 2003 2004 Totals

#14

Senior Tailback • 6-0 • 220 Plymouth, Mass. Milton Academy Communication

LP 25 37 38 38

#47

Sophomore Place-kicker • 6-1 • 171 State College, Pa. State College Area HS Animal Sciences

AtCornell:Hardingwilllendhisstronglegto the kicking game and will compete for the starting job as a sophomore. He is enrolled in the College of Agriculture and Life Sciences. At State College Area: Harding was athree-yearletterwinnerasaplace-kickeratStateCollegeAreaHS, helpinghissquadwinapairofdistrictchampionships.Healsoearned atotalofeightletterswhilecompetinginsoccer,wrestlingandtrack andfield. Personal:JeffreyCharlesHardingisthesonofJeffandCindy Harding and has three younger brothers and a younger sister.

A DAM HOLLIER

Year 2002 2003 2004 Totals

GP 9 9 6 24

Rushes 4 41 88 133

Yds 10 136 348 494

Avg 2.5 3.3 4.0 3.1

TD 0 1 5 6

LP 4 11 31 31

Year 2002 2003 2004 Totals

GP 9 9 6 24

Rec 0 18 14 32

Yds 0 134 113 247

Avg 0.0 7.4 8.1 7.7

TD 0 0 0 0

LP 0 37 28 37

At Cornell: Hollier brings good athleticism and an infectious spirit to the field and will compete for time on special teams and in the defensive backfield. He is enrolled in the School of Industrial and Labor Relations. At Renaissance: Hollier was an All-Detroit selection in leading his team to a divisional and regional title. He served as team captain as a senior. Hollier also competed in multiple events in track and field, earning all-state honors. In the classroom, he served as the school’s student council president and was the city-wide council president. Personal: Adam Jacques Hollier is the son of Carl and Jacqui Hollier and has an older brother and and older and younger sister. Adam’s cousin is 2003 NFL co-MVP Steve McNair, the quarterback of the Tennessee Titans.

S T U HOMAN*

#48

Junior Tight End • 6-2 • 229 Meridian, Idaho Eagle HS Policy Analysis and Management

At Cornell: Homan set himself apart as one of the team’s top special teams players in 2004 and will attempt to earn a larger spot in the team’s tight end corps as a junior. He was selected to the team’s Elite 11 Special Teams Player award after seeing substantial time on each squad. He has good size, strength and explosiveness, which he’ll continue work to develop. Homan is enrolled in the College of Human Ecology. At Eagle: Homan helped lead his Eagle HS football team to the 2002 5-A Idaho state championship title with a perfect 12-0 record. One of the team’s captains, he was a first-team all-conference linebacker and was named to the East-West Shrine All-Star team. A two-year letter winner and the team’s leading tackler as a senior, he was also named to the conference’s all-academic team in 2001 and 2002. Homan also turned in standout performances for the baseball team, helping the squad 2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

AtCornell: HardawayjoinsclassmateJoshua Johnston to form one of the top 1-2 running back combos in the Ivy League. Despite missing the final four games due to a shoulder injury, Hardaway rushed for 348 yards and a team-leading five touchdowns and gained 665 all-purpose yards. Hardaway racked up a career-high 130 rushing yards and two touchdowns while totaling 255 all-purpose yards as Cornell gave undefeated Harvard all it could handle in Cambridge, then posted 84 yards and a touchdown in a near defeat of Colgate. Hardaway ranked fourth on the team with 14 catches for 113 yards and was second in kick return yardage with nine returns for 204 yards. As a sophomore, Hardaway saw action in nine games and picked up 858 all-purposeyardsdespitebattlingvariousinjuries.Hehad136yards on41carriesin2003andhadamajorityofthekickoffreturnduties, where he picked up an additional 588 yards. His top running game came against Georgetown, where he had 56 yards and a touchdown. He has continued to work on his game and will battle it out for the top spot. He rushed just four times for 10 yards as a rookie, but also played a key role on special teams with four tackles. He could still return kickoffs this season to get his game-breaking abilityonthefieldmore.HeisenrolledintheCollegeofAgriculture and Life Sciences. At Milton: Hardaway played football and basketball at Milton Academy. A two-year starter and letter winner on the gridiron,hewastheteam’scaptainasajuniorandsenior.Hardaway earned all-league honors in 2001 and 2002. He was also a member ofthebasketballteam,earningfourvarsityletters.Personal:Andre Devon Hardaway is the son of Tiffany Cesero and has two brothers andthreesisters.

Junior Safety • 5-7 • 186 Detroit, Mich. Renaissance HS Industrial and Labor Relations

2005 OUTLOOK 2005 to the 5-A state title and a No. 26 national ranking. A first-team allconference selection, he posted a school-record .515 batting average as a designated hitter. Personal: Stuart D. Homan is the son of John and Candy Homan and has a younger brother.

CHICHIIBEGBU

AtCornell:Anaturallygiftedrunner,Ibegbu has the rare combination of both speed and strength. A shifty back who can run outside or between the tackles, Ibegbu will challenge for time as a sophomore. He also has good hands and will have a chance to be a part of the team’s third-down packages as a receiver out of the back. Ibegbu played in six games as a freshman, seeing time at running back and on special teams. Ibegbu rushed five times for 3 yards and made a special teams tackle. HeisenrolledintheCollegeofAgricultureandLifeSciences. AtWilliamsvilleNorth:Athree-sportathleteatWilliamsvilleNorth HS,Ibegbuwasafour-yearstarterandletterwinneronthefootball team. As his team’s captain in 2003, he earned All-WNY honorable mention honors as a running back and was an all-star strong safety. He was also an All-WNY scholar-athlete in 2003 and 2004. Personal: Chinazom Uchenna Ibegbu is the son of Callistus and Mary Ibegbu and has two younger brothers. Year 2004 Totals

GP 6 6

Rushes 5 5

Yds 3 3

JAREDISON

Avg 0.6 0.6

TD 0 0

LP 3 3

#31

WWW .CORNELL B IG R ED . COM

Sophomore Safety • 6-3 • 189 Powell, Ohio Olentangy HS Industrial and Labor Relations

At Cornell: Ison possesses everything you lookforinasafety—size,speedandstrength. Ahardhitter,Isoncanalsocoverquickreceivers.Hehasanosefor theballandwillbeanintegralpartoftheteam’sdefensiveschemes. HeisenrolledinCornell’sSchoolofIndustrialandLaborRelations. At Olentangy: Ison was a three-time letter winner on the Olentangy HSfootballteam.Whileservingasseniorcaptain,Isonearnedfirst team All-OCC honors and was second-team all-district. The previous year, he was named to the All-OCC second-team and was an honorablementionselectionfortheall-districtsquad.Hewasalso a member of the school’s basketball and track teams. Personal: Jared Michael Ison is the son of David and Julie Ison and has a younger sister and two younger brothers.

2005 FOOTBALL

TEAM

A NTHONY JACKSON**

Junior Wide Receiver • 5-8 • 173 Waterford, Mich. Brother RIce HS Communication

#28

Sophomore Running Back • 5-8 • 185 Getzville, N.Y. Williamsville North HS Biological Sciences

AND

At Cornell: Jackson had a breakout season as a sophomore and will again be looked at as one of the top deep threats on the Big Red. Jackson caught 23 passes for 314 yards a season ago, averaging nearly 14 yards per catch. He also served as the team’s primary kickoff returner after Andre Hardaway went down with an injury and averaged 21.9 yards per return. He had at least three catches in each of the team’s last five games, with long catches of 41 yards at Columbia and 50 yards against Penn. Jackson played in seven games as a rookie in 2003 and made 14 catches for 116 yards. He scored a touchdown vs. Colgate and had a game-high 82 all-purpose yards vs. Georgetown, with four receptions, a carry and a return. He is enrolled in the College of Agriculture and Life Sciences. At Brother Rice: A three-sport athlete at Brother Rice HS, Jackson earned three letters each in football, basketball and track. His football team won the state title in 2000 and was runner-up in 2002. Jackson was captain of the team as a senior and was selected to play in the Michigan all-star game. He was also picked to play in the state basketball all-star game. Personal: Anthony Carnell Jackson II is the son of Anthony and Kimberly Jackson and has an older sister and two younger brothers. Year 2003 2004 Totals

GP 7 10 17

Rec 14 23 37

Yds 116 314 430

Avg 8.3 13.7 11.6

TD 1 0 1

LP 34 50 50

Year 2003 2004 Totals

GP 7 10 17

KickRet. 1 16 17

KOR Yds 15 351 366

Avg 15.0 21.9 21.5

TD 0 0 0

LP 15 46 46

JARINJACKSON

#23

Junior Cornerback • 5-10 • 167 New Orleans, La. Benjamin Franklin HS Industrial and Labor Relations

At Cornell: Jackson saw action in four contests in 2004, making two special teams tackles, but will look to break into the defensive backfield as a junior. Jackson saw some action in two games at the end of the 2003 season and showed great potential. He is a student in the School of Industrial and Labor Relations. At Benjamin Franklin: Jackson was a four-year starter and letter winner for the football team at Benjamin Franklin HS and was also a starter for the basketball and baseball teams. He was the football team’s captain and MVP as a senior. He also earned top rookie honors as a freshman. Jackson earned three letters each in basketball and baseball, and he served as team captain for both squads. He was named the school’s athlete of the year by The Times Picayune as a senior. Personal: Jarin Rolan Jackson is the son of Ralph and Nicola Jackson and has a brother and a sister.

2005 OUTLOOK

AND

TEAM

JOSHUAJOHNSTON**

Senior Tailback • 6-1 • 214 Centerport, N.Y. Harborfields HS Applied Economics and Management

AtCornell:Johnstonbringssize,strengthand speedtothetailbackpositionandwillcompete withclassmateAndreHardawayastheteam’sstarterinthebackfield.He emergedasastarterthelasttwoseasonsandentershisseniorseason 79 yards away from becoming the school’s 25th 1,000-yard rusher. Despitemissingtwogamesduetoinjuryin2004,Johnstongrindedout 475 yards and scored three touchdowns. He rushed for 142 yards and allthreeofhisscoresintheteam’sfinaltwogamesandhadaseasonhigh 142 all-purpose yards and 93 yards on the ground in the Ivy win overYale.Healsoemergedasathreattocatchtheballoutofthebackfield, haulingin14passesfor86yards.Johnstonpickedupfourtouchdowns, including two against Columbia in 2003 en route to 446 yards on the ground. His best game was a 109-yard performance with a TD against Colgate. JohnstonisenrolledintheCollegeofAgricultureandLife Sciences.AtHarborfields:Johnstonplayedbothfootballandbasketball atHarborfieldsHS,earningatotalofsevenvarsityletters.Onthegridiron, hewasnamedtotheall-leagueandall-countyteams.Asasenior,hewas theteam’scaptainandaddedAll-LongIslandandfirst-teamall-state honors to his resume. As a member of the basketball team, he was an all-leagueandall-conferencepick.Hewastheteam’scaptainasajunior andsenior.Personal:JoshuaMichaelJohnstonisthesonofMichaeland PattiJohnstonandhasanolderbrotherandayoungersister. Year 2003 2004 Totals

GP 8 8 16

Rushes 103 156 259

Yds 446 475 921

Avg 4.3 3.0 3.6

TD 4 3 7

LP 59 27 59

Year 2003 2004 Totals

GP 8 8 16

Rec 8 14 22

Yds 76 86 162

Avg 9.5 6.1 7.4

TD 0 0 0

LP 23 18 23

Year 2003 2004 Totals

GP 8 8 16

KickRet. 2 9 11

KOR Yds 49 165 214

Avg 24.5 18.3 19.5

TD 0 0 0

LP 28 32 32

B RANDON KERNS

#18

Sophomore Defensive Back • 5-11 • 191 Martinsburg, W.Va. Hedgesville HS Undecided

AtCornell:Afterayearintheprogram,Kerns willhaveachancetoearnplayingtimeinthe defensive backfield after moving from wide receiver. He played in fivegamesasarookieonspecialteams,assistingonatackle.Heis enrolled in the College of Arts and Sciences. At Hedgesville: A second-teamall-tristateselection,Kernswasnamedfirst-teamallleagueandall-areaasasenioratHedgesvilleHS.Atwo-yearletter winner in football, Kerns served as team captain as a senior and was invited to play in the North-South all-star game. An all-state selectionintrackandfieldandastatefinalistinbasketball,Kerns earned a combined seven varsity letters in his three sports. Personal: Brandon Lawrence Kerns is the son of Fred Kerns and Linda Norris and has a younger sister.

R YAN KISCADDEN

#90

Junior Defensive Line • 6-3 • 224 Landisville, Pa. Hempfield HS Developmental Sociology

At Cornell: Kiscadden has shown significant progress over the past year and will look to compete for a spot in the defensive line rotation. He possesses good strength and speed, enabling him to become an effective pass rusher. Kiscadden is enrolled in the College of Agriculture and Life Sciences. At Hempfield: Kiscadden was a member of the football, basketball and track teams at Hempfield HS. A threeyear letter-winner as a lineman on the football team, he was an allleague and all-section pick and was also a county all-star. His basketball team competed at the district level, and he was a threetime district qualifier on the track. Personal: Ryan Michael Kiscadden is the son of Richard and Debra Kiscadden and has an older brother, Justin, who was a member of the Penn State football and track and field teams.

WWW .CORNELL B IG R ED . COM 2005 FOOTBALL

2005 OUTLOOK 2005 R YAN KUHN*

#12

Senior Quarterback • 6-4 • 237 New Fairfield, Conn. New Fairfield HS Applied Economics and Management

At Cornell: Kuhn is expected to open the 2005 season as the team’s starting quarterbackaftermovingundercenterforhisfirstthreestartslastseason. A big, strong player with an accurate arm and good running ability, he brings a lot of poise to the position and has the confidence of his teammates. Kuhn completed 54-of-105 passes for 615 yards and three touchdowns while running for three more scores. He threw for career highs of 208 yards and two touchdowns in the Big Red’s win over Princeton and rushed for two scores and a careerbest 48 yards against Brown. Kuhn also showed the penchant for thebigplay,tossingtwopassesofatleast50yardsandrushingfor at least 10 yards on six different carries. Kuhn saw action in three games as a sophomore, going 3-for-7 for 38 yards. His time came againstnationalcontenderColgate,Columbia,andIvyleaderPenn. He got thrown into the fire as a freshman when then starter Mick Razzano was injured in the final game of the season against Penn. He gained valuable experience in that contest, going 5-for-12 for 31 yards. Kuhn is enrolled in the College of Agriculture and Life Sciences. At New Fairfield: Kuhn played both football and basketballatNewFairfieldHS,earningthreevarsitylettersineach.Afirstteamall-statefootballselectionasasenior,hewasalsoafirst-team all-area and all-conference pick. The team’s captain in 2001, he actually earned all-conference honors three times — honorable mention once and first team twice. As a member of the basketball team, he was an all-division first-team selection as a junior and senior. Kuhn was named to the conference all-academic squad for both sports. Personal: Ryan Michael Kuhn is the son of Michael and Sandra Kuhn and has a younger sister. Year 2002 2003 2004 Totals

GP 1 3 5 9

Comp 5 3 54 62

Year 2002 2003 2004 Totals

GP 1 3 5 9

Rushes 3 2 54 259

Att 12 7 105 124

Pct. .417 .429 .514 .500

Yds 6 11 90 107

WWW .CORNELL B IG R ED . COM

DOUGLEMPA

Yds 31 38 615 684 Avg 2.0 5.5 1.7 1.8

TD 0 0 3 3 TD 0 0 3 3

Int 2 1 4 7 LP 4 12 23 23

#51

Sophomore Linebacker • 5-11 • 199 Point Pleasant Beach, N.J. Point Pleasant Beach HS Applied Economics and Management

At Cornell: Lempa was an impressive contributor to the program as a freshman thanks to his high energy level and hard-hitting style. A tough, strong linebacker, Lempa’s ability to learn the team’s defensive schemes quickly will allow him to see time in 2005. Lempa is enrolled in the College of Agriculture and Life Sciences. At Point Pleasant Beach: Lempa was a four-year letter winner in football at Point Pleasant BeachHS.Hewastheteam’scaptainhisseniorseason,earningfirstteam all-county linebacker accolades. He was also named national division defensive player of the year and was the MVP of the 2003 2005 FOOTBALL

AND

TEAM

Keyport Hall of Fame game. Lempa also lettered in baseball and basketballatPointPleasant.Personal:DouglasRobertLempaisthe sonofRobertandPatriciaLempa.Hehasanoldersisterandanolder brother, Ryan, a captain on last year’s Big Red team.

T ODD LISOWSKI

#19

Sophomore Quarterback • 6-1 • 191 Dover, Ohio Dover HS Policy Analysis and Management

AtCornell:Lisowskiwilllooktocompetefor aspotastheteam’sbackupquarterbackafter spendinghisfreshmanyearquarterbackingthejuniorvarsityteam. A good athlete with solid footwork, Lisowski has the leadership abilitiestobeaserviceableoptionbehindcenter.Heisenrolledin the College of Human Ecology. At Dover: A three-year letter winner in both football and basketball, Lisowski helped Dover HS become state runner-up as a senior. As team captain his senior year, he was namedfirst-teamAll-Ohioquarterbackaswellastakinghomefirstteamall-leaguehonors.Lisowskialsoledhisbasketballteamtothe statefinalsasasenior. Personal:ToddC.LisowskiisthesonofPeter and Roseann Lisowski and has four brothers.

JONATHANLUCAS**

#92

Junior Defensive Line • 6-2 • 240 Wheat Ridge, Colo. Arvada West HS Economics

At Cornell: Lucas developed into one of the Ivy League’s top run-stoppers from his spot on the defensive line in 2004, ranking first on the team in tackles for loss (nine) and fifth in total tackles (50). He added five pass breakups, a forced fumble and a sack for a Cornell defense that ranked seventh nationally against the run. Lucas started all 10 games on the line, posting three games with multiple tackles for loss and recording career highs of eight tackles against both Colgate and Harvard. Lucas had an impressive rookie campaign in 2003, seeing action in eight games, making 13 tackles, including three for loss. He is extremely quick and strong and is expected to continue improving his game. Lucas will see a lot of playing time this season and will challenge for a starting job at defensive end. He is enrolled in the College of Arts and Sciences. At Arvada West: A three-year letter winner at linebacker for the Arvada West HS football team, Lucas was a first-team all-state player. He was the team’s captain as a junior and senior, earning first-team all-conference both years. He was the conference defensive player of the year and a Denver Post Gold Helmet winner en route to earning All-Colorado honors. A member of the track team in 2003, he earned first-team all-league honors as the conference shot put champion. Personal: Jonathan David Lucas is the son of David and Nancy Lucas and has an older brother. Year 2003 2004 Totals

GP 8 10 18

Tackles 9 26 35

Assists 4 24 28

For Loss 3-6 9-27 12-33

Sacks 0-0 1-6 1-6

2005 OUTLOOK

AND

TEAM

A N T H O N Y MACALUSO*

#32

Junior Tailback • 5-7 • 196 Middletown, N.J. Middletown South HS Economics

GP 9 9

KickRet. 2 2

KOR Yds 21 21

Avg 10.5 10.5

TD 0 0

C H I C H I MADU

#75

Junior Offensive Line • 6-5 • 301 Succasunna, N.J. Roxbury HS Natural Resources

At Cornell: Macaluso played a key role in special teams and as a lead blocker in 2004, seeing action in nine contests. He made four special team tackles and returned a pair of kickoffs for 21 yards. Macaluso missed his freshman season with injury and didn’t see any action. He had a good spring outing and showed that he is a hard runner with good vision. Look for him to continue gaining ground this fall and challenge for some playing time. Macaluso is enrolled in the College of Arts and Sciences. At Middletown South: Macaluso was a three-year letter winner on both the football and wrestling teams at Middletown South HS. On the gridiron, he was a first-team alldivision and all-county selection as a junior and senior. As a senior, he went on to also earn first-team All-Shore, Group 3 all-state honors. He was also named to the state’s all-division third team. The team’s captain his senior year, he helped the squad earn the Federal Division title. He also served as the wrestling team’s captain and was a second-team All-Monmouth County pick. Personal: Anthony Dominick Macaluso is the son of Dominick and Nancy Macaluso and has a younger brother. Year 2004 Totals

K E V I N MARCHUT

LP 15 15

#24

Sophomore Defensive Back • 6-1 • 202 Fairfield, Conn. Fairfield HS Engineering

BRIANMcGUIRE

#72

Junior Offensive Line • 6-3 • 314 Princeton Junction., N.J. West Windsor-Plainsboro HS Industrial and Labor Relations

At Cornell: McGuire has worked tremendously hard to earn a spot on the team’s offensive line and has worked hard to make improvements to his game. Possessing good size (6-3, 314), McGuire will challenge for playing time in a backup role this season. He is enrolled in the School of Industrial and Labor Relations. At West Windsor-Plainsboro: McGuire was a three-year letter winner and two-way starter as a junior and senior for the West Windsor-Plainsboro HS football team. He was a first-team all-conference offensive lineman as a senior, after earning second-team honors as a junior. He was also an all-area and AllPrinceton Packet selection in 2002. McGuire capped off his final season by being named the central New Jersey lineman of the year and was selected to play in the North-South all-star game. McGuire also played lacrosse, earning second-team all-area and all-division honorable mention honors. Personal: Brian Patrick McGuire is the son of Kevin and Ann McGuire and has an older sister. His aunt, Vivian McGuire, received her MBA from Cornell in 1983.

E VAN McGUIRE

#53

Sophomore Linebacker • 5-11 • 217 White Plains, N.Y. White Plains HS Policy Management and Analysis

At Cornell: McGuire has the size, strength and skill to play linebacker in the Big Red’s defensiveschemes.Afterayearinthesystem,McGuirewilllookfor a breakthrough season. He is enrolled in the College of Human Ecology. At White Plains: McGuire was a four-year letter winner on theWhitePlainsHSfootballteam.Asaco-captaininhissenioryear, McGuire earned all-section and all-league honors for the second consecutive year. He was also named to the first team all-state defense and was the New York State Class AA Scholar-Athlete of the year. McGuire also lettered in baseball. Personal: Evan Segue McGuire is the son of Terence and Diedra McGuire and has a sister.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

At Cornell: Madu has the size and athletic abilitytocontributeinthedefensivebackfield in 2005. Recruited to Cornell as a running back, Madu will improve with repetition and increased work in the team’s defensive scheme. He saw action in two games as a rookie on special teams and will look to contribute even more as a sophomore. He is enrolled in the College of Engineering. At Fairfield:Madu was a three-time letter winner for football. He was named to the all-state team as a senior and the FCIAC team three consecutive years. He was a member of the Hartford Courant first team defense and the Connecticut Post second team offense. Madu also was a 2004 Fairfield County AllStarselectioninfootball.Heletteredinbasketballandtrackaswell. Personal: Chinedu Ndubisi Madu is the son of Chris and Assumpta Madu and has two younger brothers.

At Cornell: Marchut is a very capable lineman who will challenge for a starting spot in 2005. Marchut has continued to work on improving his game and strength, adding 22 pounds since last season. He is enrolled in the College of Agriculture and Life Sciences. At Roxbury: Marchut was a member of the football and wrestling teams at Roxbury HS. He played on both sides of the line for the football team and earned first-team all-county and all-area honors and was a third-team all-state pick. He capped off his senior season by being selected to play in the North-South All-Star game. He was also a third-team all-county wrestler. Personal: Kevin James Marchut is the son of Gary and Kathy Marchut and has two brothers.

2005 OUTLOOK 2005 JAKEMERRILL

#41

Sophomore Safety • 6-0 • 198 Kentfield, Calif. Marin Catholic HS Communication

#71

Junior Offensive Line • 6-5 • 283 Marengo, Ohio Highland HS Animal Sciences

#50

WWW .CORNELL B IG R ED . COM

Senior Offensive Line • 6-0 • 267 Columbus, Ohio Northland HS Architecture

At Cornell: Moody figures to be a key player intheBigRed’soffensivelinein2005after startingthefirstfourgamesatcenteraseasonago.Heisanathletic and powerful player who continues to work hard to make an impact. He saw time in five games as a sophomore and continued making improvements during the spring. He is a student in the College of Architecture, Art, and Planning. At Northland: Moody was awarded two varsity letters as a member of the Northland HS football team. He was also a member of the wrestling and track and fieldsquads.Heearnedthirdplaceinthecitywrestlingtournament and third in the shot put and discus at the city meet. He was also adistrictqualifierinwrestlingandwasawardedtheArchieGriffin Sportsmanship Award. Personal: Jonathan Douglas Moody is the son of Curtis and Elaine Moody and has two older brothers.

2005 FOOTBALL

At Cornell: Nash made a huge impact on the special teams and the scout team, earning the Dick Schaap Award as the freshman who makes the biggest contributiontothevarsitysquad.Nashsawactioninninecontests onspecialteams.Herunsstrong,preciseroutesatreceiverandhas good hands. Nash could be a surprise contributor out of the wide receiving corps in 2005. He is enrolled in Cornell’s College of Human Ecology. At Fairport: Nash was a four-year starter on the footballteamatFairportHS.Atwo-timeletterwinner,hewasnamed to the first-team all-county squad as a senior and was also an Eddie Meathall-star.Thatyear,Nashalsoservedasco-captainofboththe football and track teams. Personal: Colin Michael Nash is the son of Barry Nash and Patricia Nash-Rubien and has a younger brother.

KYLEPEREZ

#81

Sophomore Fullback • 5-10 • 240 Patterson, Calif. Modesto Central Catholic HS Applied Economics and Management

At Cornell: Miller has the size and athleticism to dent the starting lineup after adding 25 pounds in the offseason. He will look to challenge for playing time in a backup role in 2005. He is a student in the College of Agriculture and Life Sciences. At Highland: An All-Ohio football selection, Miller was a three-year letter winner and starter for the Highland HS team. As a senior, he was captain of the team and also served as the captain of his basketball and baseball teams. He also earned three letters in both of those sports and was an alldistrict basketball pick and an all-league selection in baseball. Personal: Eric Joseph Miller is the son of Kurt and Terri Miller and has two sisters.

J O N MOODY*

C OLIN NASH*

TEAM

Sophomore Wide Receiver • 5-11 • 169 Fairport, N.Y. Fairport HS Human Biology, Health and Society

AtCornell:Merrillisanotherinalonglineof talented young safeties on the Big Red’s roster. With the speed to cover receivers and the strength to come up and stop the run, Merrill will have a shot to earn playing time as asophomore. HeisenrolledinCornell’sCollegeofAgricultureand Life Sciences. At Marin Catholic: Merrill earned all-conference accolades as a senior, averaging better than 7.0 yards per carry as a running back and intercepting three passes and returning them for touchdowns as a defensive back. He captained his sectional championship team in his final campaign. Merrill also played lacrosse, earning all-conference and team MVP honors as a senior andsettingleaguerecordsforgoalsinaseasonasajunior.Personal: John Ogden Merrill IV is the son of John and Kay Merrill.

ERICMILLER

AND

AtCornell:Perezwillbattleforplayingtime as a fullback and on special teams as a sophomore. He has good speed for his size and may also be a special teams contributor. Perez is enrolled in the College of Agriculture and Life Sciences. At Modesto Central Catholic: Perez was a twotimeall-leagueselectionatCentralCatholicHS,earningall-state honors as a senior while playing fullback and linebacker. He was named the league’s most valuable player in 2003 after helping his squadtoitsthirdstraightsectiontitleandsecondconsecutivestate Division 5 crown. He also lettered one year in both baseball and track and field. Personal: Kyle Anthony Perez is the son of Ray and KristiPerezandhasanolderbrotherandanolderandyoungersister.

MIKEPITTORE

#69

Sophomore Defensive Line • 5-11 • 232 Lafayette, Calif. De La Salle HS Civil Engineering

At Cornell: Pittore spent his freshman season on the two-deep on the defensive line, but did not see any varsity action. That will change in 2005, as PittorewillplayasignificantroleintheBigRed’sdefense.Pittore excels equally well in run-stopping and pass rushing. After a year adjusting to the speed of the game and gaining strength in the weight room, he will have every opportunity to see important playingtime.PittoreisenrolledinCornell’sCollegeofEngineering. AtDeLaSalle:Pittorewasathree-timeletterwinnerandstarteron a De La Salle HS squad that won three straight national championships. An All-East Bay and all-league first-team selection, he was named the California North Coast Student-Athlete of the Year in 2004 by Cal-Hi Sports. Pittore was also named to the second team on the San Francisco Chronicle’s all-metro team As a senior, he recorded10sacksand65tackles.Personal:MichaelA.Pittoreisthe son of Jesse and Brenda Pittore and has a younger brother.

2005 OUTLOOK

AND

TEAM

M ATT POLLOCK**

#98

PATRICKPOTTS**

Senior Defensive Line • 6-1 • 267 Fulton, N.Y. G. Ray Bodley HS Applied Economics and Management

AtCornell:PollockplayedatanAll-Ivylevel in 2004, starting all 10 games and helping the Big Red rank seventh nationally against the run, allowing just 101 yards per game. He is extremely strong and powerful with quick hands, and has become a strong pass rusher and well as a runstuffer. Pollock was dominant at times, ranking fourth among the team’s defensive linemen with 31 tackles, making 7.5 tackles for loss and registering a sack. Pollock also forced a fumble, broke up threepassesandblockedapairofkicks,includingafourth-quarter extra-pointblockagainstPrincetonthathelpedtheBigRedwin2120. That performance earned him Ivy League Special Teams Player of the Week honors. Pollock made a career-high nine tackles, including three for loss, and forced a fumble in the season opener vs. Bucknell. He saw significant action in 2003, making 24 total tackles and recording a sack. He is enrolled in the College of AgricultureandLifeSciences.AtBodley:Pollockplayedonboththe offensive and defensive lines at G. Ray Bodley HS, earning two varsityletters. Asasenior,heearnedfirst-teamAll-CNY,all-league and all-state honors. His 2000 team won the regional title and went on to finish third in the state. Pollock was also a member of the wrestling and lacrosse teams. The wrestling team won two Section IIItitlesandplacedfifthatthe2001NewYorkstatechampionships. Personal: Matthew Edward Pollock is the son of Michael and Joanne Pollock and has a younger brother. Year 2002 2003 2004 Totals

GP 1 10 10 21

Tackles 0 14 18 32

Assists 1 10 13 24

For Loss 0-0 1-2 7.5-26 8.5-28

Sacks 0-0 1-2 1-9 2-11

#58

Senior Linebacker • 6-2 • 227 Kenton, Ohio Kenton Senior HS History

At Cornell: Potts is a two-year starter at linebackerandwillcontinuethatroleonthe rightsidethisseason. Heistechnicallysoundandisatrueleader by example. One of the team’s most consistent players, he has the potentialtobeanall-leagueperformerifhecontinuestoworkhard. Potts ranked fourth on the team in tackles with 55 to go along with six tackles for loss and three sacks. He added two pass breakups and a fumble recovery to cap off his junior campaign. Potts had a pair of double figure tackle games, recording 11 stops against both Towson and Harvard. He also had a pair of sacks against Dartmouth. Potts was also named an ESPN Academic All-District selection after postinga3.45gradepointaverageinhistory.Pottswasthirdoverall on the team in tackles in 2003 with 65 total tackles, including 31 solos and four tackles for loss. As a rookie, he saw action in two games and made one tackle. He is a student in the College of Arts andSciences.AtKentonSenior:Pottswasafour-timevarsityletter winner as a middle linebacker for the Kenton Senior HS football team. He also played on the basketball team and was a member of thetrackandfieldsquad. Onthegridiron,hewasafirst-teamallleague, all-region and all-state selection. He was also named the league’s defensive back of the year and was the Northwest Ohio Defensive Player of the Year. As a senior, he captained the team to the league and state titles. As a member of the basketball team, he was the squad’s captain and earned all-league honors. Personal: Patrick James Potts is the son of James and Rebecca Potts and has twooldersisters. Year 2002 2003 2004 Totals

GP 2 10 10 22

Tackles 0 31 28 59

Assists 1 34 27 62

For Loss 0-0 4-7 6-23 10-30

KYLEREIDY

Sacks 0-0 0-0 3-18 3-18

#83

Sophomore Linebacker • 6-1 • 213 Scarsdale, N.Y. Edgemont HS Biological Sciences

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

At Cornell: A big linebacker with good strength and instincts, Reidy will be out to earn playing time as a sophomore. He saw action in three games as a freshman on special teams. Reidy is enrolled in Cornell’s College of Agriculture and Life Sciences. At Edgemont: Reidy was afirst-teamall-stateselectionasaseniorandplayedintheGovernor’s Bowl All-Star game, which pits student-athletes from New York and New Jersey. The football team captain, he helped his squad to a sectional championship in 2001. Reidy participated in the Section I senior all-star game and was named to the Westchester County Golden Dozen team. He also competed in basketball and track and field,winningthecountytitleinthejavelin. Personal:KyleLouis ReidyisthesonofJamesandValerieReidyandhasanolderbrother.

2005 OUTLOOK 2005 KEVINREX**

#21

Senior Free Safety • 6-2 • 211 Thousand Oaks, Calif. Thousand Oaks HS Biological Sciences

At Cornell: Rex was a second-team All-Ivy selection in 2004, exploding for a breakthrough season as a junior. A big-play safety, Rex paced the team in tackles (86) and forced fumbles (four) and ranked fourth in tacklesforloss(7.5for35yards)andthirdinsacks(3.0for23yards). He moved into the whip position after an injury to Joel Sussman and flourished, eventually starting all 10 games. Rex made a team-best eight tackles, including one for a loss, and forced two fumbles in the 10-6 loss to No. 20 Colgate, then responded with a game-high 13 tackles to go along with a forced fumble and a sack against Brown. He had a game-high 14 tackles to go along with a sack in the win at Columbia on Nov. 13. As a sophomore, he saw action in all 10 games and came away with 22 total tackles, including two for a loss of 20 yards. The coaching staff is expecting big things fromhimthisfall. HeisenrolledintheCollegeofArtsandSciences. At Thousand Oaks: Rex was a member of the football, basketball and volleyball teams at Thousand Oaks HS. As a member of the football team, he earned all-county and All-CIF honors his senior year, as his squad won the league title. He was selected to play in the Ventura County East-West All-Star game. Rex was also an allcounty and All-CIF basketball pick. Personal: Kevin Gregory Rex is the son of Gregory and Jane Rex and has two older sisters and a youngersister. Year 2002 2003 2004 Totals

GP 5 10 10 25

Tackles 2 16 45 63

Assists 1 6 41 48

Int 0-0 0-0 2-0 2-0

Passes Def For Loss 0 0-0 0 2-2 7 7.5-35 7 9.5-37

B RIAN ROMNEY*

WWW .CORNELL B IG R ED . COM

Senior Wide Receiver • 5-9 • 166 Pleasant Grove, Utah Pleasant Grove HS • Snow JC General Studies

At Cornell: A second-team All-Ivy selection as a junior, Romney returns as one of the Ivy League’s top big-play receivers. Though small in stature, Romney runs tremendous routes, has good hands and is as tough as they come, unafraid to go across the middle and make a catch. Romney ledtheteaminreceptions(60)andreceivingyards(766)inhisfirst season at Cornell. He was the Ivy League Offensive Player of the Week after his 114-yard, two-touchdown performance in the win over Princeton. Romney recorded eight catches for 98 yards and the game-winning touchdown with 37 seconds left in a win at Columbia and had his second 100-yard receiving game in the season finale at Penn. He was also a weapon on punt returns, setting a school record with 34 punt returns, gaining 221 yards. Romney had at least four catches in each contest. Romney is enrolled in Cornell’s College of Agriculture and Life Sciences. At Snow JC: Romney was a second-team All-America selection after leading the nation in receptions per game as a freshman at Snow Junior College. A twotime all-conference pick, he was selected team MVP as a sophomore.Romneyearnedscholar-athlete All-Americahonors.AtPleasantGrove: Romneywasathree-timeall-regionpickandanall-state 2005 FOOTBALL

AND

TEAM

selection as a senior at Pleasant Grove. He led his team to a region title on the gridiron in his final season and earned a total of nine varsitylettersinfootball,basketballandbaseball.Personal:Brian Eli Romney is the son of Park and Sandy Romney and has three brothersandtwosisters. Romneyandhiswife,AngelaKay(DeMill), were married Dec. 19, 2003. Year 2004 Totals

GP 10 10

Rec 60 60

Yds 766 766

Avg 12.8 12.8

TD 3 3

LP 54 54

Year 2004 Totals

GP 10 10

Punt Ret. 34 34

PR Yds 221 221

Avg 6.5 6.5

TD 0 0

LP 20 20

JEFFROSAGE

#85

Sophomore Tight End • 6-3 • 235 Panama, N.Y. Panama Central HS Engineering

At Cornell: Rosage possesses great size as a receiving tight end and will have a chance to break into the lineup as a sophomore. He is enrolled in Cornell’s CollegeofEngineering.AtPanama Central: Afour-yearstarterand four-time letter winner, Rosage earned second-team all-league honors twice while serving as captain of his team at Panama HS. A member of the All-WNY academic team, he also received first-team all-statehonors.Rosagewasalsocaptainoftheschool’sbasketball andtrackandfieldteams.Afive-timeletterwinnerintrack,heset the school record in the shot put and discus. Personal: Jeffery Thomas Rosage is the son of Donald Rosage and Rebecca Dibble andhastwooldersisters.

L OREN ROSENBERG

#74

Sophomore Offensive Line • 6-2 • 256 Oak Park, Calif. Oak Park HS Developmental Sociology

AtCornell:Rosenberghasgoodsizeandskill for a young offensive lineman. He excels in both pass and run blocking, which will give him a chance to see playing time as a sophomore. He is enrolled in Cornell’s College of Agriculture and Life Sciences. At Oak Park: Rosenberg won three lettersinfootballatOakParkHS.HewasnamedtotheAll-Tri-Valley League team and was a Ventura County All-Star as a senior. He was alsoawardedsecond-teamall-statehonorsbyCalHiSports.AnAllCIFselection,RosenbergwasaCaliforniaBowlall-starandlineman of the year at Oak Park. Personal: Loren Michael Rosenberg is the son of Joel and Sheree Rosenberg and has an older sister.

2005 OUTLOOK

AND

TEAM

T ODD RUSINKOVICH

#40

LUKESIWULA*

Junior Fullback • 6-0 • 231 San Clemente, Calif. San Clemente HS Human Development Studies

At Cornell: Rusinkovich made the transition from the defensive line to fullback last fall before going down for the season with a knee injury after seeing action in one game. If healthy, he will look to earn snaps as a lead blocker this season. Rusinkovich is enrolled in the College of Human Ecology. At San Clemente: Rusinkovich was a threeyear letter winner and starter for the San Clemente HS football team. He was an all-league pick and his team was a two-time CIF semifinalist. He captained the squad and was named the team’s MVP. Rusinkovich was also a two-year letter winner on the baseball and basketball teams. He was named his school’s male athlete of the year as a senior. Personal: Todd Schuler Rusinkovich is the son of John and Cheri Rusinkovich and has two younger brothers.

EDSABIA*

#43

Senior Linebacker • 6-1 • 227 Lafayette Hill, Pa. LaSalle College HS Civil and Environmental Engineering

AtCornell:Sabiawillreturntothelinebacking corps after sitting out the 2004 season with aninjuryandisexpectedtoseesubstantialtime.Hehastremendous athletic ability and is extremely mobile, which will allow him to compete for a starting job this fall. He saw action in nine games in 2003,recording25totaltackles,includingtwoforlossandasack. He is enrolled in the College of Engineering. At La Salle:Sabia was amemberofthefootballteamforthreeyearsatLaSalleCollegeHS, whereheplayedatthelinebackerandtightendpositions.Asajunior andsenior,heearnedfirst-teamall-league,all-cityandall-county honors as a linebacker. He was also a second-team All-Southeast Pennsylvania selection and was picked to play in the Montgomery County All-Star game. Personal: Edward Charles Sabia is the son of John and Virginia Sabia and has an older brother and younger twin sisters.Hisfatherplayedfootballandhismotherwasonthetennis teamatWakeForest,whilehisbrother,John,wascaptainoftheWest Point tennis team prior to graduating in 2004. GP Tackles Assists 9 13 12 Missed season with injury 9 13 12

For Loss 2-4

Sacks 1-1

2-4

1-1

At Cornell: Siwula is a gifted athlete who possesses good running ability. He saw actioninthefinalsixcontestsof2004,registeringthreespecialteam tackles and rushing three times for 7 yards. Siwula is enrolled in Cornell’s School of Industrial and Labor Relations. At Homer: Siwulawasafirst-teamall-leagueselectionasajuniorandsenior at Homer HS. He earned team MVP honors as a senior and the team’s Mr. Offense Award as a junior. Siwula received a national scholarathletescholarshipafterletteringinfivedifferentsportsandwasa two-timeall-leaguepickinlacrosse.Personal:LukasAndrewSiwula is the son of Terri and Tom Siwula and has an older and a younger sister. Year 2004 Totals

GP 6 6

Rushes 3 3

Yds 7 7

Avg 2.3 2.3

TD 0 0

T ED SONNENBERG*

LP 3 3

#68

Junior Offensive Line • 6-4 • 278 Holgate, Ohio Holgate School Animal Sciences

At Cornell: Sonnenberg made an impact during his sophomore campaign, playing in nine games while starting the last six games of the season. With Sonnenberg as a starter, the Big Red went 3-3. Sonnenberg is emerging as an All-Ivy weapon at right guard, where he will protect the quarterback alongside first-team All-Ivy selection Kevin Boothe. Sonnenberg is a student in the College of Agriculture and Life Sciences. At Holgate: A four-year letter winner in football at Holgate School, Sonnenberg played on both the offensive and defensive lines. The team’s captain and MVP as a senior, he was also a Perrysburg All-Star. He also earned first-team all-conference honors on both sides of the ball. Sonnenberg also played basketball and was a member of the track team. His basketball team played in the regional tournament three straight years and was the league champion in 2003. He was the track team’s MVP and was a regional qualifier in the discus and shot put. Personal: Theodore Sonnenberg is the son of Kent and Jan Sonnenberg and has two sisters.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Year 2003 2004 Totals

#25

Sophomore Tailback • 6-0 • 191 Cortland, N.Y. Homer HS Industrial and Labor Relations

2005 OUTLOOK 2005 JOELSUSSMAN**

#35

R ICH TRUMKA**

Senior Safety • 6-4 • 234 Great Neck, N.Y. Great Neck North HS General Studies

WWW .CORNELL B IG R ED . COM

GP 9 10 injured 4 23

2005 FOOTBALL

TEAM #42

Senior Linebacker • 5-11 • 208 Rockville, Md. Thomas S. Wootton HS Industrial and Labor Relations

At Cornell: An All-Ivy caliber player and potential NFL Draft prospect, Sussman entershisfinalseasonwithplentytoprove.Beforebeinginjuredinthe fourth game of the season, Sussman was having a dominant campaign at the whip position, posting 31 total tackles and blocking three field goal attempts. Sussman increased his school record total of blocked kicks to six, earning Ivy League Special Teams Player of the Week after posting 10 tackles, blocking two field goal attempts, recovering a fumble and posting a tackle for loss in the team’s opener vs. Bucknell. He returned to the Big Red after missing the 2003 fall season because of an injury.One of the most dedicated and hardest-working players on the team, he is known for his hard-nosed, aggressive play and will provide leadership to the defense. A dominant force at linebacker in previous seasons, Sussman earned second-team All-Ivy recognition as a sophomore after leading the Big Red in tackles (90) in 10 starts. He alsorecordedfivetacklesforloss,wascreditedwithtwoforcedand recovered fumbles, three passes defended and a pair of blocked kicks. One of his top performances of 2002 was in the overtime win against Brown, where he recorded 10 tackles, including one for a lossof15yards.Lateinthegame,hestrippedtheballawayandthen recovered the fumble, giving the offense the chance to drive down the field en route to the win. He also recorded 11 tackles against Princeton and had a season-high 13 in the win over Dartmouth. Sussman saw action in all nine games for the Big Red as a rookie, primarilyonspecialteams.Herecorded17totaltacklesfortheyear, includingfivesoloefforts.Hehadtwotacklesforlossvs.Harvard, including a 5-yard sack and closed out 2001 with a blocked kick against Penn in the season finale. He is enrolled in the College of Agriculture and Life Sciences. At Great Neck: Sussman was an allcounty selection in football at Great Neck North HS. A two-year letter winner, he served as the team’s captain his senior year. Sussman also played lacrosse and was a two-time all-county pick on defense. He was selected to play in the NY/LI all-star game his senior year. Personal: Joel Matthew Sussman is the son of Don and Karen Sussman and has two brothers and a sister. Sussman’s parents are both Cornell graduates and his father played two seasons on the Big Red’s sprint football team (lightweight). Year 2001 2002 2003 2004 Totals

AND

Tackles 5 50

Assists 12 40

For Loss 2-6 5-19

Sacks 1-5 0-0

16 71

15 67

1-1 8-26

0-0 1-5

At Cornell: Trumka is a special teams terror who will look to challenge for playing time at the linebacker slot in his final campaign. A hard worker, Trumka is a tough, smart player who provides depth at linebacker. He also serves as the team’s long snapper and provides a lot of consistency and assurance in that role. He ended his junior season with four special teams tackles, seeing action in all 10 games. As a sophomore, he saw action in all 10 contests and made 11 total tackles. TrumkaisenrolledintheSchoolofIndustrialandLaborRelations. At Thomas S. Wootton: Trumka was a varsity letter winner for the football and baseball teams at Thomas Wootton HS. As a senior, he was named to the Washington Post all-league team, the Montgomery Journal all-county team and the Potomac Almanac all-county team. He was also honored by the coaches when he was selected to the all-county team. The team’s captain, he finished his career with a school record 306 tackles, including the single-season record of 133 sticks. He was a starting outfielder for the baseball team. Personal: Richard L. Trumka is the son of Richard and Barbara Trumka. His cousin, Fred Pugac, was a linebacker on the Ohio State footballteam. Year 2003 2004 Totals

GP 10 10 20

Tackles 6 3 9

Assists 5 1 6

For Loss 0-0 0-0 0-0

DANWASSER

Sacks 0-0 0-0 0-0

#49

Sophomore Fullback • 5-9 • 222 Thousand Oaks, Calif. Viewpoint School Undecided

At Cornell: Wasser enters his sophomore season looking to earn playing time as a blocking fullback after impressing as a rookie. He has good speed for his size and may also be a special teams contributor. He saw actionagainstColgateonspecialteamsforhisfirstvarsityaction. WasserisenrolledintheCollegeofArtsandSciences.AtViewpoint: A three-time all-league running back, Wasser was captain of his Viewpoint School team as a senior. He was named the team’s offensive player of the year in 2001. Wasser has also competed in fencing (saber) and was certified to scuba dive. Personal: Daniel Edward Wasser is the son of Harris and the late Ann Wasser and has ayoungersister.

2005 OUTLOOK

AND

TEAM

A.J.WEITSMAN**

#88

Senior Place-kicker • 6-2 • 192 Saratoga, Calif. Saratoga HS Biological and Environmental Engin.

At Cornell: Weitsman and his powerful leg willhaveachancetoearnthestartingkicker spot outright in 2005. A kickoff specialist each of the last two seasons, Weitsman made 2-of-6 field goals, including a 40-yarder atBrowntosetacareerhigh.Healsonailedfiveextrapoints.Atough player, he was also credited with a pair of special teams tackles. Weitsman saw action in several games in 2003 and connected on a field goal and seven extra points, while also providing kickoff duties.He is enrolled in the College of Engineering. At Saratoga: Weitsman was a place-kicker for the football team and also played soccer at Saratoga HS. As a member of the football team, he was a first-team all-league pick as a junior and was named the league’s outstandingkickerasasenior.Hewasalsohissoccerteam’scaptain and was named the league’s MVP as a senior. Personal: Andrew John Weitsman is the son of Kevin ‘72 and Kathy Weitsman and has a younger brother. Year 2003 2004 Totals

GP 7 10 17

X-Pts Made-Att 7-7 5-5 12-12

FGM-FGA 1-3 2-6 3-9

Lg 24 40 40

PETERZELL

Pts 10 11 21

#39

Sophomore Place-kicker • 6-2 • 186 Ft. Myers, Fla. Bishop Verot HS Economics

Year 2004 Totals

GP 2 2

X-Pts Made-Att 2-3 2-3

FGM-FGA 0-1 0-1

Lg — —

Pts 2 2

Freshman Tight End • 6-5 • 235 Roxbury, N.J. • Roxbury HS Chemical and Biomolecular Engineering

At Roxbury: A captain of both the football and basketball teams at Roxbury HS, Adams was a first-team all-area and all-county selection in 2004. He was named to the New Jersey Super 100 squad and was a National Football Hall of Fame Scholar-Athlete Award recipient. Adams was a first-team all-league pick as a junior and senior and was a three-year starter at tight end and on the defensive line. His team won the conference title as a sophomore. Adams was also an honorable mention all-league pick in basketball, where he was athree-yearletterwinner. Personal:RyanJeffreyAdansistheson of Jeff and Lori Adamsand has a younger brother and sister. His grandfather,RobertAdams,playedfootballfortheBaltimoreColts. He is enrolled in the College of Engineering.

D ARIO AREZZO Freshman Defensive End • 6-1 • 228 North Syracuse, N.Y. • Christian Brothers Academy Communication

AtCBA:Afirst-teamall-stateandAll-CentralNewYorkselectionat Christian Brothers Academy, Arezzo was part of an undefeated state championship squad his senior year. He recorded 79 tackles, including 10 for loss and eight sacks, while blocking a kick and scoring a pair of defensive touchdowns as an all-league defensive end.Arezzowasinvitedtoplayinthe2004Governor’sBowl,pitting the best high school players from New York vs. the best players from NewJersey.Asajunior,Arezzowasthird-teamall-leagueandthirdteam All-Central New York. For his career, Arezzo posted 208 tackles, 25 tackles for loss and 20 sacks. He was rated a two-star prospectaccordingtoscoutingserviceRivals.com.Personal:Dario Giuseppe Arezzo is the son of Pietro and Angela Arezzo and has a youngersister.HeisenrolledintheCollegeofAgricultureandLife Sciences.

JESSEBAKER Freshman Wide Receiver • 6-2 • 184 Platteville, Wis. • Platteville HS Economics

At Platteville: A first-team all-state selection by the Wisconsin Football Coaches, Baker was named one of the top 100 high school prospects in the state of Wisconsin by Scout.com as a senior at Platteville HS. Baker had 54 catches for 1,012 yards and 15 touchdowns in his final season, leading the state in touchdowns and ranking third in receiving yards. He was named first-team allconference as a team captain. The three-year starter was named the team’s offensive MVP in 2004. Baker had a state record five touchdown catches in one game during his junior campaign, then broke his own state record by hauling in six scoring passes. He ended that game with 264 receiving yards, ninth-best in state history. Baker had 107 career receptions for 1,765 yards and 28 touchdowns, averaging 16.5 yards per reception. He was named honorable mention all-state as a junior. Personal: Jesse Lee Baker isthesonofStephanieBecker.HeisenrolledintheCollegeofArts and Sciences.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

At Cornell: Zell has a strong leg and, with added confidence, will have a chance to earn the team’s full-time kicking position. He kicked in two games last year,making2-of-3extra-points.ZellisenrolledintheCollegeof Arts and Sciences.At Bishop Verot: Zell lettered for two years as a member of the Bishop Verot football team. As a kicker, he was named the team’s special teams player of the year and was an allarea honorable mention. He was also named Southwest Florida RotarySouthScholar-AthleteoftheYear.Zellwasafour-timeletter winner on the soccer team, earning first team all-state honors as a senior. Personal: Peter Douglas Zell is the son of Douglas and E. Susan Zell and has an older brother and sister.

RYANADAMS

WWW .CORNELL B IG R ED . COM

2005 OUTLOOK 2005

AND

TEAM

JOSHBARVIN

S COTT BOONE

Freshman Offensive Line • 6-7 • 257 Houston, Texas • Phillips Exeter Academy (Mass.) Economics

Freshman Defensive Line • 6-2 • 240 Naperville, Ill. • Benet Academy Chemical and Biomolecular Engineering

AtPhillipsExeter:BarvinplayedoneyearatPhillipsExeterAcademy after a strong high school career at the Kincaid School. A physically imposing athlete, Barvin played on both the offensive and defensive lines, helping Kincaid to a 9-1 record and an unbeaten league mark in 2003 en route to a Southwest Prep Conference championship. He also competed in basketball and track and field. Personal: Joshua Meyer Barvin is the son of Mark and Martha Barvin and has an older brother and a yonuger brother. His older brother,Eric,playsbasketballatEmoryUniversity.Barvinisenrolled in the College of Arts and Sciences.

AtBenet:Afirst-teamall-stateselectioninClass6Aasaseniorat Benet Academy, Boone was selected to participate in the 2005 IllinoisCoachesAssociationShrinersAll-StarFootballGame.Boone was named the league’s top defensive lineman and was a first-team all-league pick. Personal: Scott Cameron Boone is the son of Mark and Kathy Boone and has a younger brother and sister. He is enrolled in the College of Engineering.

T IM BAX

P E T E BURNHAM

Freshman Safety • 6-1 • 165 Chicago, Ill. • Mount Carmel HS Urban and Regional Studies

Freshman Defensive End • 6-3 • 235 Danvers, Mass. • St. John’s Preparatory School Animal Sciences

At Mount Carmel: Bax was a three-sport star at Mount Carmel HS, competinginfootball,basketballandvolleyball.Afirst-teamAllCatholicLeagueselectioninhisfinaltwoseasonsandanhonorable mention all-state pick in his final campaign, Bax had 66 tackles as a senior for his 9-4 squad. He was named to the ISNET Chicago Super 7 all-star team as one of the seven best players in the Catholic League. Bax also earned team most valuable player honors as a senior. Personal: Timothy John Bax is the son of Mary and Bob Bax and has an older brother and an older and younger sister. He is enrolledintheCollegeofArchitecture,Art,andPlanning.

AtSt.John’sPrep:Athree-yearstarteratSt.John’sPrep,Burnham was named to the league all-star team while playing a myriad of positions.Burnhamsawactionatdefensiveend,tightend,fullback and on the offensive line, helping his team to four consecutive league championships. He posted 54 tackles and eight sacks as a senior, earning him a spot in the Shriner’s All-Star Class and the Agganis All-Star game. He was named to the Lynn Item All-Star team as a senior in football, then switched to the diamond in the fall, playingpitcherandfirstbaseforthebaseballteam.Personal:Peter J. Burnham is the son of Scott and Patricia Burnham and has an older sister and a younger brother. He is enrolled in the College of AgricultureandLifeSciences.

H O R A T I O BLACKMAN

Z A C CANTY

Freshman Wide Receiver • 6-1 • 170 Albany, N.Y. • Albany HS Policy Analysis and Management

Freshman Wide Receiver • 5-8 • 164 Naperville, Ill. • Naperville North HS Applied Economics and Management

At Albany: Blackman had 19 catches for 378 yards and two touchdowns as a senior wide receiver at Albany HS to rank among thetop20receiversinthesection.ASectionIIAll-Star,Blackman wasfirst-teamall-areawhileservingasteamco-captain.Hehadfive games with at least 50 yards receiving and also hauled in a twopoint conversion. Blackman also lettered as captain of the track team. Personal: Horatio Walton Blackman is the son of Albert and JenniferBlackmanandhasanolderbrotherandsister.Hisbrother, the late Balewa Blackman, is a 1996 Cornell grad, while his sister, Loneke, is a sophomore at Cornell. He is enrolled in the College of Human Ecology.

AtNapervilleNorth: Afirst-teamall-areaselectionasaseniorat NapervilleNorthHS,Cantyhadcloseto800yardsreceiving,rushed for more than 200 yards, returned punts and kicked field goals and extra points as a senior. As a defensive back, he added four interceptions with 44 tackles and was invited to compete in the 2005 ICA/Shrine All-Star Football Game. Helped his team to a league title and a 10-1 record as a senior after earning Sun News Player of the Year as a junior. He led the team with 524 yards receiving in 2003 and ranked fourth in rushing with 357 yards. He also scored seven all-purpose touchdowns as a junior when he earned Chicago Tribune honorable mention all-state accolades. Canty was rated two-star prospect according to scouting service Rivals.com. Personal: Zachary Adam Canty is the son of Don and Karen Canty and has a younger brother and sister. He is enrolled in the College ofAgriculture and Life Sciences.

2005 FOOTBALL

2005 OUTLOOK

AND

TEAM

S HANE CONNOLLY

N A T H A N FORD

Freshman Quarterback • 6-1 • 181 Johnson City, N.Y. • Maine-Endwell HS Science of Natural and Environmental Systems

Freshman Quarterback • 6-1 • 188 Palo Alto, Calif. • Palo Alto HS Undecided

At Maine-Endwell: The 2004 New York State Class A player of the year, Connolly led Maine-Endwell HS to its first state title with a perfect12-0seasonasasenior.Asasenior,Connollycompleted69of-113 passes for 1,324 yards and 14 touchdowns while throwing just five interceptions. Connolly also ran for 10 touchdowns in ME’s option attack. Connolly was also chosen as the New York State CoachesAssociationCo-PlayeroftheYearasaseniorafterearning third-team all-state honors as a junior at safety. He directed an offense that averaged nearly 38 points per game on its way to the state championship. Connolly was invited to play in the 2004 Governor’s Bowl, pitting the best high school players from New Yorkvs.thebestplayersfromNewJersey.Despiteplayingwithatorn ACL in the state final, Connolly tossed for 308 yards and three touchdowns after sitting out the first quarter. He competed in the 2005 Ernie Davis All-Star Classic. He was named to the 2003 and 2004 Binghamton Press and Sun Bulletin All-Metro first team. Connollywasafour-yearstarterinfootball,athree-yearstarterin baseball as a pitcher/first baseman and a two-year starter as a forward in basketball. Personal: Timothy Shane Connolly is the son of Tim and Cheryl Connolly and has two younger brothers. He is enrolledintheCollegeofAgricultureandLifeSciences.

At Palo Alto: Ford tossed for 2,151 yards and 24 touchdowns as a senior at Palo Alto HS while rushing for five more scores. The twoyear tri-captain was named the league’s outstanding offensive playerandfirst-teamall-leagueandhonorablementionall-stateas a senior. Ford was a perfect 16-of-16 passing in a 49-40 win in one game and threw for six touchdowns in another contest. Ford tossed for 2,301 yards and 29 touchdowns with just nine interceptions whileearningthe SanJoseMercuryNewsAll-CentralCoastJuniorof the Year. For his career, Ford threw for 6,357 yards and 72 touchdowns while running for 19 more.A three-sport star (football, basketball, baseball), Ford was heavily recruited by Division I baseballprogramsbeforeoptingtoplayfootball.Personal:Nathan Edward Ford is the son of Kevin and Celeste Ford and has an older sisterandyoungersister.Hisoldersister,Miranda,playedsoccerat Notre Dame. He is enrolled in the College of Engineering.

B RENDAN DALY Sophomore Defensive Line • 6-1 • 246 Victor, N.Y. • Victor HS Applied Economics and Management

At Victor: Daly was a first team all-league and honorable mention All-GreaterRochesterselectionasasenioratVictorHS.Athree-year letter winner and two-year starter in football, he helped lead his team to the 2000 Class A semifinals and a district title, as well as league titles as a freshman and senior. Daly also served as team captain for the Victor lacrosse team. that won section titles as a junior and senior. Daly was his school’s High School Heisman nominee. Personal: Brendan Kieran Daly is the son of Kieran and PegDalyandhasanoldersisterandayoungerbrother.Heisenrolled intheCollegeofAgriculture andLifeSciences.

BRIANFitzPATRICK

AtEpiscopal:FitzPatrickwasnamedfirst-teamall-cityandall-state afterasuccessfulprepcareeratEpiscopalAcademy.FitzPatrick,the Philadelphia Daily News’ Inter-AC Player of the Year, rushed for 1,512 yards and 16 touchdowns. He also was 40-of-80 passing for 528yardsandninemorescores.FitzPatrickalsowasatopperformer on defense from the defensive back position and had two return touchdowns. He earned the Maxwell Football Club Award as the top playeronhisteam.FitzPatrickalsoplayedhalfbackearlierinhis career,andnetted2,754yardsoftotaloffenseinhiscareer.Hewas a three-time all-league pick and a two-time all-county selection. FitzPatrickalsoletteredinbasketballandbaseball.Personal:Brian ShaneFitzPatrickisthesonofBrianandBetteFitzPatrickandhasa youngerbrother.HeisenrolledintheCollegeofArtsandSciences.

Freshman Tailback • 5-10 • 181 Macugnie, Pa. • Emmaus HS Undecided

At Emmaus: Germani rushed for 1,624 yards and 14 touchdowns asasenioratEmmausHS,earningfirst-teamall-areaaccolades.He finished with career numbers of 3,561 yards and 36 touchdowns on the ground. He earned the Maxwell Football Club Award as the topplayeronhisteam.GermaniwasinvitedtoplayintheMcDonald’s LehighValleyAll-StarFootballClassicafterhisseniorseason.Asa junior, Germani won the 2003 NHSCA High School Football Strength, Speed and Agility championship. Personal: Jamison L. Germani is the son of Jeffrey and Kimberly Germani and has an older brother andyoungersister.HeisenrolledintheCollegeofAgricultureand LifeSciences.

G ARRETT GROVE Freshman Linebacker • 6-3 • 204 Loganville, Ga. • Loganville HS Undecided

At Loganville: Grove was an all-county selection as a senior after a successful three-year starting career at Loganville HS. A team captain as a senior, he was the school’s nominee for the Wendy’s High School Heisman Award and was a three-time team defensive player of the week. A Coca-Cola Academic Athlete award winner, Grove also led the team’s defensive linemen with 59 tackles as a junior.Hewasafour-yearstarterandletterwinneronthegolfteam, earning all-county honors twice, and was a two-year letter winner in basketball. Personal: Garrett Grove is the son of Ric and Lisa Grove and has an older brother and younger sister. He is enrolled in the College of Arts and Sciences.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Freshman Defensive Back • 5-10 • 174 Collegeville, Pa. • Episcopal Academy Undecided

JAMIEGERMANI

2005 OUTLOOK 2005

AND

TEAM

JOSHUA HULSEBERG

GUSKRIMM

Freshman Wide Receiver • 5-8 • 152 Wilbraham, Mass. • Minnechaug Regional HS Industrial and Labor Relations

Freshman Safety • 6-0 • 189 Columbus, Ohio • Upper Arlington HS Communication

At Minnechaug Regional: Hulseberg was a second-team all-league selection as a senior captain at Minnechaug Regional HS. Hulseberg was also named to The Republican’s Fall 2004 All-Academic team and was a two-time All-Western Massachusetts second-team pick. A three-year letter winner, Hulseberg also competed for the track and field team, finishing in the top three in Western Mass. in both the 100 meters and the javelin. Personal: Joshua Andrew Hulseberg is the son of Kevin and Janet Hulseberg and has an older brother and sister.HeisenrolledintheSchoolofIndustrialandLaborRelations.

At Upper Arlington: A three-year varsity letter winner and team captain as a senior at Upper Arlington HS, Krimm was a three-sport star as a prep player. He was named all-conference as a junior and senior, leading the team in tackles (81), tackles for loss (11) and sacks (4) as a senior. He also claimed an interception, forced four fumbles and recovered two more en route to honorable mention all-state honors. Krimm also played running back and was awarded the school’s Iron Man Award. In lacrosse, Krimm helped his high school squad to the 2004 state championship. Personal: Augustine Walter Krimm is the son of John and Ann Krimm and has a younger sister and two younger brothers. He is enrolled in the College of AgricultureandLifeSciences.

S TEVE HYLAND Freshman Wide Receiver • 6-2 • 200 Islip, N.Y. • Choate Rosemary Hall Applied Economics and Management

At Choate Rosemary Hall: A three-year letter winner at Islip HS, Hyland spent a prep year at Choate Rosemary Hall last season. An all-conference wide receiver in 2003, he was named most valuable player of the Long Island championship game. He also was an allconference wrestler, lettering all four high school seasons. Personal: Steve Joseph Hyland is the son of Steven and Karen Hyland and has three younger sisters. He is enrolled in the College of AgricultureandLifeSciences.

FRANKKUNIS Freshman Defensive Line • 6-0 • 235 East Hanover, N.J. • Seton Hall Prep Economics

At Seton Hall Prep: Kunis earned first-team all-league and thirdteam all-state honors on the offensive line as a two-way player at SetonHallPrepin2004.Asteamcaptain,heledhissquadtoaleague title en route to all-county accolades. He was named to the Newark Star Ledger’s All-Junior offense team in 2003. Kunis was chosen to play in New Jersey’s East-West All-Star game at Rutgers.Personal: Fotios Kunis is the son of Frank and Suzanna Kunis and has a youngerbrother.HeisenrolledintheCollegeofArtsandSciences.

SHANEKILCOYNE

WWW .CORNELL B IG R ED . COM

Freshman Tailback • 5-11 • 187 San Diego, Calif. • Torrey Pines HS Applied Economics and Management

AtTorreyPines:Kilcoynewasafirst-teamall-leagueandall-county selectionin2004asasenioratTorreyPinesHS.Hefinishedtheyear with 1,116 yards rushing, 434 yards receiving and 16 total touchdowns. He also had 18 tackles and nine interceptions on defense. He was a third team all-state selection by Cal Hi Sports and earned academichonorsasanall-statescholarathlete,aNationalFootball Foundation and College Hall of Fame Scholar Athlete and a San Diego Union Tribune first team All-Scholastic selection. His 2003 and 2004 squads won the division title. Kilcoyne was selected to competeinCalifornia’sNorth-SouthAll-Stargame.Personal:Shane Robert Kilcoyne is the son of John and Susan Kilcoyne and has two younger sisters. His father is a 1981 Cornell graduate and former two-yearletterwinneronthegridironfortheBigRed.Heisenrolled intheCollegeofAgriculture andLifeSciences.

2005 FOOTBALL

TYLERLUCAS Freshman Quarterback • 6-2 • 204 Montgomery, Texas • Montgomery HS Human Biology, Health and Society

At Montgomery: Lucas completed 44-of-88 passes for 545 yards and three touchdowns as a senior, stepping into the quarterback role late in his senior season at Montgomery HS. He was named firstteam academic all-state by the Texas High School Coaches Associationasasenior.Personal:TylerLeeLucasisthesonofMikeand Wendy Lucas and has a younger brother. His father is the defensive coordinatoratSoutheasternLouisiana.HeisenrolledintheCollege of Human Ecology.

2005 OUTLOOK

AND

TEAM

M A T T LUNDY

NICKMAXWELL

Freshman Offensive Line • 6-2 • 292 Lancaster, Pa. • J.P. McCaskey HS Economics

Freshman Punter • 5-10 • 200 Lacey, Wash. • Timberline HS Computer Science

At McCaskey: Lundy opened up holes for McCaskey HS running backs all season as the team rushed for 1,900 yards in going 7-4 and earning a playoff berth in 2004. For his efforts, Lundy was named first-teamall-districtasaseniorafterearningsecond-teamhonors asajunior.Lundyalsohad37tacklesasadefensivelineman.Hewas invited to play in the Lancaster-Lebanon League/Tri-County AllStarFootballGameafterhisseniorseason.Healsoplayedlacrosse for three seasons. Personal: Matthew J. Lundy is the son of Edward and Eileen Lundy and has an older brother and sister, as well as a younger sister. He is enrolled in the College of Arts and Sciences.

At Timberline: Maxwell played quarterback and served as the punter at Timberline HS, earning second team all-league honors behind center by The Olympian. He averaged 40.1 yards per punt as a senior. He participated in the 2004 Northwest Kick It Camp, finishing fourth at the camp in punting average and first in hang time at the premier kicking and punting camp on the West Coast. A four-year starter, he was named 2004 first-team preseason AllAmericanatpunterbyProfessionalKickingServices(PKS),earning camp-wide outstanding punter honors at the PKS Summer Scholarship Development Camp after placing first in camp hang time and distance competitions for all levels. At quarterback, Maxwell was 20-2 as a varsity starter. He led his team to its first unbeaten regularseason(10-0)andfirstoutrightleaguechampionshipinthe school’s30-yearhistoryasajunior.Asasenior,Maxwellledhisteam to a 10-2 mark and finished with 15 touchdowns and 1,453 yards. He tossed for 27 touchdowns and only six interceptions in his varsitycareer,completing63.6percentofhispassesandaveraging 15.3 yards per completion. Personal: Nicholas Robert Maxwell is the son of Robert Maxwell and Kathy Bogucci and has a younger sister.HeisenrolledintheCollegeofArtsandSciences.

WILLIAM MACIAS Freshman Tight End • 6-3 • 215 North Bergen, N.J. • High Tech HS Undecided

At High Tech: Macias played several positions, including quarterback, as a three-year starter at North Bergen HS before graduating from High Tech HS. He was a two-team all-area pick, earning the team’s Offensive MVP award as a junior. Macias was a three-year starter in basketball at power forward and was a three-year allleague pick as a first baseman and pitcher in baseball. Personal: William C. Macias is the son of Guillermo and Marica Macias and has an older brother. He is enrolled in the College of Arts and Sciences.

M A T T MALLEO Freshman Defensive Back • 5-10 • 167 Manasquan, N.J. • The Hun School Hotel Administration

Freshman Linebacker • 6-2 • 235 Hood River, Ore. • Hood River Valley HS Mechanical and Aerospace Engineering

At Hood River Valley: McCarthy was an honorable mention allstate selection and the 2004 Conference Defensive Player of the Year as a linebacker at Hood River Valley HS. A first-team allconference pick at linebacker and second-team all-league selection at running back, McCarthy was a three-year letter winner in footballandalsoletteredtwiceinlacrosseandonceontheskiteam. McCarthy was a member of his high school’s honor roll and was inducted into his school’s chapter of the National Honor Society. Personal: Lucas McCarthy is the son of Michael and Susan McCarthy andhasanolderbrotherandsister.HeisenrolledintheCollegeof Engineering.

BRANTMcKOWN Freshman Safety • 5-10 • 195 Tampa, Fla. • Tampa Jesuit HS Industrial and Labor Relations

At Tampa Jesuit: McKown was a two-sport star at Tampa Jesuit HS and will play defensive back after a tremendous prep career. He led his team’s defense with 137 tackles, three sacks, an interception and a blocked punt while playing free safety. McKown was named to the all-county teams by the Tampa Tribuneand the St. Petersburg Times. The National Football Foundation Athlete of the Year added 23 receptions for 286 yards and a touchdown at wide receiver. He alsowasatremendousprepbaseballplayer,earningdistrictplayer of the year honors and being named to the Tampa Tribune and the St. Petersburg Times all-county teams. He was chosen to play in the county all-star game. Personal: Brant Joseph McKown is the son of Stuart and Lynette McKown and an older and younger sister. He is enrolled in the School of Industrial and Labor Relations. 2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

At The Hun School: Malleo intercepted seven passes in 2004 at The Hun School, most among prep school defensive backs to earn firstteamall-statehonors.Heledhisconferencewithsixinterceptions, returning one for a touchdown, as a senior at Wall HS in 2003 en route to earning first-team All-Jersey Shore honors. A two-year starter at Wall, Malleo added 40 tackles, five pass break-ups, a forced fumble, a fumble recovery to his interception total. Malleo was a big part of a defense that ranked third in the conference, helping the team to a league title and the 2002 squad that earned a state championship. Personal: Matthew Robert Malleo is the son of Michael and Beth Malleo and has an older brother and younger sister.Hisbrother,Chris,isasophomorequarterbackatNorthwestern. He is enrolled in the School of Hotel Administration.

L U C A S McCARTHY

2005 OUTLOOK 2005 K AWIKA NAKOA

Freshman Offensive Line • 6-1 • 287 Rothschild, Wis. • D.C. Everest HS Biological and Environmental Engineering

Sophomore Safety • 5-11 • 200 Honolulu, Hawaii • Iolani School Civil Engineering

At D.C. Everest: A three-year starter on the offensive line at D.C. Everest HS, Mortensen was a unanimous first-team all-league selection and was named first-team all-state by the Wisconsin Football Coaches Association. He was a second-team all-state pick by the Associated Press. The Brockmeyer Award nominee helped pave the way for 32 touchdowns as a senior, the most of any team in the league. He served as team captain in 2004 and received the team’s most valuable lineman award. Everest won the 2003 DivisionIstatetitle(14-0)andcompileda31-4recordinhisthreevarsity seasons. He did not allow a sack in his last two seasons as a starter and was called for just two penalties during that span with 93 pancake blocks. Mortensen was named one of the top 10 offensive linemen in Wisconsin by Wisconsin Preps, which also named him one of the top 40 junior football players in 2003. Personal: Justin Daniel Mortensen is the son of Dan and Cathy Mortensen and has anoldersisterandyoungerbrother.HeisenrolledintheCollegeof AgricultureandLifeSciences.

At Iolani: Nakoa was an honorable mention all-state selection as a senior at the Iolani School. Nakoa was a two-time all-league selection at defensive end and also played for the Hawaiian Warriors. He was selected to attend the National Federation of State High School Associations leadership conference. Personal: Kawika Nakoa is the son of Chucky and Sandra Nakoa and has an older sister and a younger brother. His father played football at Montana. Nakoa is enrolled in the College of Engineering.

Freshman Offensive Line • 6-5 • 327 Rochester, Mich. • Rochester Adams HS Undecided

At Rochester Adams: A two-year starter at center and a first-team all-statepickasasenior,Motamedihelpedleadhisteamtothe2003 state championship, while posting a 24-3 record in his two seasons ascaptain.Healsowasthelongsnapperandplayeddefensivetackle ingoal-linesituations.Motamediwasafirst-teamAll-DetroitMetro selection as a senior. Personal: Babak Omid Motamedi is the son of Mohammed and Rosemary Motamedi and has a younger sister. He is enrolled in the College of Arts and Sciences.

AARONMUMFORD Freshman Tailback • 6-0 • 175 Gresham, Ore. • San Barlow HS Economics

WWW .CORNELL B IG R ED . COM

TEAM

JUSTIN MORTENSEN

B A B A K MOTAMEDI

AND

At San Barlow: The conference Player of the Year as a senior, Mumford was a first-team all-state and all-league selection at running back at San Barlow HS. He helped his team to a league title as a senior. Mumford played in the Les Schwab Bowl after his senior campaign. He was a four-year member of his school’s honor roll and was chosen for induction to the National Honor Society for his effortsintheclassroom.Mumfordalsoplayedbasketballasaprep. Personal: Aaron Paul Mumford is the son of Joel and Cindy Mumford and has an older brother and a twin sister. His sister, Ali, will run track at Brown beginning in the fall He is enrolled in the College of Arts and Sciences.

2005 FOOTBALL

B RIAN OSTROWSKY Freshman Tailback • 6-1 • 203 Wyoming, Pa. • Bishop Hoban HS Applied Economics and Management

At Bishop Hoban: Ostrowsky rushed for 1,816 yards and 23 touchdowns as a senior at Bishop Hoban HS, where he became the school’s all-timeleadingrusher,tacklerandscorer.Ostrowskywasnamedfirstteamall-stateasalinebackerandwastheSuper33PlayeroftheYear in 2004. He was a UNICO senior all-star game selection, winning the game’smostvaluableplayeraward.Athree-timefirst-teamall-league pick,heplayedbothrunningbackandlinebacker.Atwo-starprospect according to Rivals.com, Ostrowsky was named to the 2004 AllEasternPAFootball.com Small School Team at running back. He was alsoanall-leagueselectioninbasketballandcompetedinbaseballand trackandfield. Personal:BrianChristopherOstrowskyisthesonof Ed and Marianne Ostrowsky and has two older sisters. He is enrolled intheCollegeofAgricultureandLifeSciences.

TOMPISELLI Freshman Quarterback • 6-1 • 224 Rockville Centre, N.Y. • South Side HS Communication

At South Side: Piselli was a first-team all-league and all-county selectionasasenioratSouthSideHS.Hewasselectedtoplayinthe Long Island Senior Bowl and was named to the Nassau County Golden 11 team and was a county scholar-athlete pick. Piselli was alsoastandoutlacrosseplayerandhelpedleadhishighschoolteam to the 2004 state championship as a three-year letter winner. He captained both teams as a senior. Personal: Thomas Andrew Piselli is the son of Robert and Mary Piselli and has an older sister and a youngerbrother.Hissister,Elizabeth,playslacrosseatStanford, whilehisfatherplayedfootballatPrinceton.Heisenrolledinthe CollegeofAgricultureandLifeSciences.

2005 OUTLOOK

AND

TEAM

G RAHAM RIHN

A LEX SPOONER

Freshman Defensive End • 6-2 • 240 Allison Park, Pa. • Pittsburgh Central Catholic HS Applied Economics and Management

Freshman Tight End • 6-1 • 227 Rocky River, Ohio • St. Edwards HS Biological Sciences

At Pittsburgh Central Catholic: Rihn was a first-team all-state selection according to Pennsylvania Football News as a senior at CentralCatholicHS.Hewasnamedfirst-teamAll-QuadEastandAllClass AAAA in 2004. The three-year starter recorded 74 tackles (10 for loss) and four sacks to go along with two fumble recoveries in 2004.Healsostartedatlefttackle,leadingthewayfora2,000-yard rusher. Rihn helped lead his team to WPIAL and PIAA Class AAAA championships. He was selected to play in the 48th annual Big 33 All-StarClassicthatpitsPennsylvaniaandOhiohighschoolsenior all-stars.Rihn’sCentralCatholicteamrankedsixthinthefinalUSA Today Super 25 high school poll and was the top-ranked squad in the East Region after going 16-0 in 2004, the first team in state historytorecord16wins.Hewasselectedtoseveralall-starteams asasenior,includingthePittsburghTribune-Review’sTerrific25,the Pittsburgh Post-Gazette’s Fabulous 22 team and the Harrisburg Patriot News’ Platinum 33 squad. Personal: Graham Gerard Rihn is the son of Thomas and Karen Rihn and has three older brothers. His brothers Chris and Jeff played soccer at Duquesne, He is enrolled intheCollegeofAgriculture andLifeSciences.

At St. Edwards: Spooner served as co-captain and earned allleague, all-county and all-district honors as a tight end at St. Edwards HS. He helped his team advance to the Division I regional semifinals in 2004 by catching 22 passes for 367 yards, three touchdowns and a two-point conversion. He was also named to the ClevelandPlainDealerall-areateam.Atremendousblockerfromthe tightendposition,hegradednearly90percentforhisblocking,had 20 knockdown blocks and also excelled as a long snapper. He was chosen to compete in the state’s East-West all-star game and was selectedforthescholar-athleteawardforNortheasternOhiobythe Ohio chapter of the National Football Foundation. Spooner was also a key figure on the 2003 team that finished as state runner-up. The two-year starter at tight end also played three seasons of basketball.Personal:AlexanderJamesSpooneristhesonofMichael and Sharon Spooner and has an older sister and younger brother. He is enrolled in the College of Agriculture and Life Sciences.

J ONATHAN RUCH Freshman Defensive Line • 6-2 • 216 Emmaus, Pa. • Allentown Central Catholic HS Undecided

AtAllentownCentralCatholic:Afirst-teamall-leagueselectionas a senior at Allentown Central Catholic HS, Ruch was a second team all-areapick.Thethree-yearvarsityletterwinnerwaschosentoplay in the Lehigh Valley All-Star Game after his senior season. Ruch servedasteamcaptainin2004.Hehelpedhisteamtoadistricttitle asajunior.Personal:JonathanWilliamRuchisthesonofFrederick andRuthRuchandhasanolderbrother.HeisenrolledintheCollege of Arts and Sciences.

A N T H O N Y SABO

At Detroit Catholic Central: Sabostartedatthreedifferentpositions(quarterback,runningbackandsafety)duringhisseniorseason atDetroitCatholicCentralHS,earningfirst-teamAll-CatholicLeague honors. Sabo was picked to the Division 1 Academic All-State team by the Michigan High School Football Coaches Association. A team captain as a senior, Sabo was an All-West second-team pick by the DetroitNewsandFreePress,wasnamedtotheAll-Observerfirstteam and was selected team most valuable player and best defensive back by the Catholic Central squad. He also started on the 2003 team that wontheDivisionIstatetitle. Personal: Anthony David Sabo is the son of Tony and Leslie Sabo and has an older sister. He is enrolled in the School of Industrial and Labor Relations.

Freshman Defensive Line • 6-3 • 277 Dallas, Texas • St. Mark’s HS Undecided

At St. Mark’s: Ranked among the top 100 recruits in the talent-rich DallasareaasasenioratSt.Mark’sHS,Stathaswasafirst-teamallconference selection in each of his final three years and was named theconference’stoplinemantwice.Heplayedontheoffensiveline, at defensive tackle and defensive end during his prep career. He is rated as a two-star prospect according to Rivals.com. He was also named one of the top 10 defensive linemen in the state by Dave Campbell’sTexasFootballNews.Stathasalsoletteredinbaseball, where he was a two-time all-conference pick as a first baseman on a team that won two league crowns. He was named team mostvaluableplayerasasenior.Personal:JohnJamesStathasisthe son of Steve and Jane Stathas. He is enrolled in the College of Arts and Sciences.

MARKTHOMPSON Sophomore Defensive Line • 6-1 • 219 Vineland, N.J. • Vineland HS Industrial and Labor Relations

At Vineland: A three-year starter as Vineland HS, Thompson served as team captain as a senior while playing on the offensive and defensive lines. He was named first-team all-league at defensive end and third-team all-league on the offensive line in 2003 and was a third-team pick as a junior as well. Thompson competed in the South Jersey Football Coaches Association Hall of Fame Game as asenior.Offthefield,heservedaspresidentofhisschool’schapter of the National Honor Society. Personal: Mark O. Thompson is the son of Bentley and Sandra Thompson and has an older sister. He is enrolled in the School of Industrial and Labor Relations.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Freshman Defensive Back • 5-11 • 194 Novi, Mich. • Detroit Catholic Central HS Industrial and Labor Relations

J OHN STATHAS

2005 OUTLOOK 2005 P ATRICK WU

Freshman Offensive Line • 6-5 • 297 Orland Park, Ill. • Carl Sandburg HS Undecided

Junior Offensive Line • 6-3 • 300 Dallas, Texas • Plano HS/Oregon State Applied Economics and Management

At Sandburg: Valenta was selected to play in the 2005 Illinois CoachesAssociationShrinersAll-StarFootballGameafterearning second-team all-state honors in his senior season at Carl Sandburg HS. He was an all-league and All-Metroland Chicago pick and was selectedtotheall-stateacademicteam.Valentawasratedasatwostar prospect according to Rivals.com. He also competed in basketball and baseball. Personal: Stephen Vincent Valenta is the son of ChristineValentaandhasanoldersister.HeisenrolledintheCollege ofEngineering.

At Oregon State: Wu joins the Big Red after spending two seasons atOregonStateasareserveontheoffensiveline.Hedidnotseeany action on the varsity squad. At Plano: Wu earned three letters and was a two-year starter at Plano HS. He was named first-team alldistrict as a senior and played in the Coca-Cola All-Star game. Scouting service Rivals.com ranked him among the top 50 recruits intheDallas-FortWortharea.Wuwasalsoafirstteamall-academic selection among Texas high school football players. Personal: Patrick H. Wu is the son of Heinz and Theresa Wu and has a sister. He is enrolled in the College of Agriculture and Life Sciences.

Freshman Wide Receiver • 6-2 • 199 Chenango Forks, N.Y. • Chenango Forks HS Human Biology, Health and Society

At Chenango Forks: A two-time state champion, Vredenburgh was afirst-teamall-stateselectionasajuniorandsenioratChenango Forks HS. A first-team Binghamton Press & Sun Bulletin All-Metro selection and an all-state scholar athlete, Vredenburgh was never on the losing end of a high school varsity game, going a perfect 260asatwo-waystarter(widereceiver/defensiveback).Vredenburgh owns the school record for most touchdown receptions in a game (three) and caught 18 passes for 335 yards and eight touchdowns as a senior. He also made 38 tackles on defense, returning two interceptions and a fumble for a touchdown. As a junior, he caught 20 passes for 445 yards and nine scores at receiver and made 77 tackles and posted eight sacks on defense. He also was a three-year letterwinnerinbothbasketballandbaseball.Heisafourthgeneration Cornellian. Personal: Zachary Donald Vredenburgh is the son of Donald and Pamela Vredenburgh and has older brothers and an older sister. His mom is a 1979 Cornell grad. He is enrolled in the College of Human Ecology.

WADEWOLOWIEC Freshman Defensive Line • 5-11 • 245 Wexford, Pa. • North Allegheny HS Biological Sciences

WWW .CORNELL B IG R ED . COM

TEAM

STEVEVALENTA

Z A C H VREDENBURGH

AND

At North Allegheny: A three-year starter at North Allegheny HS, Wolowiec was a two-time all-conference performer, including a first-teamselectionasajunior.Wolowiechad57tackles,10sacks, two blocked punts, two forced fumbles and two fumle recoveries in 2003. He was named to the pre-season Fabulous 22 team by the Pittsburgh Post-Gazette and received a Commonwealth of Pennsylvania House of Representatives citation for athletic accomplishment. Personal: Wade Chester Wolowiec is the son of John and Bonnie Wolowiec and has an older brother and sister. He is enrolled intheCollegeofAgriculture andLifeSciences.

2005 FOOTBALL

ROBZINGALE Freshman Offensive Line • 6-2 • 246 Hubbard, Ohio • Hubbard HS Economics

AtHubbard:Afirst-teamall-conference,all-cityandAll-Notheast Ohio selection as a senior at Hubbard HS, Zingale will be a welcome additiontotheoffensiveline.ThehonorablementionAll-Ohiopick helpedleadhisteamtoa26-3recordwithhiminthestartinglineup, making two playoff appearances and earning a league title in 2004. He was also valedictorian of his class. He was named the Channel 33 Student-Athlete of the Week. Personal: Robert James Zingale is the son of James and Jeanne Zingale and has an older sister. He is enrolled in the College of Arts and Sciences.

2005 OPPONENTS

WWW .CORNELL B IG R ED . COM

2005 Opponents 2005 FOOTBALL

2005 OPPONENTS 2005

Bucknell Bison

Game #1 • September 17 Schoellkopf Field (25,597) • Ithaca, N.Y. • 1 p.m. General Information

Location: ..... Lewisburg, Pa. Founded: ............ 1846 Enrollment: .......... 3,350 Colors: ..... Orange and Blue Nickname: ............ Bison Conference: ... Patriot League President: Dr. Brian C. Mitchell AthleticDir.: ... John P. Hardt

Bucknell Head Coach Tim Landis

Team Information

Media Relations

All-Time Record: .. 545-497-51 Basic Offense: . Spread Option Basic Defense: .......... 4-4 Lettermen R/L: ....... 33/24 Starters R/L: ......... 10/12 Off. Starters R/L: ........ 5/6 Def. Starters R/L: ........ 5/6

Football SID: ....... Jon Terry Office Phone: . (570) 577-1227 Home Phone: . (570) 522-0840 E-mail: .... terry@bucknell.edu SID Office Fax: . (570) 577-1660 Press Box: .... (570) 577-1519 or (570) 577-1522

Senior Defensive End Sean Conover

Coaching Staff Head Coach: ............................... Tim Landis Alma Mater: ....................... Randolph-Macon ‘86 Record at Bucknell: .................... 13-10, 3rd year Career Record: ...................... 66-62-1, 13th year Office Phone: ........................ (570) 577-1134 Assistant Coaches (Assignments): Brent Thompson ................... Quarterbacks/Fullbacks Tim Camp ............. Offensive Coordinator/Offensive Line Matt Lintal ............................. Wide Receivers Tripp Merritt . Assoc. Head Coach/Def. Coordinator/Linebackers Jared Backus ................. Defensive Line/Special Teams Steve Perry ............................. Defensive Backs TravisBurkett ............................ Defensive End Dick Cassels ............................. Offensive Line Ryan Crawford ...................... Outside Linebackers

2005 SCHEDULE

WWW .CORNELL B IG R ED . COM

Sept. 3 10 17 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (7-4, 4-2 Patriot, t-3rd)

...... G E O R G E T O W N ...... at Stony Brook .......... at Cornell ........... MARIST ............ at Penn ........ VILLANOVA ............ LEHIGH ........ at Lafayette ........ at Fordham ......... at Colgate ....... HOLY CROSS

at Villanova ..... L CORNELL ...... W COLUMBIA ..... W at Georgetown .. W PENN (2OT) ..... L LAFAYETTE ...... L at Lehigh ....... L at Holy Cross ... W F O R D H A M ..... W COLGATE ...... W at Duquesne .... W

www.BucknellBison.com Returning Statistical Leaders Rushing Class P. Kaufman Jr. J. DeStefano So.

Att 30 53

Yds 274 243

Avg 9.1 4.6

TD 4 0

Passing None

Att-Com-Int

Yds

Receiving Class J. DeStefano So. K. Davis Jr.

No 8 8

Avg 14.8 9.9

TD 0 1

Tackles D. Peterson S. Conover

UT-AT—Tot 55-34—89 33-22—55

Class

Class Jr. Sr.

2005 FOOTBALL

Yds 118 79

Other 7 TFL 18 TFL, 10.5 Sacks

.. .. .. .. .. .. .. .. .. .. ..

14-20 15-9 42-13 35-19 25-32 13-14 17-40 42-27 21-20 42-7 30-20

Christy Mathewson-Memorial Stadium Capacity: .................................. 13,100 Surface: ................................. FieldTurf Press Box: .......................... (570) 577-1519 or (570) 577-1522 Tickets: ............................ (570) 577-1000

Series Information 44 Games since 1888 Cornell leads 34-10 Current Streak: ..................... Bucknell, 1 game Last Cornell Win: ....................... 2003, 21-19 Last Bucknell Win: ....................... 2004, 15-9 Last Tie: .................................... none Last Shutout: .................... 1979, Bucknell 10-0 Longest Cornell Win Streak: ............ 23 (1892-1978) Longest Bucknell Win Streak: .. 2 (1979-80; 2000 & 2002) H/A W / L . C- B 1888 .. H .. W .. 20 -3 1889 .. H .. W .. 66 -0 1890 .. H .. W .. 26 -0 1891 .. H .. L ... 0 -4 1892 .. H .. W .. 54 -0 1896 .. H .. W .. 54 -0 1900 .. H .. W ... 6 -0 1901 .. H .. W ... 6 -0 1903 .. H .. W ... 6 -0 1904 .. H .. W .. 24 -12 1905 .. H .. W .. 24 -0 1906 .. H .. W .. 24 -6 1912 .. H .. W .. 14 -0 1913 .. H .. W .. 10 -7 1914 .. H .. W .. 48 -0 1915 .. H .. W .. 41 -0 1916 .. H .. W .. 19 -0 1917 .. H .. W .. 20 -0 1943 .. H .. W ... 7 -6 1944 .. H .. W .. 26 -0 1945 .. H .. W .. 19 -8 1946 .. H .. W .. 21 -0

H/A W / L . C- B 1960 .. H .. W .. 15 -7 1967 .. H .. W .. 23 -7 1974 .. H .. W .. 24 -0 1975 .. A .. W .. 21 -6 1978 .. H .. W .. 24 -0 1979 .. H .. L ... 0 -10 1980 .. A .. L .. 16 -33 1981 .. H .. W .. 22 -15 1984 .. A .. L ... 7 -10 1985 .. A .. W .. 26 -13 1986 .. H .. W .. 16 -3 1987 .. H .. L ... 6 -20 1989 .. A .. W .. 20 -9 1990 .. H .. L .. 21 -42 1991 .. A .. W .. 23 -7 1994 .. A .. W .. 29 -28 1995 .. H .. L ... 7 -10 1998 .. H .. W .. 23 -19 2000 .. A .. L .. 15 -38 2002 .. A .. L ... 3 -14 2003 .. H .. W .. 21 -19 2004 .. A .. L ... 9 -15

2005 OPPONENTS

Yale Bulldogs

Game #2 • September 24 Yale Bowl (64,269) • New Haven, Conn. • 1 p.m. General Information

Location: .. New Haven, Conn. Founded: ............ 1701 Enrollment: .......... 5,200 Colors: ... Yale Blue and White Nickname: ...... Bulldogs,Elis Conference: ...... Ivy League President: ... Richard C. Levin AthleticDir.: .... Tom Beckett

Yale Head Coach Jack Siedlicki

Team Information

Media Relations

All-Time Record: .. 826-320-55 Basic Offense: ...... Multiple Basic Defense: .......... 4-3 Lettermen R/L: ....... 35/31 Starters R/L: ......... 11/13 Off. Starters R/L: ........ 6/5 Def. Starters R/L: ........ 5/6

Football SID: ..... Steve Conn Office Phone: . (203) 432-1455 Home Phone: . (203) 393-9602 E-mail: .. steven.conn@yale.edu SID Office Fax: . (203) 432-1454 Press Box: .... (203) 764-9244 or (203) 764-9245

Coaching Staff Head Coach: ............................. JackSiedlicki Alma Mater: ................................ Union ‘74 Record at Yale: ....................... 43-36, ninth year Career Record: ...................... 99-58-2, 18th year Office Phone: ........................ (203) 432-8587 Assistant Coaches (Assignments): Keith Clark ............... Assoc. Head Coach/Offensive Line Rick Flanders ............ Defensive Coordinator/Linebackers Joel Lamb .............. Offensive Coordinator/Quarterbacks Duane Brooks ............................ Defensive Line LarryCiotti .............................. Running Backs Matthew Dence .............. Wide Receivers/Special Teams Jeff McDonald ............................ Defensive Ends Anthony Reno ........................... Defensive Backs Kyle Metzler ..................... Tight Ends/Offensive Line

2005 SCHEDULE Sept. 17 24 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (5-5, 3-4 Ivy, t-4th)

....... at San Diego .......... CORNELL ....... HOLY CROSS ....... D A R T M O U T H .......... at Lehigh ............ at Penn ........ at Columbia ........... B R O W N ........ at Princeton .......... HARVARD

at Dayton ...... W at Cornell ....... L COLGATE ...... W at Dartmouth ... W LEHIGH ......... L P E N N .......... L COLUMBIA ..... W at Brown ....... L PRINCETON .... W at Harvard ...... L

.. .. .. .. .. .. .. .. .. ..

24-17 7-19 31-28 24-14 24-30 7-17 21-14 17-24 21-9 3-35

Returning Statistical Leaders Rushing D. Knox J. Spence

Class Sr. Jr.

Att 84 13

Yds 430 37

Avg 5.1 2.8

TD 3 (2003stats) 0

Passing Jeff Mroz

Class Sr.

Att-Com-Int —

Yds —

TD — (missed 2004)

Receiving C. Henley A. Faherty

Class Sr. Sr.

No 48 15

Avg 14.9 12.3

TD 6 3

Tackles M. Handlon B. Dyches

Class Sr. Sr.

UT-AT—Tot 28-35—63 34-26—60

Yds 716 185

Other 2 INTs, 8 BrUp 14.5 TFL, 6.5 Sacks

12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012 12345678901234567890123456789012123456789012

Yale Bowl Capacity: .................................. 64,269 Surface: ............................. Natural Grass Press Box: .......................... (203) 764-9244 or (203) 764-9245 Tickets: ............................ (203) 432-1400

Series Information 67 Games since 1889 Yale leads 39-26-2 (29-20-0 in Ivy play) Current Streak: ...................... Cornell, 1 game Last Cornell Win: ........................ 2004, 19-7 Last Yale Win: ........................... 2003, 21-7 Last Tie: ................................ 1953, 0-0 Last Shutout: ..................... 1993, Cornell 21-0 Longest Cornell Win Streak: .............. 4 (1990-93) Longest Yale Win Streak: ................. 7 (1973-79) 1889 1889 1936 1937 1940 1941 1942 1944 1945 1946 1947 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971

H/A . W/L .. C- Y A ... L.... 6 -56 H ... L.... 0 -70 A ... L.... 0 -23 A ... L.... 0 -9 A ... W .. 21 -0 H ... W .. 21 -7 A ... W .. 13 -7 A ... L.... 7 -16 A ... L.... 7 -18 H ... T ... 6 -6 A ... L.... 0 -14 A ... W .. 48 -14 H ... W ... 7 -0 A ... W .. 27 -0 A ... L.... 0 -13 H ... T ... 0 -0 A ... L... 21 -47 A ... L.... 6 -34 A ... L.... 7 -25 H ... L.... 7 -18 A ... W .. 12 -7 H ... L.... 0 -23 A ... L.... 6 -22 H ... L.... 0 -12 A ... L.... 8 -26 H ... W .. 13 -10 H ... L... 21 -23 A ... L... 14 -24 H ... W .. 16 -14 A ... L.... 7 -41 H ... L... 13 -25 A ... L.... 0 -17 H ... L.... 7 -38 A ... W .. 31 -10

1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

H/A . W/L .. C- Y H ... W .. 24 -13 A ... L.... 3 -20 H ... L.... 3 -27 A ... L... 14 -20 A ... L.... 6 -14 H ... L.... 0 -28 A ... L... 14 -42 H ... L... 20 -23 A ... W .. 24 -6 H ... L... 17 -23 A ... W .. 26 -20 H ... W .. 41 -7 A ... L... 14 -21 A ... W .. 20 -14 H ... W .. 15 -0 A ... L.... 9 -28 H ... W .. 26 -0 A ... L... 19 -34 A ... W .. 41 -31 H ... W .. 31 -6 A ... W .. 35 -14 H ... W .. 21 -0 A ... L... 14 -24 H ... W .. 38 -10 A ... W .. 28 -20 H ... W .. 37 -10 A ... L... 21 -28 H ... L... 20 -37 H ... W .. 24 -23 A ... L... 13 -40 H ... L... 23 -50 A ... L.... 7 -21 H ... W .. 19 -7

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

www.YaleBulldogs.com

Senior Wide Receiver Chandler Henley

2005 OPPONENTS 2005

Colgate Raiders

Game #3 • October 1 Andy Kerr Stadium (10,221) • Hamilton, N.Y. • 1 p.m. General Information

Location: ..... Hamilton, N.Y. Founded: ............ 1819 Enrollment: .......... 2,800 Colors: Maroon, White and Gray Nickname: .......... Raiders Conference: ... Patriot League President: ... Rebecca Chopp AthleticDir.: .. David T. Roach

Colgate Head Coach Dick Biddle

Team Information

Media Relations

All-Time Record: .. 559-423-50 Basic Offense: ...... Multiple Basic Defense: ...... Multiple Lettermen R/L: ....... 27/23 Starters R/L: ......... 10/12 Off. Starters R/L: ........ 4/7 Def. Starters R/L: ........ 6/5

Football SID: .... Bob Cornell Office Phone: . (315) 228-7602 Home Phone: . (315) 824-3637 E-mail: rcornell@mail.colgate.edu SID Office Fax: . (315) 228-7977 Press Box: .... (315) 228-6863

Senior Linebacker Jared Nepa

Coaching Staff Head Coach: .............................. Dick Biddle Alma Mater: ................................ Duke ‘70 Record at Colgate: .................... 76-31, 10th year Career Record: ....................... 76-31, 10th year Office Phone: ........................ (315) 228-7603 Assistant Coaches (Assignments): Mike Foley ............. Offensive Coordinator/Offensive Line Ed Pinkham ............... Defensive Coordnator/Secondary Dan Hunt ................................ Quarterbacks Chris Young ............................ Wide Receivers KevinBolis .............................. Running Backs Ross Thoreson ............................ Defensive Line Robert Fraser .............................. Linebackers Nick Monroe ....................... Outside Linebackers

2005 SCHEDULE

WWW .CORNELL B IG R ED . COM

Sept. 3 10 17 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (7-4, 4-2 Patriot, t-3rd)

.... CENTRAL CONN. ... MASSACHUSETTS ....... at Dartmouth .......... CORNELL ........ at Princeton ......... F O R D H A M ....... at Holy Cross ............ LEHIGH ........ at Lafayette ......... BUCKNELL ...... at Georgetown

at Massachusetts . L D A R T M O U T H ... W G E O R G E T O W N .. W at Yale ......... L PRINCETON .... W at Cornell ...... W HOLY CROSS ... W at Lehigh ....... L LAFAYETTE ..... W at Bucknell ...... L at Fordham .... W

www.goColgateRaiders.com Returning Statistical Leaders Rushing R. LaMonica K. Parker

Class Sr. Jr.

Att 31 13

Yds 104 69

Avg 3.4 5.3

TD 0 0

Passing L. Sloan

Class So.

Att-Com-Int 28-14-1

Yds 115

TD 1

Receiving R. LaMonica G. Rose

Class Sr. So.

No 15 5

Avg 8.2 3.6

TD 0 0

Tackles J. Nepa G. Bean

Class Sr. Jr.

UT-AT—Tot 65-22—87 58-22—80

2005 FOOTBALL

Yds 123 18

Other 10 TFL, 3 INTs 6 INTs, 2 FF

.. .. .. .. .. .. .. .. .. .. ..

20-30 17-15 33-0 28-31 29-26 10-6 41-7 14-21 22-19 7-42 40-28

Andy Kerr Stadium Capacity: .................................. 10,221 Surface: ............................. Natural Grass Press Box: .......................... (315) 228-6863 Tickets: ............................ (315) 228-7600

Series Information 87 Games since 1896 Cornell leads 46-38-3 Current Streak: ..................... Colgate, 9 games Last Cornell Win: ........................ 1992, 25-7 Last Colgate Win: ........................ 2004, 10-6 Last Tie: ................................ 1965, 0-0 Last Shutout: ..................... 1968, Cornell 17-0 Longest Cornell Win Streak: ............ 10 (1896-1905) Longest Colgate Win Streak: .......... 9 (1993-present) 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1911 1912 1913 1914 1917 1919 1920 1921 1922 1923 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957

H/A . W/L Cor- C H ... W .... 6 -0 H ... W .... 6 -0 H ... W ... 29 -5 A ... W ... 42 -0 H ... W ... 16 -0 H ... W ... 17 -0 H ... W .... 5 -0 H ... W ... 12 -0 H ... W ... 17 -0 H ... W ... 12 -11 H ... T..... 0 -0 H ... W ... 18 -0 H ... W .... 9 -0 H ... W .... 6 -0 H ... L..... 7 -13 H ... T..... 0 -0 H ... L..... 3 -7 H ... L..... 0 -20 H ... L..... 0 -21 H ... W ... 42 -6 H ... W ... 31 -7 H ... W ... 14 -0 H ... W ... 34 -7 H ... W ... 40 -7 H ... W ... 15 -6 H ... W ... 14 -12 H ... W ... 34 -0 H ... W ... 21 -2 H ... L..... 6 -18 N ... L..... 7 -20 H ... L..... 7 -14 H ... W ... 20 -6 H ... W ... 13 -9 A ... W ... 27 -18 H ... W ... 14 -6 H ... W ... 39 -27 H ... W ... 26 -18 A ... W ... 41 -18 H ... L..... 7 -14 H ... W ... 27 -7 H ... L.... 14 -19 H ... L..... 6 -21 A ... L..... 6 -34 H ... L.... 13 -14

1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1990 1991 1992 1993 1996 1997 1999 2000 2001 2002 2003 2004

H/A . W/L Cor- C H ... W ... 13 -0 A ... W ... 20 -15 H ... L..... 8 -28 H ... W ... 34 -0 H ... L.... 12 -23 H ... L.... 17 -21 A ... L..... 3 -8 H ... T ..... 0 -0 H ... W ... 15 -14 A ... W ... 23 -7 H ... W ... 17 -0 H ... L.... 24 -28 A ... W ... 17 -7 H ... W ... 38 -20 H ... W ... 37 -7 A ... W ... 35 -21 H ... W ... 40 -21 H ... L.... 22 -24 H ... L.... 20 -25 H ... L.... 22 -28 A ... W ... 21 -12 H ... W ... 36 -21 A ... L.... 20 -38 H ... L.... 10 -34 H ... L..... 6 -21 H ... L..... 7 -60 H ... L..... 7 -35 H ... L.... 20 -21 A ... W ... 21 -12 H ... L..... 3 -27 H ... W ... 17 -14 A ... L.... 24 -59 H ... L.... 13 -31 A ... W ... 25 -7 H ... L..... 6 -22 H ... L.... 21 -31 H .. L-OT .. 38 -44 A ... L.... 16 -55 H ... L.... 16 -23 A ... L.... 32 -35 H ... L.... 13 -42 A ... L.... 24 -27 H ... L..... 6 -10

2005 OPPONENTS

Harvard Crimson Game #4 • October 8 Schoellkopf Field (25,597) • Ithaca, N.Y. • 1 p.m.

General Information Location: .. Cambridge, Mass. Founded: ............ 1636 Enrollment: .......... 6,704 Colors: Crimson, Black and White Nickname: ......... Crimson Conference: ...... Ivy League President: Lawrence H. Summers AthleticDir.: . Robert L. Scalise

Harvard Head Coach Tim Murphy

Team Information

Media Relations

All-Time Record: .. 767-363-50 Basic Offense: ..... Multiple Basic Defense: Multiple8-ManFront Lettermen R/L: ....... 27/19 Starters R/L: ......... 15/10 Off. Starters R/L: ........ 7/5 Def. Starters R/L: ........ 6/5

FootballSID: .... ChuckSullivan Office Phone: . (617) 495-2206 Home Phone: . (508) 824-1197 E-mail: . sulliv2@fas.harvard.edu SID Office Fax: . (617) 495-2130 Press Box: .... (617) 495-5902

Junior Running Back Clifton Dawson

Coaching Staff Head Coach: .............................. Tim Murphy Alma Mater: ............................ Springfield ‘78 Record at Harvard: .................... 66-43, 12th year Career Record: ...................... 98-88-1, 19th year Office Phone: ........................ (617) 495-2207 Assistant Coaches (Assignments): Kevin Doherty ...................... Defensive Coordinator Dave Cecchini ..................... Offensive Coordinator John Butler .............................. Special Teams EricWesterfield ................... Recruiting Coordinator Ron Crook .............................. Offensive Line Matt Cersosimo ......................... Wide Receivers Luke Thompson ..................... Outside Linebackers Patrick Kingman .......................... Defensive Line

2005 SCHEDULE Sept. 17 24 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (10-0, 7-0 Ivy, 1st)

....... at Holy Cross ........... B R O W N ............ LEHIGH .......... at Cornell ........ at Lafayette ........ PRINCETON ....... D A R T M O U T H ........ at Columbia ............. P E N N ............ at Yale

HOLY CROSS ... at Brown ...... at Lafayette .... CORNELL ...... NORTHEASTERN at Princeton .... at Dartmouth ... COLUMBIA ..... at Penn ........ YALE ..........

Returning Statistical Leaders Rushing C. Dawson R.Tyler

Class Jr. Sr.

Att 248 1

Yds 1302 35

Avg 5.2 35.0

TD 17 0

Passing None

Class

Att-Com-Int

Yds

Receiving C. Mazza R.Tyler

Class Jr. Sr.

No 51 22

Avg 15.2 21.6

TD 7 0

Tackles M. Thomas M. Berg

Class Jr. Jr.

UT-AT—Tot 35-47—82 24-14—38

Yds 773 216

Other 19 TFL, 8 Sacks 15 TFL, 6 Sacks

.. .. .. .. .. .. .. .. .. ..

35-0 35-34 38-23 34-24 41-14 39-14 13-12 38-0 31-10 35-3

Series Information 69 Games since 1890 Harvard leads 36-31-2 (24-23-2 in Ivy play) Current Streak: ..................... Harvard, 4 games Last Cornell Win: ....................... 2000, 29-28 Last Harvard Win: ....................... 2004, 34-24 Last Tie: ................................ 1983, 3-3 Last Shutout: .................... 2003, Harvard 27-0 Longest Cornell Win Streak: ............. 11 (1986-96) Longest Harvard Win Streak: ............ 10 (1890-1913) 1890 1892 1893 1894 1895 1896 1897 1909 1910 1913 1915 1916 1938 1941 1948 1949 1950 1951 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970

H/A . W/L .. C- H A ... L.... 0 -77 N ... L... 13 -20 N ... L.... 0 -34 N ... L... 12 -22 A ... L.... 0 -25 H ... L.... 4 -13 A ... L.... 5 -24 A ... L.... 0 -18 A ... L.... 5 -27 A ... L.... 6 -23 A ... W .. 10 -0 A ... L.... 0 -23 A ... W .. 20 -0 A ... W ... 7 -0 H ... W .. 40 -6 A ... W .. 33 -14 A ... W .. 28 -7 H ... W .. 42 -6 H ... L... 12 -13 A ... W .. 20 -7 H ... L.... 7 -32 A ... W .. 20 -6 H ... W .. 21 -14 A ... W .. 20 -16 H ... W .. 12 -0 A ... L.... 0 -14 H ... W .. 14 -12 A ... L... 14 -21 A ... L.... 0 -16 H ... T ... 3 -3 A ... L.... 0 -21 H ... L... 12 -14 A ... L.... 0 -10 H ... W .. 41 -24 A ... L... 24 -27

1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

H/A . W/L .. C- H H ... W .. 21 -16 A ... L... 15 -33 H ... L... 15 -21 A ... L... 27 -39 H ... L... 13 -34 A ... W ... 9 -3 H ... L.... 7 -17 A ... W .. 25 -20 H ... W .. 41 -14 A ... L... 12 -20 H ... L... 10 -27 A ... L... 13 -25 H ... T ... 3 -3 A ... L... 18 -24 H ... L... 17 -20 A ... W ... 3 -0 H ... W .. 29 -17 A ... W .. 19 -17 H ... W .. 28 -0 A ... W .. 20 -17 H ... W .. 22 -17 A ... W .. 31 -13 H ... W .. 27 -0 A ... W .. 18 -13 H ... W .. 28 -27 A ... W .. 20 -13 H ... L.... 9 -34 A ... L... 12 -19 H ... W .. 24 -23 A ... W .. 29 -28 H ... L.... 6 -26 A ... L... 23 -52 H ... L.... 0 -27 A ... L... 24 -34

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

www.gocrimson.com

W W W W W W W W W W

Harvard Stadium Capacity: .................................. 30,323 Surface: ............................. Natural Grass Press Box: .......................... (617) 495-5894 Tickets: ........................ 1-877-GO HARVARD

2005 OPPONENTS 2005

Georgetown Hoyas

12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789 12345678901234567890123456789

Game #5 • October 15 Schoellkopf Field (25,597) • Ithaca, N.Y. • 1 p.m. General Information

Location: ... Washington, D.C. Founded: ............ 1789 Enrollment: .......... 6,537 Colors: ........ Blue and Gray Nickname: ........... Hoyas Conference: ... Patriot League President: .... John J. DeGioia AthleticDir.: . Bernard M. Muir

Georgetown Head Coach Bob Benson

Team Information

Media Relations

All-Time Record: .. 453-319-31 Basic Offense: ...... Multiple Basic Defense: .......... 5-2 Lettermen R/L: ....... 67/29 Starters R/L: .......... 18/6 Off. Starters R/L: ........ 7/4 Def. Starters R/L: ........ 9/2

Football SID: .... Kevin Rieder Office Phone: . (202) 687-2492 Home Phone: . (202) 687-2491 E-mail: . kcr2@georgetown.edu SID Office Fax: . (202) 687-2491 Press Box: ............. TBA

Coaching Staff Head Coach: .............................. Bob Benson Alma Mater: ............................. Vermont ‘86 Record at Georgetown: ................ 68-57, 13th year Career Record: ................................ same Office Phone: ........................ (202) 687-2380 Assistant Coaches (Assignments): John Perry ......................... Associate Head Coach ElliotUzelac ....................... Offensive Coordinator Rob Sgarlata .......... Defensive Coordinator/Defensive Line Aaron Brady .............. Special Teams/Inside Linebackers Todd Wike .............................. Offensive Line Stanley Arnold .......................... Wide Receivers Rob Belli ................................ Running Backs Ralphel Clark ....................... Outside Linebackers Mike Mattia ................. Secondary/Video Coordinator

2005 SCHEDULE

WWW .CORNELL B IG R ED . COM

Sept. 3 10 17 24 Oct. 1 8 15 22 Nov. 5 12 19

2004 RESULTS (3-8, 0-6 Patriot, 7th)

......... at Bucknell ....... at Holy Cross ........... B R O W N ...... at Stony Brook ......... LAFAYETTE ........ DUQUESNE .......... at Cornell ......... F O R D H A M .......... at Lehigh ........ DAVIDSON .......... COLGATE

ST. FRANCIS (Pa.) W LAFAYETTE ...... L at Duquesne ..... L at Colgate ...... L BUCKNELL ...... L VMI .......... W at Monmouth .... L at Fordham ..... L LEHIGH ......... L at Davidson .... W HOLY CROSS (OT) . L

.. .. .. .. .. .. .. .. .. .. ..

www.guhoyas.com Returning Statistical Leaders Rushing K. Sarin E.Davis

Class Sr. So.

Att 207 82

Passing K. Allan

Class Jr.

Avg 5.1 3.4

TD 1 5

Att-Com-Int 59-21-7

Yds 187

TD 0

Receiving Class G. Castergine Sr. D. Saunders Sr.

No 18 10

Avg 13.9 12.4

TD 2 0

Tackles Class M. Hassan Sr. M. Ononibaku Sr.

UT-AT—Tot 57-45—102 39-25—64

2005 FOOTBALL

Yds 1,051 278

Yds 251 124

Other 7 TFL, 2 FF, 2 Sacks 18.5 TFL, 10.5 Sacks

36-7 6-17 7-45 0-33 19-35 21-0 10-27 6-36 18-49 23-0 28-31

Senior Defensive End Michael Ononibaku

123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123 123456789012345678901234567890121234567890123

Multi-Sport Field Capacity: ................................... 2,500 Surface: ................................. FieldTurf Press Box: ................................... TBA Tickets: ........................... (202) 687-HOYA

Series Information One Game since 2003 Georgetown leads 1-0 Current Streak: .................. Georgetown, 1 game Last Cornell Win: ............................. none Last Georgetown Win: ................... 2003, 42-20 Last Tie: .................................... none Last Shutout: ................................ none Longest Cornell Win Streak: .................... none Longest Georgetown Win Streak: ........ 1 (2003-pres.) H/A W / L . C- G 2003 .. H .. L .. 20 -42

2005 OPPONENTS

Brown Bears

Game #6 • October 22 Schoellkopf Field (25,597) • Ithaca, N.Y. • 1 p.m. General Information

Location: ..... Providence,R.I. Founded: ........... 1764 Enrollment: .......... 5,711 Colors: . Brown, Red and White Nickname: ........... Bears Conference: ...... Ivy League President: ... Ruth J. Simmons AthleticDir.: Michael Goldberger

Brown Head Coach Phil Estes

Team Information

Media Relations

All-Time Record: .. 541-519-40 Basic Offense: .......... Pro Basic Defense: ...... Multiple Lettermen R/L: ....... 45/12 Starters R/L: .......... 16/8 Off. Starters R/L: ........ 8/4 Def. Starters R/L: ........ 8/4

Football SID: .... Chris Humm Office Phone: . (401) 863-2219 Home Phone: . (401) 247-2392 E-mail: christopher_humm@brown.edu SID Office Fax: . (401) 863-1436 Press Box: .... (401) 751-2390 or (401) 751-3370

Senior Running Back Nick Hartigan

Coaching Staff Head Coach: ................................ PhilEstes Alma Mater: ....................... New Hampshire ‘81 Record at Brown: ...................... 42-27, 8th year Career Record: ................................ same Office Phone: ........................ (401) 863-2424 Assistant Coaches (Assignments): Michael Kelleher ......... Defensive Coordinator/Linebackers Abbott Burrell ......... Assistant Head Coach/Defensive Backs Frank Sheehan ......... Offensive Line/Recruiting Coordinator JoeLeslie .............................. Wide Receivers Neil McGrath ............................ Defensive Line Paul Boudreau .................. Tight Ends/Special Teams Paul Frisone ........................ Outside Linebackers Shaun Johnson ........................... Running Backs Jamie Casullo ........................... Defensive Backs

2005 SCHEDULE Sept. 17 24 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (6-4, 3-4 Ivy, t-4th)

...... at Georgetown ......... at Harvard ..... RHODE ISLAND ......... F O R D H A M ........ PRINCETON .......... at Cornell ............. P E N N ............ at Yale ....... D A R T M O U T H ........ at Columbia

ALBANY ....... W HARVARD ....... L at Rhode Island . W at Fordham (OT) W at Princeton ..... L CORNELL ...... W at Penn ......... L YALE .......... W at Dartmouth .... L COLUMBIA ..... W

Returning Statistical Leaders Rushing N. Hartigan A. Oyalowo

Class Sr. So.

Att 323 26

Yds 1,263 106

Avg 3.9 4.1

TD 17 0

Passing Class J. DiGiacomo Jr. A. Vita Jr.

Att-Com-Int 216-112-9 66-30-1

Yds 1,514 437

TD 4 4

Receiving J.Schreck L.Hill

Class Sr. Jr.

No 62 76

Avg 16.7 11.4

TD 3 5

Tackles Z. DeOssie T. Cotter

Class Jr. Sr.

UT-AT—Tot 55-43—98 33-28—61

Yds 1,035 896

Other 11.5 TFL, 2 INTs 4.5 TFL, 2.5 Sacks

35-7 34-35 20-13 27-20 10-24 21-17 16-20 24-17 7-20 33-21

Series Information 52 Games since 1895 Brown leads 26-25-1 (25-22-1 in Ivy play) Current Streak: ...................... Brown, 2 games Last Cornell Win: ................... 2002, 10-7 (2OT) Last Brown Win: ........................ 2004, 21-17 Last Tie: .............................. 1967, 14-14 Last Shutout: ..................... 1988, Cornell 35-0 Longest Cornell Win Streak: ............ 5 (1968-1972) Longest Brown Win Streak: ............... 8 (1973-80) H/A W / L . C- B 1895 .. H .. W ... 6 -4 1914 .. N .. W .. 28 -7 1955 .. A .. W .. 20 -7 1956 .. A .. L ... 6 -13 1957 .. H .. W .. 13 -6 1958 .. A .. L ... 8 -12 1959 .. H .. W .. 19 -0 1960 .. A .. L ... 6 -7 1961 .. H .. W .. 25 -0 1962 .. A .. W .. 28 -26 1963 .. H .. W .. 28 -25 1964 .. A .. L .. 28 -31 1965 .. H .. W .. 41 -21 1966 .. A .. W .. 23 -14 1967 .. H .. T .. 14 -14 1968 .. A .. W .. 31 -0 1969 .. H .. W .. 14 -7 1970 .. A .. W .. 35 -21 1971 .. H .. W .. 21 -7 1972 .. A .. W .. 48 -28 1973 .. H .. L ... 7 -17 1974 .. A .. L ... 8 -16 1975 .. H .. L .. 23 -45 1976 .. H .. L .. 12 -28 1977 .. A .. L ... 3 -21 1978 .. H .. L .. 13 -21

H/A W / L . C- B 1979 .. A .. L ... 7 -28 1980 .. H .. L .. 25 -32 1981 .. A .. W .. 14 -9 1982 .. H .. L .. 19 -38 1983 .. A .. L ... 3 -14 1984 .. H .. L ... 9 -13 1985 .. A .. L ... 0 -22 1986 .. H .. W .. 27 -9 1987 .. A .. L .. 15 -23 1988 .. H .. W .. 35 -0 1989 .. A .. L ... 7 -28 1990 .. H .. W .. 34 -7 1991 .. A .. W .. 20 -17 1992 .. H .. W .. 16 -6 1993 .. A .. W .. 21 -3 1994 .. H .. L ... 3 -16 1995 .. A .. W .. 38 -28 1996 .. H .. L .. 21 -35 1997 .. A .. L .. 12 -37 1998 .. H .. L ... 7 -20 1999 .. A .. W .. 33 -28 2000 .. A .. L .. 40 -56 2001 .. H .. L .. 21 -49 2002 .. A . W - O T . 10 -7 2003 .. H .. L ... 7 -21 2004 .. A .. L .. 17 -21

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

www.BrownBears.com

.. .. .. .. .. .. .. .. .. ..

Brown Stadium Capacity: .................................. 20,000 Surface: ............................. Natural Grass Press Box: .......................... (401) 751-2390 or (401) 751-3370 Tickets: ............................ (401) 863-2773

2005 OPPONENTS 2005

Princeton Tigers Game #7 • October 29 Princeton Stadium (27,800) • Princeton, N.J. • Noon General Information Location: ...... Princeton,N.J. Founded: ............ 1746 Enrollment: .......... 4,600 Colors: ..... Orange and Black Nickname: ........... Tigers Conference: ...... Ivy League President: ... Shirley Tilghman AthleticDir.: . Gary D. Walters

Princeton Head Coach Roger Hughes

Team Information

Media Relations

All-Time Record: .. 757-344-50 Basic Offense: ......... Pro 1 Basic Defense: .. Multiple Front Lettermen R/L: ....... 32/17 Starters R/L: .......... 17/8 Off. Starters R/L: ........ 8/4 Def. Starters R/L: ........ 7/4

FootballSID: .... Craig Sachson Office Phone: . (609) 258-3680 Home Phone: . (609) 712-2203 E-mail: . sachson@princeton.edu SID Office Fax: . (609) 258-2399 Press Box: .... (609) 258-0660

Senior Linebacker Justin Stull

Coaching Staff Head Coach: ............................ Roger Hughes Alma Mater: ............................... Doane ‘82 Record at Princeton: ................... 19-31, 6th year Career Record: ................................ same Office Phone: ........................ (609) 258-3514 Assistant Coaches (Assignments): Stan Clayton ............................ Offensive Line Don Dobes ............ Run Defense Coordinator/Linebackers EricJackson ................. Defensive Backs/Special Teams Dave Rackovan .......... Offensive Coordinator/Running Backs Scott Sallach ........................... Wide Receivers Eric Van Heusen .......................... Defensive Line Steve Verbit ........... Defensive Coordinator/Defensive Line Matt Borich ............................. Defensive Line Josh Nowocin ........................... Defensive Backs

2005 SCHEDULE

WWW .CORNELL B IG R ED . COM

Sept. 17 24 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (5-5, 3-4 Ivy, t-4th)

........ at Lafayette ........ SAN DIEGO ......... COLUMBIA .......... COLGATE .......... at Brown ......... at Harvard .......... CORNELL ............ at Penn .............. YALE ....... at Dartmouth

LAFAYETTE ..... W at San Diego ... W at Columbia (OT) W at Colgate ...... L B R O W N ....... W HARVARD ....... L at Cornell ....... L P E N N .......... L at Yale ......... L D A R T M O U T H ... W

.. .. .. .. .. .. .. .. .. ..

www.GoPrincetonTigers.com Returning Statistical Leaders Rushing G.Fields

Class Sr.

Att 26

Yds 169

Avg 6.5

TD 3

Passing None

Class

Att-Com-Int

Yds

Receiving Class G.Fields Sr. J. McCareins Sr. J. Dekker Sr.

No 49 21 13

Avg 10.4 9.0 8.2

TD 0 1 0

Tackles J.Stull A. Fadeyi

UT-AT—Tot 46-60—106 30-32—62

Class Sr. Sr.

2005 FOOTBALL

Yds 511 188 106

Other 7 TFL, 4 Sacks, 1 FF 8 TFL, 2 Sacks, 1 Int.

35-18 24-17 27-26 26-29 24-10 14-39 20-21 15-16 9-21 17-10

Princeton Stadium Capacity: .................................. 27,800 Surface: ............................. Natural Grass Press Box: .......................... (609) 258-0660 Tickets: ............................ (609) 258-3538

Series Information 87 Games since 1891 Princeton leads 53-32-2 (30-18-1 in Ivy play) Current Streak: ...................... Cornell, 1 game Last Cornell Win: ....................... 2004, 21-20 Last Princeton Win: ...................... 2003, 28-6 Last Tie: .............................. 1978, 14-14 Last Shutout: .................... 1998, Princeton 6-0 Longest Cornell Win Streak: .............. 4 (1970-73) Longest Princeton Win Streak: ............ 7 (1891-98) 1891 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1927 1928 1929 1930 1931 1932 1934 1935 1936 1937 1939 1943 1945 1946 1947 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961

H/A . W/L ... CA .... L ..... 0 N .... L ..... 0 N .... L ..... 4 N .... L ..... 0 A .... L ..... 0 H .... L ..... 0 A .... L ..... 0 H ... W ..... 5 A ... W .... 12 H .... L ..... 6 A .... L ..... 0 A .... L ..... 0 H .... L ..... 6 A .... L ..... 6 N .... L ..... 5 H ... W ..... 6 H .... L .... 10 A .... L ..... 0 H ... W .... 13 A ... W .... 12 H ... W .... 33 A .... T ..... 0 A .... L ..... 0 H .... L ..... 0 A .... L .... 13 A ... W .... 20 A ... W .... 20 A ... W .... 30 H .... L ..... 6 A ... W .... 14 A ... W .... 28 H ... W .... 14 A .... L ..... 0 A .... L .... 15 H .... L ..... 0 A ... W .... 26 A ... W .... 27 H .... L .... 20 H .... L .... 21 A .... L .... 14 H ... W .... 34 A .... L ..... 0 H .... L .... 18 A .... L .... 25

P -6 -46 -12 -6 -37 -10 -6 -0 -0 -8 -10 -44 -18 -16 -14 -5 -21 -3 -7 -7 -0 -0 -45 -54 -41 -7 -7 -0 -14 -7 -21 -12 -27 -53 -27 -19 -0 -26 -32 -47 -8 -20 -21 -30

1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

H/A . W/L ... CH ... W .... 35 A .... L .... 14 A .... L .... 12 H .... L .... 27 A .... L ..... 0 H ... W .... 47 A .... L .... 13 H .... L .... 17 A ... W ..... 6 H ... W .... 19 A ... W .... 22 H ... W .... 37 A .... L .... 20 H .... L ..... 8 H .... L ..... 0 A .... L ..... 0 H .... T .... 14 A .... L .... 14 H ... W .... 17 A .... L .... 14 H .... L .... 36 A ... W .... 32 H .... L ..... 9 A .... L .... 27 H ... W .... 39 A .... L ..... 6 H .... L .... 17 A .... L ..... 7 H ... W .... 17 A .... L ..... 0 H .... L .... 20 A .... L .... 12 H ... W .... 31 A .... L .... 22 H .. W-OT .. 33 H ... W .... 14 A .... L ..... 0 A ... W .... 20 H ... W .... 25 A ... W .... 10 H .. L-OT ... 25 A .... L ..... 6 H ... W .... 21

P -34 -51 -17 -36 -7 -13 -41 -24 -3 -8 -15 -6 -41 -16 -3 -34 -14 -26 -7 -37 -41 -30 -17 -33 -8 -23 -26 -21 -14 -18 -22 -18 -16 -24 -27 -10 -6 -3 -24 -7 -32 -28 -20

2005 OPPONENTS

Dartmouth Big Green Game #8 • November 5 Memorial Field (20,416) • Hanover, N.H. • 12:30 p.m. General Information Location: ...... Hanover, N.H. Founded: ............ 1769 Enrollment: .......... 4,300 Colors: ..... Green and White Nickname: ........ Big Green Conference: ...... Ivy League President: ..... James Wright AthleticDir.: .... Josie Harper

Dartmouth Head Coach Buddy Teevens

Team Information

Media Relations

All-Time Record: . 636-387-46 Basic Offense: ...... Multiple Basic Defense: ...... Multiple Lettermen R/L: ....... 34/28 Starters R/L: ......... 10/14 Off. Starters R/L: ........ 2/9 Def. Starters R/L: ........ 7/4

FootballSID: KathySlatteryPhillips Office Phone: . (603) 646-2468 Home Phone: . (603) 448-2103 E-mail: kathy.r.slattery@dartmouth.edu SID Office Fax: . (603) 646-1268 Press Box: .... (603) 646-2468

Senior Quarterback Charlie Rittgers

Coaching Staff Head Coach: ............................ Buddy Teevens Alma Mater: ............................ Dartmouth ‘79 Record at Dartmouth: ................ 26-22-2 (1987-91) Career Record: ...................... 60-99-2, 16th year Office Phone: ........................ (603) 646-2467 Assistant Coaches (Assignments): Cyril Brockmeier .......................... Offensive Line Mike Hodgson .............................. Tight Ends Adam Hollis ............................. Running Backs James Jones ............................. Defensive Line Sammy McCorkle ........................ Defensive Backs Matt Smiley ................ Kickers/Punters/Wide Receivers KiJuan Ware ........................ Asst. Defensive Backs Chris Wilkerson ........... Defensive Coordinator/Linebackers

2005 SCHEDULE Sept. 17 24 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (1-9, 1-6 Ivy, t-7th)

.......... COLGATE ... at New Hampshire ............. P E N N ............ at Yale ....... at Holy Cross ......... COLUMBIA ......... at Harvard .......... CORNELL .......... at Brown ........ PRINCETON

at Colgate ...... L NEW HAMPSHIRE . L at Penn ......... L YALE ........... L HOLY CROSS .... L at Columbia ..... L HARVARD ....... L at Cornell ....... L B R O W N ....... W at Princeton ..... L

.. .. .. .. .. .. .. .. .. ..

Returning Statistical Leaders Rushing C. Gaudet R. Rochester

Class So. Jr.

Att 99 34

Passing C.Rittgers

Class Sr.

Receiving R.Fuselier C. Ganske Tackles J. Dooley S. Jensen

Yds 389 106

Avg 3.9 3.1

TD 2 1

Att-Com-Int 320-170-14

Yds 1866

TD 8

Class Sr. Sr.

No 23 15

Avg 12.6 5.0

TD 0 0

Class Sr. Sr.

UT-AT—Tot 37-38—75 49-21—70

Yds 289 75

Other 5 TFL, 2 Sacks, 2 FF 5 TFL, 1 Int., 2 FR

Series Information 88 Games since 1900 Dartmouth leads 50-37-1 (35-14-0 in Ivy play) Current Streak: ...................... Cornell, 1 game Last Cornell Win: ........................ 2004, 14-7 Last Dartmouth Win: .................... 2003, 26-17 Last Tie: ................................ 1937, 6-6 Last Shutout: .................. 1976, Dartmouth 35-0 Longest Cornell Win Streak: .............. 5 (1950-54) Longest Dartmouth Win Streak: .......... 11 (1968-78) 1900 1912 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960

H/A . W/L ... CH ... W .... 23 H .... L ..... 0 N .... L ..... 0 N .... L ..... 3 N ... W .... 59 N ... W .... 23 A ... W .... 32 N .... L .... 14 A .... L .... 13 H ... W .... 24 A .... L ..... 7 H .... L ..... 0 A .... L .... 14 H .... L .... 13 A .... L ..... 0 H ... W .... 21 A ... W ..... 7 H ... W .... 21 A .... L ..... 6 H .... L ..... 6 A .... T ..... 6 H ... W .... 14 A ... W .... 35 A .... L ..... 0 H ... W .... 33 N ... W .... 21 N .... L ..... 0 H ... W .... 14 A ... W .... 20 H ... W .... 21 A .... L .... 13 H ... W .... 27 A .... L ..... 7 H ... W .... 24 A ... W .... 21 H ... W .... 13 A ... W .... 28 H ... W .... 40 A .... L ..... 0 H .... L .... 14 A .... L .... 19 H .... L .... 15 A .... L .... 12 H .... L ..... 0

D -6 -24 -9 -14 -7 -0 -7 -27 -62 -23 -53 -28 -18 -19 -14 -6 -0 -6 -41 -20 -6 -7 -6 -3 -19 -19 -20 -13 -13 -7 -21 -26 -16 -0 -13 -7 -26 -21 -7 -27 -20 -32 -21 -20

1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

H/A . W/L ... CA .... L .... 14 H .... L .... 21 A .... L ..... 7 H ... W .... 33 A .... L ..... 0 H .... L .... 23 A ... W .... 24 H .... L ..... 6 A .... L ..... 7 H .... L ..... 0 A .... L .... 14 H .... L .... 22 A .... L ..... 0 H .... L ..... 9 A .... L .... 10 H .... L ..... 0 A .... L .... 13 H .... L ..... 7 A ... W .... 21 H ... W ..... 7 A .... L ..... 7 H .... L .... 13 A .... L .... 17 H ... W .... 13 H .... L .... 17 A ... W .... 10 H ... W .... 21 A ... W .... 24 H .... L .... 14 H .... L ..... 6 A .... L .... 25 H ... W .... 26 A .... L .... 27 H ... W .... 17 A ... W .... 24 H .... L .... 21 A .... L .... 20 H ... W .... 14 A .... L .... 17 H ... W .... 49 A ... W .... 28 H ... W .... 21 A .... L .... 17 H ... W .... 14

D -15 -28 -12 -15 -20 -32 -21 -27 -24 -24 -24 -31 -17 -21 -33 -35 -17 -14 -10 -3 -42 -14 -31 -10 -20 -7 -14 -7 -28 -11 -31 -16 -28 -14 -19 -38 -24 -11 -20 -31 -24 -19 -26 -7

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

www.dartmouth.edu/athletics

15-17 24-45 0-35 14-24 0-24 6-9 12-13 7-14 20-7 10-17

Memorial Field Capacity: .................................. 20,416 Surface: ............................. Natural Grass Press Box: .......................... (603) 646-2468 Tickets: ............................ (603) 646-2466

2005 OPPONENTS 2005

Columbia Lions

Game #9 • November 12 Schoellkopf Field (25,597) • Ithaca, N.Y. • 1 p.m. General Information

Location: ..... New York, N.Y. Founded: ............ 1754 Enrollment: .......... 5,532 Colors: Columbia Blue and White Nickname: ............ Lions Conference: ...... Ivy League President: ...... Lee Bollinger AthleticDir.:Dr. M. Dianne Murphy

Columbia Head Coach Bob Shoop

Team Information

Media Relations

All-Time Record: .. 351-575-43 Basic Offense: ...... Multiple Basic Defense: .......... 4-3 Lettermen R/L: ....... 28/27 Starters R/L: ......... 10/15 Off. Starters R/L: ........ 3/9 Def. Starters R/L: ........ 7/6

FootballSID: ... Todd Kennedy Office Phone: . (212) 854-2534 Home Phone: ......... N/A E-mail: .. tk149@columbia.edu SID Office Fax: . (212) 854-8168 Press Box: .... (212) 304-8023

Senior Quarterback Joe Winters

Coaching Staff Head Coach: ............................... Bob Shoop Alma Mater: ................................. Yale ‘88 Record at Columbia: ................... 5-15, third year Career Record: ................................ same Office Phone: ........................ (212) 304-8023 Assistant Coaches (Assignments): Rich Skrosky ............ Offensive Coordinator/Offensive Line Tim Weaver ........... Defensive Coordinator/Defensive Line Carlton Hall ............................ Wide Receivers Scott Larkee .......................... DefensiveAssistant Pat Madden ........................ Defensive Secondary Bob Muckian ............................... Tight Ends Sean Ryan ............................... Quarterbacks Mike Siravo ............. Linebackers/Recruiting Coordinator Shawn West ............................. Running Backs

2005 SCHEDULE

WWW .CORNELL B IG R ED . COM

Sept. 17 24 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (1-9, 1-6 Ivy, t-7th)

........ at Fordham ........ DUQUESNE ........ at Princeton ........ at Lafayette ............. P E N N ....... at Dartmouth .............. YALE .......... HARVARD .......... at Cornell ........... B R O W N

F O R D H A M ...... L at Bucknell ...... L PRINCETON (OT) . L LAFAYETTE ...... L at Penn ......... L D A R T M O U T H ... W at Yale ......... L at Harvard ...... L CORNELL ....... L at Brown ....... L

.. .. .. .. .. .. .. .. .. ..

14-17 13-42 26-27 14-35 3-14 9-6 14-21 0-38 26-32 21-33

www.GoColumbiaLions.com Returning Statistical Leaders Rushing G. Radlein M. DeFazio

Class Sr. Sr.

Yds 24 11

Avg 4.8 5.5

TD 0 0

Passing Class C. Hormann So. J.Winters Sr.

Att-Com-Int 38-19-2 —

Yds 207 —

TD 1 — did not play in 2004

Receiving Class B. Bowser Sr. N. DeGasperis Jr.

No 51 25

Avg 11.4 7.4

TD 4 1

Tackles T. Crawford K. Shaw

UT-AT—Tot 53-41—94 37-25—62

Class Jr. Sr.

2005 FOOTBALL

Att 5 2

Yds 583 184

Other 1Int.,1Block 6TFL,2Int.

Lawrence A. Wien Stadium Capacity: .................................. 17,000 Surface: ................................. FieldTurf Press Box: .......................... (212) 304-8023 Tickets: ............................ (212) 854-2546

Series Information 92 Games since 1889 Cornell leads 58-31-3 (33-16-0 in Ivy play) Current Streak: ...................... Cornell, 1 game Last Cornell Win: ....................... 2004, 32-26 Last Columbia Win: ..................... 2003, 34-21 Last Tie: ................................ 1935, 7-7 Last Shutout: ..................... 1990, Cornell 41-0 Longest Cornell Win Streak: ............. 12 (1977-88) Longest Columbia Win Streak: ..... 3 (1903-05, 1932-34, 1960-62, 1992-94) 1889 1890 1899 1901 1903 1904 1905 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930 1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958

H/A . W/L . Cor.A ... W .... 20 H ... W .... 36 A ... W .... 29 A ... W .... 24 H .... L .... 12 A .... L ..... 6 H .... L ..... 6 H ... W .... 34 A ... W .... 41 H ... W .... 56 A ... W .... 35 H ... W .... 14 N ... W .... 17 A .... L ..... 9 H .... T ..... 0 A .... T ..... 0 H ... W .... 12 A .... L ..... 7 H ... W .... 13 A .... L ..... 0 H .... L ..... 6 A .... L ..... 0 H .... T ..... 7 A .... L ..... 6 H ... W .... 34 A ... W .... 23 H ... W .... 13 H ... W .... 27 A .... L ..... 0 A .... L .... 13 H ... W .... 33 A ... W .... 25 A .... L .... 26 A ... W .... 12 H .... L ..... 0 A ... W .... 20 H ... W .... 54 A .... L .... 19 H .... L .... 20 A ... W .... 21 H ... W .... 27 A ... W .... 26 H ... W .... 34 A .... L .... 19 H ... W ..... 8 A ... W .... 25

Col. -0 -0 -0 -0 -17 -12 -12 -7 -7 -0 -0 -0 -14 -17 -0 -0 -6 -10 -0 -6 -9 -14 -7 -14 -20 -7 -7 -0 -7 -14 -6 -7 -34 -0 -22 -13 -0 -20 -21 -14 -13 -0 -19 -25 -0 -0

1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

H/A . W/L . Cor.H ... W .... 13 A .... L ..... 6 H .... L ..... 7 A .... L .... 21 H ... W .... 18 A ... W .... 57 H ... W .... 20 A ... W .... 31 H ... W .... 27 A .... L .... 25 H ... W .... 10 A ... W .... 31 H ... W .... 24 A .... L ..... 0 H ... W .... 44 A ... W .... 24 H .... L .... 19 A .... L .... 17 H ... W .... 20 A ... W .... 35 H ... W .... 24 A ... W .... 24 H ... W .... 15 A ... W .... 35 H ... W .... 31 A ... W .... 19 H ... W .... 21 A ... W .... 28 H ... W .... 31 A ... W .... 42 H .... L .... 19 A ... W .... 41 H ... W .... 28 A .... L .... 30 H .... L .... 24 A .... L .... 33 H ... W .... 35 A .... L .... 10 H ... W .... 33 A .... L .... 10 H ... W .... 31 A ... W .... 35 H .... L .... 28 A ... W .... 17 H .... L .... 21 A ... W .... 32

Col. -7 -44 -35 -25 -17 -20 -6 -6 -14 -34 -3 -20 -21 -14 -14 -0 -42 -35 -7 -14 -7 -0 -9 -26 -6 -7 -8 -0 -20 -19 -25 -0 -21 -35 -29 -38 -14 -24 -22 -22 -29 -31 -35 -14 -34 -26

2005 OPPONENTS

Penn Quakers

Game #10 • November 19 Franklin Field (52,958) • Philadelphia, Pa. • Noon General Information

Location: .... Philadelphia, Pa. Founded: ............ 1740 Enrollment: ......... 10,500 Colors: ........ Red and Blue Nickname: ......... Quakers Conference: ...... Ivy League President: .. Dr. Amy Gutmann AthleticDir.: ..... SteveBilsky

Penn Head Coach Al Bagnoli

Team Information

Media Relations

All-Time Record: .. 771-440-42 Basic Offense: Multiple one-back Basic Defense: ........... 50 Lettermen R/L: ....... 40/20 Starters R/L: ......... 10/15 Off. Starters R/L: ........ 6/5 Def. Starters R/L: ........ 2/9

Football SID: ..... Mat Kanan Office Phone: . (215) 573-4125 Home Phone: . (215) 687-5548 E-mail: mkanan@pobox.upenn.edu SID Office Fax: . (215) 898-1747 Press Box: .... (215) 898-6159

Senior Running Back Sam Mathews

Coaching Staff Head Coach: ............................... Al Bagnoli Alma Mater: ................ Central Connecticut State ‘75 Record at Penn: ...................... 94-34, 14th year Career Record: ...................... 180-53, 24th year Office Phone: ........................ (215) 573-9229 Assistant Coaches (Assignments): Ray Priore ......................... Defensive Coordinator Andy Coen ........................ Offensive Coordinator Jim Schaefer ............................. Defensive Line Larry Woods .............................. Quarterbacks Steve Downs ............................ Running Backs Cliff Schwenke ............................. Linebackers Trey Brown ............................. Wide Receivers Brett Sawyer ............................... Tight Ends Shawn Daignault ........................ Defensive Backs

2005 SCHEDULE Sept. 17 24 Oct. 1 8 15 22 29 Nov. 5 12 19

2004 RESULTS (8-2, 6-1 Ivy, 2nd)

........ DUQUESNE ........ at Villanova ....... at Dartmouth ......... BUCKNELL ........ at Columbia .............. YALE .......... at Brown ........ PRINCETON ......... at Harvard .......... CORNELL

at San Diego ... W VILLANOVA ..... L D A R T M O U T H ... W at Bucknell (OT) . W COLUMBIA ..... W at Yale ........ W B R O W N ....... W at Princeton .... W HARVARD ....... L at Cornell ...... W

Returning Statistical Leaders Rushing S. Mathews K. Ambrogi

Class Sr. Sr.

Att 178 64

Yds 716 231

Avg 4.0 3.6

TD 7 2

Passing Class P. McDermott Sr.

Att-Com-Int 294-159-5

Yds 1995

TD 12

Receiving S. Mathews M. Carre

Class Sr. Jr.

No 32 21

Avg 8.8 14.7

TD 0 1

Tackles K. Gedin M. Johns

Class Jr. Sr.

UT-AT—Tot 41-20—61 36-13—49

Yds 314 308

Other 4.5 TFL 1Int.

61-18 13-16 35-0 32-25 14-3 17-7 20-16 16-15 10-31 20-14

Series Information 111 Games since 1893 Penn leads 64-42-5 (Cornell leads 25-23-1 in Ivy play) Current Streak: ....................... Penn, 5 games Last Cornell Win: ....................... 1999, 20-12 Last Penn Win: ......................... 2004, 20-14 Last Tie: .............................. 1974, 28-28 Last Shutout: ....................... 2002, Penn 31-0 Longest Cornell Win Streak: .............. 7 (1961-67) Longest Penn Win Streak: ....... 8 (1893-1900; 1940-47) 1893 1894 1895 1896 1897 1898 1899 1900 1901 1902 1903 1904 1905 1906 1907 1908 1909 1910 1911 1912 1913 1914 1915 1916 1917 1919 1920 1921 1922 1923 1924 1925 1926 1927 1928 1929 1930

H/A W/L CA .. L .. 0 A .. L .. 0 A .. L .. 2 A .. L . 10 A .. L .. 0 A .. L .. 6 A .. L .. 0 A .. L .. 0 A .. W . 23 A .. L . 11 A .. L .. 0 A .. L .. 0 A .. L .. 5 A .. T .. 0 A .. L .. 4 A .. L .. 4 A .. L .. 6 A .. L .. 6 A .. L .. 9 A .. L .. 2 A .. W . 21 A .. W . 24 A .. W . 24 A .. L .. 3 A .. L .. 0 A .. L .. 0 A .. L .. 0 A .. W . 41 A .. W .. 9 A .. W . 14 A .. L .. 0 A .. L .. 0 A .. T . 10 A .. L .. 0 A .. L .. 0 A .. L .. 7 A .. W . 13

P -50 -6 -46 -32 -4 -12 -29 -27 -6 -12 -42 -34 -6 -0 -12 -17 -17 -12 -21 -7 -0 -12 -9 -23 -37 -24 -28 -0 -0 -7 -20 -7 -10 -35 -49 -17 -7

1931 1932 1933 1934 1935 1936 1937 1938 1939 1940 1941 1942 1943 1944 1945 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967

H/A W/L CA .. W .. 7 A .. L .. 7 A .. W . 20 A .. L . 13 A .. L .. 7 A .. L .. 6 A .. W . 34 A .. T .. 0 A .. W . 26 A .. L . 20 A .. L .. 0 A .. L .. 7 A .. L . 14 A .. L .. 0 A .. L .. 6 A .. L . 20 A .. L .. 0 A .. W . 23 A .. W . 29 A .. W . 13 A .. L .. 0 A .. L .. 7 A .. T .. 7 A .. W . 20 A .. W . 39 A .. W . 20 A .. L .. 6 A .. W . 19 A .. L . 13 A .. L .. 7 A .. W . 31 A .. W . 29 A .. W . 17 H .. W . 33 A .. W . 38 H .. W . 45 A .. W . 33

P -0 -13 -12 -23 -33 -14 -20 -0 -0 -22 -16 -34 -20 -20 -59 -26 -21 -14 -21 -6 -7 -14 -7 -6 -7 -7 -14 -7 -28 -18 -0 -22 -8 -0 -14 -28 -14

1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

H/A W/L CH .. L .. 8 A .. W . 28 H .. W . 32 A .. W . 41 H .. W . 24 A .. L . 22 H .. T . 28 A .. L . 21 H .. W . 31 A .. L .. 7 H .. W . 35 A .. W . 52 H .. W . 31 A .. L . 22 H .. W . 23 A .. L .. 7 H .. L .. 0 A .. L .. 6 H .. L . 21 A .. W . 17 H .. W . 19 A .. W . 20 H .. W . 21 A .. L . 13 H .. L .. 7 A .. L . 14 H .. L . 14 A .. L . 18 H .. W . 24 A .. W +20 H .. L . 21 A .. W . 20 H .. L . 15 A .. L . 14 H .. L .. 0 A .. L .. 7 H .. L . 14

P -10 -14 -31 -13 -20 -31 -28 -27 -13 -17 -17 -13 -9 -29 -0 -28 -24 -10 -31 -13 -6 -6 -15 -14 -14 -17 -18 -37 -21 -33 -35 -12 -45 -38 -31 -59 -20

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

www.PennAthletics.com

.. .. .. .. .. .. .. .. .. ..

Franklin Field

Capacity: .................................. 52,598 Surface: ................................. Sprinturf Press Box: .......................... (215) 898-6159 Tickets: ............................ (215) 898-6151

2005 OPPONENTS 2005

Cornell vs. All Opponents â&#x20AC;˘ 1887-2004 First Game 1922 1903 1911 1890 1907

Last Game 1932 1936 1911 1908 1948

W 2 3 1 1 2

L 0 0 0 1 3

T 0 0 0 0 0

Cor. Pts. 88 154 35 6 94

Opp. Pts. 28 0 0 18 111

2 1 52 44 6

1982 1906 1895 1888 1898

1983 1906 2004 2004 1998

0 2 1 0 25 26 34 10 4 1

0 0 1 0 1

6 72 979 906 194

58 0 965 368 102

Canisius 1 CarlisleIndians 5 Carnegie Tech 3 Case Western 6 ChicagoUniversity 5 Chicago U.C. 2 Cincinnati 1 Clarkson Tech 5 Colgate 87 Columbia 92 CrescentAthleticClub 1

1925 1898 1916 1895 1899 1890 1983 1927 1896 1889 1894

1925 1914 1919 1935 1911 1891 1983 1931 2004 2004 1894

1 0 3 2 3 0 5 1 1 2 1 1 0 1 5 0 46 38 58 31 1 0

0 0 0 0 2 0 0 0 3 3 0

33 0 67 23 55 7 266 37 36 35 16 20 20 48 255 0 1,542 1,366 2,002 1,266 22 0

Dartmouth 88 DetroitAthleticClub 1 Dickinson 1

1900 1891 1892

2004 1891 1892

37 50 1 0 1 0

1 0 0

1,383 1,669 32 0 58 0

Fordham 6 Forty-SeventhInfantry 1 Franklin & Marshall 2

1909 1917 1904

1999 1917 1914

4 0 2

2 1 0

0 0 0

160 0 62

78 6 8

Geneva Georgetown Gettysburg

1 1 2

1926 2003 1893

1926 2003 1916

1 0 2

0 1 0

0 0 0

6 20 55

0 42 0

8 3 69 1 6 5

1898 1928 1890 1905 1902 1906

1908 1930 2004 1905 1930 1998

8 0 3 0 31 36 1 0 6 0 5 0

0 0 2 0 0 0

1923

24 24

1888 1887

1997 2001

14 14

8 8

2 2

460 518

308 295

ManhattanAthleticClub 1 MIT 1 MassachusettsSt. 1 Merchant Marine 1 Michigan 18 Michigan State 1

1892 1892 1916 1982 1889 1926

1892 1892 1916 1982 1952 1926

1 1 1 1 12 1

0 0 0 0 6 0

0 0 0 0 0 0

16 44 37 34 379 24

0 12 0 0 254 14

Navy 10 New Hampshire 1 New York University 2 Niagara 13 Northeastern 1

1941 1922 1912 1906 1989

1962 1922 1948 1949 1989

1 1 2 13 0

9 0 0 0 1

0 0 0 0 0

59 68 61 424 0

296 7 12 38 20

Oberlin Ohio State

15 2

1898 1939

1919 1940

13 2

1 0

324 44

61 21

Palmyra Penn State Penn Pittsburgh Princeton

1 14 111 6 87

1888 1895 1893 1905 1891

1888 1943 2004 1914 2004

1 0 8 4 42 64 4 2 32 53

0 2 5 0 2

Opponent Albright Alfred Allegheny Amherst Army

Games 2 3 1 2 5

BostonUniversity Bowdoin Brown Bucknell Buffalo

Hamilton Hampden-Sydney Harvard Haverford Hobart Holy Cross Johns Hopkins

WWW .CORNELL B IG R ED . COM

Lafayette Lehigh

2005 FOOTBALL

186 0 105 18 1,064 1,282 57 0 225 0 129 44

26 0 187 104 1,587 2,051 90 37 1,228 1,695

First Game 1909 1953 1927 1889 1920

Last Game 1910 1954 1934 1921 1981

W 2 0 4 9 5

L 0 2 1 0 6

T 0 0 0 0 0

Cor. Pts. 40 27 135 417 204

Opp. Pts. 3 69 13 12 212

St. Bonaventure 9 St. Lawrence 3 Springfield 1 Stanford 1 StevensInstitute 2 Susquehanna 3 Swarthmore 3 SyracuseAthleticClub 1 Syracuse 33

1910 1933 1921 1991 1889 1923 1905 1892 1891

1928 1935 1921 1991 1891 1925 1907 1892 1958

7 0 2 1 1 0 0 1 2 0 3 0 2 1 1 0 22 11

2 0 0 0 0 0 0 0 0

342 68 14 6 110 255 46 16 696

25 19 0 56 4 0 14 0 341

Towson Trinity Tufts

2 3 3

2002 1890 1893

2004 1908 1897

1 3 2

1 0 1

0 0 0

45 91 33

52 6 12

Union U.S.N.T.S. (Sampson) U.S.S.B. (New London) Ursinus

9 2 1 2

1887 1943 1945 1913

1920 1944 1945 1914

8 2 1 2

1 0 0 0

0 0 0 0

263 40 39 69

30 19 0 0

Vermont VirginiaTech

5 1

1900 1915

1910 1915

5 1

0 0

150 45

5 0

Wagner 1 Washington & Jefferson 4 Washington & Lee 1 Wesleyan 1 Williams 21

1999 1900 1915 1890 1888

1999 1912 1915 1890 1926

1 4 1 0 13

0 0 0 1 5

0 0 0 0 3

31 75 40 2 423

14 5 21 4 127

Yale

1889

2004

26 39

Opponent Rensselaer RiceInstitute Richmond Rochester Rutgers

Games 2 2 5 9 11

Note: 2005 opponents are indicated in bold. Total games: 1,064 Record: 594-436-34 Cornell points: 20,793 Opponent points: 15,217

Opponent Records Most games vs. one opponent: 111, vs. Penn Most wins vs. one opponent: 58, vs. Columbia Most losses vs. one opponent: 64, vs. Penn Most ties vs. one opponent: 5, vs. Penn Oldest series: Lehighâ&#x20AC;&#x201D;1st game in 1887 and last game in 2001 Number of opponents: 86

1,019 1,330

2004 IN REVIEW/IVY LEAGUE

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

2004 In Review/Ivy League

2004 IN REVIEW/IVY LEAGUE

2004 Statistics * * * * * * *

DATE

OPPONENT

SCORE

Sep 18 Sep 25 Oct 2 Oct 9 Oct 16 Oct 23 Oct 30 Nov 6 Nov 13 Nov 20

at Bucknell YALE at Towson at Harvard COLGATE at Brown PRINCETON DARTMOUTH at Columbia PENN

9-15 19-7 11-21 24-34 6-10 17-21 21-20 14-7 32-26 14-20

W W W

ATTEND L

6,702 11,835 2,522 13,334 12,168 9,310 5,842 5,012 4,020 4,242

L L L L

* denotes conference game TEAM STATISTICS

Cornell

Opp

First Downs ................. 155 160 by Rushing-Passing-Penalty . 57-88-10 63-89-8 Rushing Yards/Game ......... 93.7 101.1 Rushes .................... 372 351 Yards Gained .............. 1283 1320 Yards Lost ................. 346 309 Net Yards .................. 937 1011 Avg. Gain/Play .............. 2.5 2.9 TDs Rushing ................ 12 9 Passing Yards/Game ......... 217.2 227.6 Passes Att-Comp-Int .... 342-176-11 320-174-9 Completion Percentage ....... .515 .544 Passing Yards .............. 2172 2276 Average Per Catch .......... 12.3 13.1 Passing Efficiency ......... 106.10 123.96 TDs Passing ................. 8 15 Total Offense/Game ......... 310.9 328.7 Total Offensive Plays/Yards 714-3109 671-3287 Avg. Gain/Play .............. 4.4 4.9 Punting Average ............ 35.5 36.4 Punts-Yards-Blocked ..... 69-2449-0 71-2584-1 Net Punting ............... 33.1 32.7 Punt Return Average .......... 7.4 6.3 Punts Returned-Yards ...... 35-260 26-165 Kick Return Average .......... 20.6 20.0 Kicks Returned-Yards ....... 36-741 26-519 Interceptions-Yards ......... 9-101 11-88 Fumbles-Lost ............... 13-4 16-11 Fumble Returns-Yards ....... 11-61 4-0 Penalties-Yards ............ 63-506 49-431 QB Sacks By-Yards ......... 23-142 27-165 3rd Down Conversions . 63-177 (36%) 46-151 (30%) 4th Down Conversions ... 5-16 (31%) 8-19 (42%) Time of Possession (Average) .. 31:03 28:57 Attendance-Average ... 39,099-7,820 35,888-7,178 Scoring

Cornell Opponents

20 34

46 57

41 29

60 61

0 0

WWW .CORNELL B IG R ED . COM

Scoring

FGs

Att-Com-Int

0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 1-0 0-0 1-1 2-4

0 0 0 0 0 0 0 0 0 0 0 0 0 0

531 388 204 19 12 12 7 4 0 102 4 1283 1320

56 40 114 2 1 3 0 1 0 110 19 346 309

Receiving

Rec

Yds

Avg

Brian Romney ....... 60 Chad Nice .......... 43 Anthony Jackson .... 23 Andre Hardaway .... 14 Joshua Johnston ..... 14 Chris Eckstein ....... 11 Troy Follmar ......... 5 Trent Carvolth ........ 3 Nate Tarsi ........... 1 Marcus Blanks ........ 1 Patrick Blakemore ..... 1 Cornell 176 Opponents 174

766 652 314 113 86 122 62 22 23 11 1 2172 2276

12.8 15.2 13.7 8.1 6.1 11.1 12.4 7.3 23.0 11.0 1.0 12.3 13.1

3 4 0 0 0 0 1 0 0 0 0 8 15

54 79 50 28 18 22 23 8 23 11 1 79 80

Total Offense*

Plays Rush

D.J. Busch ....... 275 Ryan Kuhn ...... 159 Joshua Johnston .. 156 All-Purpose*

-8 90 475

Rush Rec

475 3.0 3 27 348 4.0 5 31 90 1.7 3 23 17 2.8 0 11 11 3.7 0 7 9 1.3 0 7 7 2.3 0 3 3 0.6 0 3 0 0.0 0 0 -8 -0.2 0 14 -15 -1.9 0 4 937 2.5 12 31 1011 2.9 9 35

Pass Yards 1534 615 0

Avg

1526 705 475

152.6 141.0 59.4

P R K O R INT Tot A v g 0 0 0 0

Kickoff Returns No.

Yds

Avg

Long

Anthony Jackson . 16 Joshua Johnston ... 9 Andre Hardaway .. 9 Anthony Macaluso . 2 Cornell 36 Opponents 26

351 165 204 21 741 519

21.9 18.3 22.7 10.5 20.6 20.0

0 0 0 0 0 1

46 32 38 15 46 92

Tot

Punt Returns

No.

Yds

Avg

Long

167 181

Brian Romney .... 34 Nate Tarsi ........ 1 Cornell 35 Opponents 26

221 39 260 165

6.5 39.0 7.4 6.3

0 0 0 0

20 39 39 47

Misc. Returns

No.

Yds

Avg

Long

Nate Tarsi ........ 2 Matt Grant ...... 2 Sean Nassoiy ...... 4 Kevin Rex ........ 2 Jason Cloyd ...... 1 Cornell 10 Opponents 9

53 50 48 11 0 162 81

26.5 25.0 12.0 5.5 0.0 16.2 7.9

1 0 0 0 0 0 0

50 50 45 11 0 50 31

0 30 0 26 0 24 0 18 0 18 0 18 0 11 0 6 0 6 0 6 0 2 0 2 0 167 0 181

Pct.

Yds

Eff.

D.J. Busch .... 234-121-7 .517 Ryan Kuhn .... 105-54-4 .514 Mike Baumgartel ... 1-1-0 1.000 Brian Romney ..... 1-0-0 .000 Cornell 342-176-11 .515 Opponents 320-174-9 .544

1534 615 23 0 2172 2276

5 3 0 0 8 15

107.8 102.4 293.2 0.0 106.1 124.0

2005 FOOTBALL

Att Gain Loss Net Avg T D LG

Brian Romney .... 9 766 221 0 Joshua Johnston 475 86 0 165 Anthony Jackson . 11 314 0 351 Andre Hardaway 348 113 0 204

PAT 2-PT Def. Kick PAT PAT Sfty Pts

Andre Hardaway 5 0-0 0-0 Trevor MacMeekin 0 6-11 8-11 Chad Nice ...... 4 0-0 0-0 Joshua Johnston . 3 0-0 0-0 Ryan Kuhn ..... 3 0-0 0-0 Brian Romney ... 3 0-0 0-0 A.J. Weitsman .. 0 2-6 5-5 D.J. Busch ...... 1 0-0 0-0 Troy Follmar .... 1 0-0 0-0 Nate Tarsi ...... 1 0-0 0-0 Chris Eckstein ... 0 0-0 0-0 Peter Zell ...... 0 0-1 2-3 Cornell 21 8-18 15-19 Opponents 26 1-9 18-22 Passing

— —

Rushing

Joshua Johnston 156 Andre Hardaway 88 Ryan Kuhn ..... 54 Marcus Blanks ... 6 Anthony Jackson 3 Brian Romney ... 7 Luke Siwula ..... 3 Chi Chi Ibegbu .. 5 Jeff Hahn ...... 1 D.J. Busch ...... 41 TEAM ......... 8 Cornell 372 Opponent 351

Field Goals

996 99.6 726 90.8 676 67.6 665 110.8

10-29 30-39 40-49 50+ Total LG

Trevor MacMeekin 4-5 A.J. Weitsman .. 1-1 Peter Zell ...... 0-0

2-4 0-2 0-1

0-1 1-3 0-0

0-1 6-11 0-0 2-6 0-0 0-1

32 40 —

Cornell Opponents

2-7 0-4

1-4 0-3

0-1 0-0

40 25

Punting

5-6 1-2 N o Yds

Avg

8-18 1-9

Tackles

Solo Asst

Kevin Rex ....... 45 Brad Kitlowski .... 26 Dan Collins ...... 34 Patrick Potts ..... 28 Jonathan Lucas .. 26 Sean Nassoiy ..... 35 Jason Cloyd ..... 24 Nate Tarsi ....... 24 Mike McGinty .... 23 Ryan Lempa ...... 14 Matt Pollock ..... 18 Joel Sussman .... 16 Matt Grant ..... 16 Jeff Hahn ........ 9 Paul Pardi ........ 6 Jeff Dicks ........ 3 Anthony Macaluso . 2 Rich Trumka ...... 3 Ryan Blessing ..... 2 Luke Siwula ....... 1 William Leone ..... 0 Jarin Jackson ..... 2 Kevin Boothe ..... 1 Chad Nice ........ 1 A.J. Weitsman .... 1 Mike Baumgartel ... 1 Zach Beadle ...... 1 Michael Boyd ..... 1 Matt Darby ...... 1 Chris Eckstein ..... 1 Chi Chi Ibegbu .... 1 Troy Follmar ...... 0 Brandon Kerns ... 0 Jason Stadnik ...... 0 Andy West ........ 0

6 6 8

0 0 1

86 64 63 53 50 48 38 38 38 37 31 31 28 15 9 6 5 4 3 3 3 2 2 2 2 1 1 1 1 1 1 1 1 1 1

TFL QB Sack No-Yds No-Yds 7.5-35 3.0-11 5.5-20 6.0-23 9.0-27 5.0-16 3.5-7 3.0-5 9.0-39 8.0-32 7.5-26 1.0-1 0-0 3.5-14 1.0-7 1.0-1 0-0 0-0 0-0 0-0 0.5-1 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

3.0-23 1.0-2 3.0-16 3.0-18 1.0-6 1.0-9 0-0 0-0 4.0-28 4.0-16 1.0-9 0-0 0-0 2.0-8 1.0-7 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0 0-0

Interceptions (9): Nassoiy 4, Rex 2, Cloyd, Grant, Tarsi. Pass Break-ups (48): Tarsi 8, Cloyd 7, Grant 5, Lucas 5, Nassoiy 5, Rex 5, Lempa 3, Pollock 3, Dicks 2, Hahn 2, Kitlowski2,Potts. Fumble Recoveries (11): Lempa 2, Collins, Kitlowski, Nassoiy, Pardi, Potts, Rex, Sussman, Tarsi, Trumka. Caused Fumbles (9): Rex 4, Kitlowski 2, Hahn, Lucas, Pollock. Blocked Kicks (8): Sussman 3, Pollock 2, Tarsi 2, Collins. Special Teams Tackles: Kitlowski 9, Cloyd 8, Grant 4, Macaluso4,Nassoiy4,Trumka4,Blessing3,Collins3,Potts 3,Siwula3,Hahn2,J.Jackson2,Baumgartel,Boyd,Follmar, Ibegbu, Kerns, R. Lempa, Nice, Rex, Tarsi, Weitsman.

2004 FIELD GOAL SEQUENCE FG Sequence ...... Cornell .... Opponents Bucknell ........ 30, 50, (28) ....... 42k, 41k Yale .... (32), (23), (25), (29) ........... — Towson .............. (32) .......... 32k Harvard ........ 44k, 32, (22) ....... 38, 31k Colgate ............... 25 .......... (25) Brown ............ 45, (40) ........... — Princeton ........... 36, 35 ........... — Dartmouth ............ 32 ........... — Columbia ............. — ........... — Penn ................. 41 .... 36k, 44, 39k Numbers in (parentheses) indicate field goal was made. Numbers with k indicate field goal was blocked.

LG I20 50+ TB BLK

Mike Baumgartel 69 2449 35.5 59 16 2 Cornell 69 2449 35.5 59 16 2 Opponents 71 2584 36.4 65 14 9

41 38 29 55 24 13 14 14 15 23 13 15 12 6 3 3 3 1 1 2 3 0 1 1 1 0 0 0 0 0 0 1 1 1 1

Tot

Returning players in bold

2004 IN REVIEW/IVY LEAGUE GAME 1 Sept. 18, 2004

BUCKNELL 15, CORNELL 9 Christy Mathewson-Memorial Stadium

Cornellfoughtvaliantlyandstayed away from the big play for 55 minutes, but a long pass play and a breakaway runinthefinalfiveminutesenabledthe Bison to claim a 15-9 win over the Big Red at Christy Mathewson-Memorial Stadium. The loss extended Cornell’s losing streak to a school record-tying 10 games. Head coach Jim Knowles’s squad had a strong debut, taking a 9-7 lead with just 4:51 to play, but a 49-yard pass play from Daris Wilson to Nissan Trotter, followed by a 21-yard run by Wilson set the stage for the go-ahead score with 3:40 to play. Wilson ended theafternoonwithhisfifthcareer100yard rushing game, tallying 139 yards and a touchdown on the ground while going 7-of-9 passing for 116 yards and a touchdown in the air. Blamah Sarnor had84yardsrushingandTrottercaught four passes for 84 yards in the win. Senior quarterback D.J. Busch finished the afternoon 19-of-38 passing for 193 yards, with classmate Chad Nicecatchingsixpassesfor84yardsto lead the Big Red offense. Junior Andre Hardaway led the Cornell ground game with 40 yards on 15 carries, while Joshua Johnston picked up 35 yards on 12 carries. The Big Red special teams were a mixed bag, as senior Joel Sussman blocked two field goal efforts to go along with his 10 defensive tackles,butCornellmissedtwoofthree field goals and an extra point. The game was fairly even, with Bucknell outgaining Cornell 408-279

GAME 2 Sept. 25, 2004

Lewisburg, Pa.

in total offense and holding a slight edge in first downs (21-17) and time of possession (30:20-29:40). Cornell Bucknell

0 7

6 0

0 0

3 8

— —

9 15

1st Quarter B—Nutt 15-yard pass from Wilson (Korn kick), 4:39 2nd Quarter C—Hardaway 2-yard run (MacMeekin kick failed), 3:12 3rd Quarter no scoring

Team Stats Cornell Bucknell First downs 17 21 Rushes-yards 30-86 53-292 Passing 193 116 Passing A-C-I 38-19-0 10-7-1 Total plays-yards 68-279 63-408 Return yards 3-59 1-14 Punts-avg. 5-37.6 3-37.7 Fumbles-lost 0-0 3-2 Penalties-yards 5-25 5-40 3rd down con. 7-16 4-10 4th down con. 0-1 1-1 Time of possession 29:40 30:20

CORNELL 19, YALE 7 Yale Cornell

Ithaca, N.Y.

0 3

7 6

0 0 0 10

— —

TD Lg 1 10 0 9 0 9 0 0

Passing A-C-I Yds D.J. Busch ... 38-19-0 193

TD Lg 0 23

Receiving Rec Yds Chad Nice ........ 6 84 Brian Romney ..... 6 38 Chris Eckstein ...... 2 42 Anthony Jackson .... 2 14 Joshua Johnston .... 1 12 Andre Hardaway ... 1 4 Troy Follmar ....... 1 -1

TD 0 0 0 0 0 0 0

Lg 23 9 22 8 12 4 0

7 19

1st Quarter C—MacMeekin 32-yard field goal, 9:06 2nd Quarter C—MacMeekin 23-yard field goal, 10:33 C—MacMeekin 25-yard field goal, 4:43 Y—Plumb 25-yard pass from Cowan (Sullivankick),2:33 3rd Quarter no scoring 4th Quarter C—Hardaway 1-yard run (MacMeekin kick), 12:07 C—MacMeekin 29-yard field goal, 1:54 Team Stats Yale Cornell First downs 8 19 Rushes-yards 22-35 50-125 Passing 146 174 Passing A-C-I 34-15-0 32-19-1 Total plays-yards 56-181 82-299 Return yards 2-50 2-39 Punts-avg. 9-34.8 5-38.0 Fumbles-lost 1-0 1-0 Penalties-yards 3-16 2-10 3rd down con. 1-14 9-20 4th down con. 1-4 0-1 Time of possession 20:21 39:39

Field Goal Attempts Trevor MacMeekin 1st ... 8:59 .... 30-yards .. Missed 2nd ... 14:03 ... 50-yards .. Missed A.J. Weitsman 4th ... 4:51 .... 28-yards ... Good Punt Returns: Brian Romney 2-19. KickoffReturns:JoshuaJohnston3-59. Tackle Leaders: Joel Sussman 6-4, Matt Pollock7-2,KevinRex5-3,MikeMcGinty6-1. Sacks: Matt Pollock 3-8, Mike McGinty 15, Brad Kitlowski 1-2, Joel Sussman 1-1. Tackles for loss: Matt Pollock 3-8, Mike McGinty1-5,BradKitlowski1-2,JoelSussman 1-1. Interceptions: Sean Nassoiy 1-3. Fumble Recoveries: Ryan Lempa 1-0, Joel Sussman 1-0. Forced Fumbles: Matt Pollock 1. Pass breakups: None.

Yale Individual Stats

Rushing Att. Net Daris Wilson ..... 23 139 Blamah Sarnor .... 17 84 Frank Lazio ....... 8 43 Peter Kaufman ..... 3 28 John Henry Jackson .. 2 -2

TD 1 0 0 0 0

Lg 35 29 13 23 0

Passing A-C-I Yds Daris Wilson ... 9-7-0 116 TEAM ........ 1-0-0 0

TD Lg 1 49 0 0

Receiving Rec Yds Nisan Trotter ...... 4 84 Mike Cangelosi .... 2 16 Ian Nutt ......... 1 16

TD Lg 0 49 0 8 1 16

Punting Att Yds Avg Lg I20 Ryan Berry .... 3 113 37.7 40 0 Field Goal Attempts Ryan Korn 2nd ... 8:05 .... 42-yards .. Blocked 2nd ... 0:00 .... 41-yards .. Blocked Punt Returns: Dante Ross 1-5. Kickoff Returns: Nisan Trotter 1-14. Tackle Leaders: Jerome Acy 11-2, Jeff Montagna 5-2, Virgil Rush 6-0, Andre Decker 4-1, Kevin Ransome 3-2. Sacks: None. Tackles for loss: Joe Glenn 1-7, Dorian Peterson 1-2, Andrew Decker 1-2, Kevin Ransome 1-1. Interceptions: None. Fumble Recoveries: None. Pass breakups: Jerome Acy 3, Jeff Montagna 1, Dante Ross 1.

Cornell Individual Stats

Rushing Att. Net Rob Carr ........ 15 41 Alvin Cowan ...... 7 -6

TD Lg 0 11 0 12

Rushing Att. Net Joshua Johnston ... 26 93 Andre Hardaway .. 13 40 Brian Romney ..... 1 2 D.J. Busch ........ 8 -5 TEAM ........... 2 -5

TD 0 1 0 0 0

Passing A-C-I Yds Alvin Cowan . 33-15-0 146 TEAM ........ 1-0-0 0

TD Lg 1 36 0 0

Receiving Rec Yds Ralph Plumb ...... 7 99 Will Blodgett ...... 4 22 Alex Faherty ...... 3 17 Chandler Henley ... 1 8

TD Lg 1 36 0 6 0 8 0 8

Passing A-C-I Yds D.J. Busch ... 32-19-1 174

TD Lg 0 30

Punting Att Yds Avg Lg I20 Tyson Crawford 8 296 37.0 59 1 TEAM ....... 1 17 17.0 17 0

Receiving Rec Yds Brian Romney ..... 5 49 Chad Nice ........ 5 48 Troy Follmar ....... 3 40 Joshua Johnston .... 3 10 Andre Hardaway ... 2 20 Trent Carvolth ..... 1 7

TD 0 0 0 0 0 0

Field Goal Attempts NONE

Punting Att Yds Avg Lg I20 Mike Baumgartel 5 190 38.0 47 0

Punt Returns: Chandler Henley 3-6. KickoffReturns:RobCarr1-27,ChrisDennyBrown 1-23. TackleLeaders:HarrisCole6-6,KenEstrera 4-7, Barton Simmons 5-5, Brandon Dyches 5-4, Ben Breunig 3-6. Sacks: Brandon Etheridge 1-9, Brandon Dyches 1-7. Tackles for loss: Brandon Dyches 4-15, Don Smith 4-6, Brandon Etheridge 1-9, Ben Breunig 1-4, Nick Campbell 1-3, Tim Barrett1-1,AlanKimball1-1. Interceptions:FredJelks1-0. Fumble Recoveries: None. Forced Fumbles: None. Pass breakups: Fred Jelks 1, Barton Simmons 1, Don Smith 1.

Field Goal Attempts Trevor MacMeekin 1st ... 9:06 .... 32-yards 2nd ... 10:33 ... 23-yards 2nd ... 4:43 .... 25-yards 4th ... 1:54 .... 29-yards

... ... ... ...

Lg 17 14 2 12 0

Lg 14 30 19 9 16 7

Good Good Good Good

Punt Returns: Brian Romney 2-13. KickoffReturns:JoshuaJohnston2-39. TackleLeaders:KevinRex5-1,SeanNassoiy 3-3,PatrickPotts3-3,DanCollins4-1. Sacks:PatrickPotts1-10,SeanNassoiy19, Jonathan Lucas 1-6. Tacklesforloss:SeanNassoy2-11,Jonathan Lucas2-7,PatrickPotts1-10,KevinRex18. Interceptions: None. Fumble Recoveries: None. Forced Fumbles: None. Pass breakups: Matt Grant 2, Jonathan Lucas 1, Matt Pollock 1, Nate Tarsi 1.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Behind an impressive defensive effort and a balanced offensive attack, the Cornell football team helped Jim Knowles ‘87 earn a victory in his first home contest as a head coach, as the Big Red defeated Yale 19-7 in front of 11,835 fans at Schoellkopf Field. The win snapped Cornell’s 10-game losing streak, tied for the longest in school history. Trevor MacMeekin was successful onallfourofhisfieldgoalattemptson the day to set a school record, includingthreeinthefirsthalftohelptheBig Red score the first nine points of the contest. The Big Red, which gained 125 yards on the ground compared to Yale’s 35, got 93 rushing yards from Joshua Johnston. Quarterback D.J. Busch added 174 yards in the air, completing 19 of his 32 attempts, and Andre Hardaway scored the Red’s lone touchdown. The contest was designatedasSchoellkopfSelloutII.Cornell’s last win over Yale was also the team’s last win in an Ivy opener. That contest came in 2000 and was a 24-23 home victoryinthefirstSchoellkopfSellout. TheBigRedlimitedYale,ateamthat averaged 35.4 points and 478 yards per game a season ago to one touchdown and182totalyards.ItalsoheldWalter Payton Award candidate Alvin Cowan to140yardsoftotaloffense,hislowest career total as a starter, and held Rob Carr, coming off a 172-yard effort in a win over Dayton, to 46 yards rushing. Theoffense,meanwhile,controlledthe ballfornearly40minutes.

Bucknell Individual Stats

Rushing Att. Net Andre Hardaway .. 15 40 Joshua Johnston ... 12 35 D.J. Busch ........ 2 13 Brian Romney ..... 1 -2

Punting Att Yds Avg Lg I20 Mike Baumgartel 5 188 37.6 45 1

4th Quarter C—Weitsman 28-yard field goal, 4:51. B—Wilson 1-yard run (Nutt pass from Wilson), 3:40

Schoellkopf Field

Cornell Individual Stats

2004 IN REVIEW/IVY LEAGUE GAME 3 Oct. 2, 2004

TOWSON 21, CORNELL 11 Johnny Unitas Stadium

Cornell made a valiant last-minute comeback attempt, but Towson held on for a 21-11 victory over the Big Red at Johnny Unitas Stadium. Towson’s Andrew Goldbeck tossed for a career-best 285 yards and two touchdowns in the victory, with Eric Yanceycatchingfiveballsfor91yards and a score. Kerry Miles had 43 yards and a touchdown on the ground. On defense,AllanteHarrisonreeledinhis fifthinterceptionoftheyear,whileJohn Webb had 15 tackles. The Tigers outgained Cornell 385300intotaloffenseandcontrolledthe ballfor34:40whilelimitingtheBigRed offense to 4-of-17 third down conversions.TheCornellspecialteamsplayed alargepartdespitetheloss,astheBig Red blocked a field goal and a punt and senior Trevor MacMeekin kicked his fifth field goal in two games. Big Red quarterback D.J. Busch ended the afternoon 21-of-42 passing for a season-high 234 yards with a touchdown and two interceptions. Brian Romney had six catches for 70 yards, while Joshua Johnston had 25 yards to lead Cornell on the ground. TroyFollmarhadhisfirstcareertouchdown on a 23-yard reception in the fourthquarter. TheCornelldefensiveeffortwasspearheaded by Joel Sussman, who blocked a second quarter field goal, his sixth career kick block, and had a game-high 15tackles.NateTarsiaddedapuntblock and a pass breakup to go along with his fourtacklesandBradKitlowskiposted11 tackles,includingtwoforlosses.

GAME 4

WWW .CORNELL B IG R ED . COM

Oct. 9, 2004

0 7

3 0

8 7

— —

11 21

1st Quarter T—Miles 2-yard run (Toth kick), 10:06 2nd Quarter T—Marcus 43-yard pass from Goldbeck(Tothkick),0:40 3rd Quarter C—MacMeekin 32-yard field goal, 2:29. 4th Quarter T—Yancey 55-yard pass from Goldbeck (Toth kick), 13:46 C—Follmar 23-yard pass from Busch (Eckstein pass from Busch), 7:39. Team Stats Cornell Towson First downs 13 20 Rushes-yards 22-66 37-100 Passing 234 285 Passing A-C-I 43-21-2 36-24-0 Total plays-yards 65-300 73-385 Return yards 3-67 4-23 Punts-avg. 7-38.6 8-28.6 Fumbles-lost 1-0 0-0 Penalties-yards 10-90 12-117 3rd down con. 4-17 7-18 4th down con. 2-3 2-2 Time of possession 25:20 34:40

HARVARD 34, CORNELL 24 Harvard Stadium

SeniorquarterbackRyanFitzpatrick ran for 102 yards and passed for 317 more and accounted for three touchdowns as Harvard topped Cornell 3424 at Harvard Stadium. Fitzpatrick rushed for a score and passed for two more in accumulating his 419 yards of total offense. Corey Mazza caught both touchdown passes and ended the afternoon with nine caught for 194 yards. Clifton Dawson, who entered the game as the nation’s second leading rusher at 166 yards per game, was bottled up all afternoon and finished with21carries for61yards. Junior tailback Andre Hardaway rushed for a career-high 130 yards and two touchdowns for the Big Red and ran back four kickoffs for 104 yards in his return to his home state of Massachusetts. Quarterback D.J. Busch passed for 285 yards on 16-of-38 passing as the Big Red offense piled up a season-high 412 yards of offense. Chad Nice had four catches for 122 yards, giving him his first 100-yard receiving game of his career. Defensively,PatrickPottshad11tacklesand Mike McGinty had seven stops, includingasackandtwoothertacklesforloss. MattPollockblockedhisfirstfieldgoal attempt of the season in the contest. Harvard held a 495-412 advantage in total yards, including a 335-285 advantagethroughtheair.Italsoused specialteams,returninga92-yardkickoff for a touchdown and blocking a Big Red field goal attempt.

2005 FOOTBALL

Cornell Towson

Towson, Md.

Cornell Harvard

Cambridge, Mass.

7 7 10 6 15 6

0 7

— —

24 34

1st Quarter H—Dawson 6-yard pass from Fitzpatrick(Balkemarushfailed),8:26 C—Hardaway 2-yard run (MacMeekin kick), 6:52 2nd Quarter C—Hardaway 10-yard run (MacMeekin kick), 8:42 H—Edwards 92-yard kick return (Fitzpatrickrush),8:30 H—Mazza 51-yard pass from Fitzpatrick(Schindelkick),2:39 3rd Quarter C—MacMeekin 22-yard field goal, 10:45 C—Nice 80-yard pass from Busch (MacMeekin kick), 6:41 H—Mazza 21-yard pass from Edwards (Schindel kick), 2:15 4th Quarter H—Fitzpatrick 17-yard run (Schindel kick),2:48 Team Stats Cornell Harvard First downs 15 22 Rushes-yards 36-127 42-160 Passing 285 335 Passing A-C-I 39-16-0 37-21-1 Total plays-yards 75-412 79-495 Return yards 6-124 4-150 Punts-avg. 8-34.8 6-38.0 Fumbles-lost 0-0 1-1 Penalties-yards 6-41 7-68 3rd down con. 5-19 6-15 4th down con. 0-3 0-1 Time of possession 31:31 28:29

Cornell Individual Stats

Towson Individual Stats

Rushing Att. Net Joshua Johnston .... 9 25 Andre Hardaway ... 6 21 D.J. Busch ........ 7 20

TD Lg 0 17 0 8 0 14

Passing A-C-I Yds D.J. Busch ... 42-21-2 234

TD Lg 1 35

Receiving Rec Yds Brian Romney ..... 6 70 Joshua Johnston .... 4 44 Chad Nice ........ 4 35 Andre Hardaway ... 3 39 Trent Carvolth ..... 2 15 Troy Follmar ....... 1 23 Chris Eckstein ...... 1 8

TD 0 0 0 0 0 1 0

Lg 35 16 15 19 8 23 8

Punting Att Yds Avg Lg I20 Mike Baumgartel 7 270 38.6 59 2 Field Goal Attempts Trevor MacMeekin 3rd ... 2:29 .... 32-yards ... Good Punt Returns: Brian Romney 2-28, Nate Tarsi1-39. KickoffReturns:JoshuaJohnston4-67. TackleLeaders:JoelSussman6-9,Kevin Rex 1-11,PatrickPotts4-7,BradKitlowski3-8, DanCollins0-9. Sacks: None. Tacklesforloss:BradKitlowski2-9,Ryan Lempa 1.5-9, Sean Nassoiy 1-3, Jason Cloyd 1-1, Mike McGinty 0.5-1, Patrick Potts 0.5-1, Kevin Rex 0.5-1. Interceptions: None. Fumble Recoveries: None. Forced Fumbles: None. Passbreakups:JasonCloyd,BradKitlowski, NateTarsi.

Cornell Individual Stats

Rushing Att. Net Kerry Miles ...... 16 43 Matt Brunetti ..... 10 36 Nick Williams ...... 8 25 Andrew Goldbeck ... 3 -4

TD Lg 1 9 0 8 0 16 0 5

Passing A-C-I Yds And. Goldbeck 36-24-0 285

TD Lg 2 55

Receiving Rec Yds Eric Yancey ....... 5 91 Andrae Brown ..... 5 32 Will Marcus ....... 4 51 Dayron Arnold ..... 4 49 Kerry Miles ....... 3 40 Jim Alexander ..... 1 11 Matt Brunetti ...... 1 7 Paul Perry ........ 1 4

TD 1 0 1 0 0 0 0 0

Lg 55 10 43 15 20 11 7 4

Punting Att Yds Avg Lg I20 Stephan Toth .. 7 229 32.7 55 2 Field Goal Attempts Stephan Toth 2nd ... 3:20 .... 26-yards .. Blocked Punt Returns: Eric Yancey 3-12, Allante Harrison1-11. Kickoff Returns: Will Marcus 2-61. TackleLeaders:JohnWebb1-14,EricClark 4-4,AllanteHarrison2-5,P.D.Moore0-7. Sacks:GeorgeMitchell1-8,JohnWebb1-7. Tackles for loss:John Webb 1.5-9, George Mitchell 1-8, P.D. Moore 1-2, Joe Ryan 12,AllanteHarrison0.5-2,CarlosAllen0.51,DaveKellner0.5-1,TimOI’Brian0.5-1, Randy Vince 0.5-1. Interceptions:AllanteHarrison1-0,P.D. Moore 1-0. Fumble Recoveries: None. Pass breakups: P.D. Moore 3, John Webb 3,CarlosAllen2,TonyLumpkin2,EricClark.

Harvard Individual Stats

Rushing Att. Net Andre Hardaway .. 28 130 Marcus Blanks ..... 2 2 Jeff Hahn ......... 1 0 D.J. Busch ........ 6 -5

TD Lg 2 31 0 2 0 0 0 7

Passing A-C-I Yds D.J. Busch ... 38-16-0 285

TD Lg 1 77

Receiving Rec Yds Brian Romney ..... 6 68 Chad Nice ........ 4 122 Anthony Jackson .... 2 62 Andre Hardaway ... 2 21 Chris Eckstein ...... 2 12

TD 0 1 0 0 0

Lg 26 77 37 13 12

Punting Att Yds Avg Lg I20 Mike Baumgartel 8 278 34.8 44 3 Field Goal Attempts Trevor MacMeekin 1st ... 12:19 ... 44-yards .. Blocked 2nd ... 0:21 .... 32-yards .. Missed 3rd ... 10:45 ... 22-yards ... Good Punt Returns: Brian Romney 2-14. Kickoff Returns: Andre Hardaway 4-104, Anthony Jackson 1-14. Tackle Leaders:Patrick Potts 5-6, Brad Kitlowski 4-5, Jonathan Lucas 5-3, Dan Collins 4-3, Mike McGinty 4-3. Sacks: Mike McGinty 1-7. Tacklesforloss:MikeMcGInty3-9,Patrick Potts1-2,JasonCloyd1-1,DanCollins10, Ryan Lempa 1-1, Jonathan Lucas 1-1. Blocked Kick: Matt Pollock. Interceptions: Kevin Rex 1-0. Fumble Recovery: Brad Kitlowski. Pass breakups: Jason CLoyd, Jonathan Lucas, Sean Nassoiy, Nate Tarsi.

Rushing Att. Net Ryan Fitzpatrick ... 17 102 Clifton Dawson ... 21 61 Nick Carrington .... 1 3

TD Lg 1 19 0 17 0 3

Passing A-C-I Yds Ryan Fitzpatrick 35-19-1 317 Brian Edwards .. 1-1-0 21 Robert Balkema . 1-1-0 -3

TD Lg 2 51 1 21 0 0

Receiving Rec Yds Corey Mazza ...... 9 194 Ryan Tyler ........ 5 52 Brian Edwards ..... 3 48 Clifton Dawson .... 2 26 Joe Murt ......... 1 18 Bobby Everett ...... 1 -3

TD 2 0 0 1 0 0

Lg 51 15 21 20 18 0

Punting Att Yds Avg Lg I20 Mike King .... 6 228 38.0 45 0 Field Goal Attempts Matt Schindel 2nd ... 11:36 ... 38-yards .. Missed 3rd ... 8:30 .... 31-yards .. Blocked KickoffReturns:BrianEdwards3-127,Corey Waller1-23. Tackle Leaders: Matt Thomas 3-10, Bobby Everett 6-4, James Harvey 2-8, Ryan Tully 3-5, Sean Tracy 4-3. Sacks: Sean Tracy 1-7, Ryan Tully 1-7, Michael Berg 1-1. Tackles for loss: Ryan Tully 3-11, Sean Tracy 2-8, Sam Workman 1-3, James Harvey1-2,MichaelBerg1-1,BobbyEverett 1-1, Matt McBurney 1-1, Matt Thomas 11. Blocked Kick: Matt McBurney. Pass breakups: Matt Thomas 4, James Harvey 2, Keith Howell, Daniel Tanner, RyanTully.

2004 IN REVIEW/IVY LEAGUE GAME 5 Oct. 16, 2004

NO. 20 COLGATE 10, CORNELL 6 Schoellkopf Field

The Big Red defense gave it all it had, but the sure hands of Colgate senior wide receiver Luke Graham proved too much as No. 20 Colgate rallied to top Cornell 10-6 in front of a Homecoming crowd of more than 12,000 at Schoellkopf Field. Cornell got a touchdown and 84 rushing yards from junior Andre Hardaway. The Raiders, last year’s NCAA Division I-AA national runner-up, were led by Graham’s nine catches for 159 yards. The Big Red limited Walter Payton Trophy candidate Jamaal Branch under 100 yards rushing and kept the Raider offense off the scoreboard for more than 40 minutes in front of a Homecoming crowd of more than 12,000 and entered the fourth quarter with a lead. Two interceptions, a muffed punt return, a missed field goal and a blocked extra point by the Big Red kept the Raiders in the game, and Graham refused to let Colgate go down to defeat. The captain hauled in three passes for 85 yards in the fourth quarter, including an incredible 43-yard reception to set up Branch’s game-winning 2-yard touchdown with just under eight minutes to play. He finished the day with 95 yards on the ground. Kevin Rex had the finest day of his career, making a team-high eight tackles, including one for a loss, and forcing two fumbles. One of his forced fumbles was a vicious hit on Colgate quarterback Chris Brown that was recovered by Cornell more than 30 yards

GAME 6 Oct. 23, 2004

Ithaca, N.Y.

downfield. Dan Collins and Jonathan Lucas also had strong showings, each making eight tackles and two for a loss. Collins also recovered a fumble. Sean Nassoiy had seven tackles and broke up three passes to pace the defensive backfield. In all, the Big Red defense limited Colgate to 244 total yards, including just 50 total yards in the first half. Colgate Cornell

0 0

0 6

3 0

7 0

— —

10 6

Cornell Individual Stats

Rushing Att. Net Jamaal Branch .... 27 95 Eric Guglielmotti .... 7 10 Chris Brown ...... 11 -26

TD Lg 1 23 0 4 0 22

Rushing Att. Net Andre Hardaway .. 20 84 Anthony Jackson .... 1 5 D.J. Busch ........ 5 -15

TD Lg 1 20 0 5 0 3

Passing A-C-I Yds Chris Brown .. 24-13-0 170

TD Lg 0 43

Passing A-C-I Yds D.J. Busch ... 25-12-2 100

TD Lg 0 28

Receiving Rec Yds Luke Graham ...... 9 159 Eric Guglielmotti .... 2 5 Jamaal Branch ..... 1 6 Garrin Rose ....... 1 0

TD Lg 0 43 0 3 0 6 0 0

Receiving Rec Yds Brian Romney ..... 4 48 Andre Hardaway ... 3 22 Chad Nice ........ 3 9 Anthony Jackson .... 2 21

TD 0 0 0 0

Lg 17 28 10 15

Punting Att Yds Avg Lg I20 Jason Sutton .. 5 168 33.6 50 1

Punting Att Yds Avg Lg I20 Mike Baumgartel 6 223 37.2 45 0

2nd Quarter Cor—Hardaway 20-yard run (MacMeekin kick blocked), 6:09

Field Goal Attempts Lane Schwarzberg 3rd ... 4:29 .... 25-yards ... Good

Field Goal Attempts Trevor MacMeekin 1st ... 1:36 .... 25-yards .. Missed

3rd Quarter Colg—Schwarzberg 25-yard field goal,4:29.

Punt Returns: Luke Graham 4-12. KickoffReturns:Ray LaMonica 1-22. Tackle Leaders: Jared Nepa 6-4, Geoff Bean 4-2, Zach Dollar 1-5, Chris Williams 3-2,JeffGalletly2-3,AntrellTyson2-3. Sacks: Jeff Galletly 2-8, Josh Wurst 1-4, Adam Leeman 1-3. Tacklesforloss:Jared Nepa 2.5-10, Jeff Galletly 2-10, Geoff Bean 1.5-4, Chris Willaims 1-4, Antrell Tyson 1-2, Chris Petrone 1-2, Josh Wurst 0.5-4, Conn Davis 0.5-3. Interceptions: Geoff Bean 2-46. Fumble Recoveries: Conn Davis 1. Forced Fumbles: None. Pass breakups: None.

Punt Returns: Brian Romney 2-14. Kickoff Returns:Andre Hardaway 3-57. TackleLeaders:Kevin Rex 7-1, Dan Collins 5-3, Jonathan Lucas 5-3, Sean Nassoiy 52,PatrickPotts4-3. Sacks:PaulPardi1-7. Tacklesforloss:DanCollins2.0-8,Jonathan Lucas 2.0-5, Paul Pardi 1.0-7, Jeff Dicks 1.0-1, Kevin Rex 1.0-1, Nate Tarsi 1.0-1. Interceptions: None. Fumble Recoveries: Dan Collins, Paul Pardi,PatrickPotts. Forced Fumbles: Kevin Rex 2. Pass breakups: Sean Nassoiy 3.

Cornell Individual Stats

Brown Individual Stats

1st Quarter No scoring

4th Quarter Colg—Branch 3-yard run (Schwarzberg kick), 7:56 Team Stats Colgate Cornell First downs 14 10 Rushes-yards 47-74 28-76 Passing 170 100 Passing A-C-I 24-13-0 25-12-2 Total plays-yards 71-244 53-176 Return yards 1-22 3-57 Punts-avg. 5-33.6 6-37.2 Fumbles-lost 4-3 2-1 Penalties-yards 2-12 7-59 3rd down con. 6-18 4-13 4th down con. 0-2 0-1 Time of possession 34:30 25:30

BROWN 21, CORNELL 17 Brown Stadium

Cornell Brown

Providence, R.I.

3 0

7 7

7 0 0 14

— —

17 6

1st Quarter C—Weitsman 40-yard field goal, 3:21 2nd Quarter B—Krevis 19-yardpass from Vita (Morgan kick), 9:52 C—Kuhn 1-yard run (Weitsman kick),0:46 3rd Quarter C—Kuhn 23-yard run (Weitsman kick),5:18 4th Quarter B—Schreck 11-yard pass from Vita (Morgan kick), 14:07 B—Blackledge 24-yard pass from Vita (Morgan kick), 5:17 Team Stats Cornell Brown First downs 15 18 Rushes-yards 42-159 34-110 Passing 134 219 Passing A-C-I 28-16-1 30-15-1 Total plays-yards 70-293 64-329 Return yards 4-95 3-54 Punts-avg. 5-29.6 6-30.0 Fumbles-lost 2-0 1-1 Penalties-yards 10-98 4-30 3rd down con. 8-18 4-12 4th down con. 0-1 1-2 Time of possession 32:16 27:44

Rushing Att. Net Joshua Johnston ... 20 76 Ryan Kuhn ....... 15 48 Andre Hardaway ... 6 33 Marcus Blanks ..... 1 2

TD 0 2 0 0

Lg 16 23 11 2

Passing A-C-I Yds Ryan Kuhn ... 24-14-1 121 D.J. Busch ..... 4-2-0 13

TD Lg 0 21 0 10

Receiving Rec Yds Brian Romney ..... 5 71 Anthony Jackson .... 4 31 Andre Hardaway ... 3 7 Chad Nice ........ 2 10 Marcus Blanks ..... 1 11 Joshua Johnston .... 1 4

TD 0 0 0 0 0 0

Lg 21 13 4 9 11 4

Rushing Att. Net Nick Hartigan ..... 24 88 Anthony Vita ...... 9 22 Brandon Markey .... 1 0

TD Lg 0 14 0 19 0 0

Passing A-C-I Yds Anthony Vita . 30-15-1 219

TD Lg 3 37

Receiving Rec Yds Jarret Schreck ...... 5 90 Paul Raymound .... 4 34 Nick Hartigan ...... 3 41 Matt Krevis ....... 2 30 Efren Blackledge .... 1 24

TD 1 0 0 1 1

Lg 37 14 21 19 24

Punting Att Yds Avg Lg I20 Steve Morgan . 6 180 30.0 34 2

Punting Att Yds Avg Lg I20 Mike Baumgartel 5 148 29.6 37 1

Field Goal Attempts None

Field Goal Attempts A.J. Weitsman 1st ... 10:18 ... 45-yards .. Missed 1st ... 3:21 .... 40-yards ... Good

Punt Returns: Brandon Markey 2-3. Kickoff Returns: Brandon Markey 2-43, NkosiStill1-11. TackleLeaders:Zak DeOssie 10-2, Craig Young 5-5, James Frazier 4-6, Anjel Gutierrez 3-5, James Gasparella 2-5. Sacks:JamesFrazier1.5-13,ScottEpperson 1.5-7, Zak DeOssie 1-8, Greg Burlin 1-8, StevenStorrs0.5-3,AnjelGutierrez0.5-1. Tacklesforloss:Zak DeOssie 2-10, James Frazier1.5-13,ScottEpperson1.5-7,Greg Burlin 1-8. Steven Storrs 0.5-3, Mike Stefanacci0.5-1,AnjelGutierrez0.5-1, James Gasparella 0.5-1. Interceptions: Rashad Collins 1-22. Forced Fumbles: James Frazier 2. Pass breakups: Zak DeOssie, Casey Dougan, James Gasparella.

Punt Returns: Brian Romney 2-9. Kickoff Returns: Andre Hardaway 2-43; Anthony Jackson 1-37. TackleLeaders:Kevin Rex 9-4, Nate Tarsi 7-1,PaulPardi5-1,BradKitlowski1-4,Dan Collins1-4. Sacks: Ryan Lempa 2-12, Kevin Rex 1-7. Tackles for loss: Ryan Lempa 2-12, Kevin Rex1-7,JasonCloyd1-2,DanCollins0.51, Mike McGInty 0.5-1, William Leone 0.51,MattPollock0.5-1. Interceptions: Matt Grant 1-50. Fumble Recovery: Ryan Lempa. Forced Fumble: Kevin Rex 1. Pass breakups: Jason Cloyd 2, Jeff Dicks 2,MattGrant,JonathanLucas,NateTarsi.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Quarterback Anthony Vita threw three touchdowns, including a pair of fourthquarterscores,asBrownrallied froma10-pointfourthquarterdeficitto top Cornell 21-17 at Brown Stadium. Ryan Kuhn, making his first career start at quarterback for the Big Red, rushed for 48 yards and two touchdowns and was 14-of-24 passing for 121 yards. Tailback Joshua Johnston rushed for 76 yards as the Big Red pounded out a season-high 159 yards on the ground. Brian Romney caught five passes for 71 yards, and A.J. Weitsman connected on his second fieldgoaloftheseason,acareer-long 40-yard attempt. The Big Red defense diditsjob,limitingBrownto329yards oftotaloffenseandholding2003firstteamAll-IvyrunningbackNickHartigan to 88 yards on 24 carries. PenaltiesagainkilledtheBigRed,as Cornell was whistled for 10 violations setting it back 98 yards. The squad was 8-of-18 on third down conversions, but just 1-of-3 in red zone opportunities. The Bears capitalized on their scoring chances, going 3-of-3 in the red zone. It was Vita who picked up the Brown offense, going 15-of-30 for 219 yards and also rushing for 22 yards. He was interceptedonce.Vita’sfavoritetarget was Jarrett Schreck, who caught five passesfor90yardsandan11-yardscore tocapoffa14-play,65yarddriveinthe fourth quarter. The winning score came on a 24-yard pass from Vita to Efren Blackledge with 5:17 to play.

Colgate Individual Stats

2004 IN REVIEW/IVY LEAGUE GAME 7 Oct. 30, 2004

CORNELL 21, PRINCETON 20 Schoellkopf Field

Cornell used a blocked kick from Matt Pollock on a late extra-point attempttoholdoffafuriousrallybythe visitingPrincetonTigersandposta2120 home victory at Schoellkopf Field. Aftertrailing21-7inthefinalminute of the third quarter, Princeton scored the final 13 points of the contest, including a touchdown on a 6-yard reverse run by Greg Fields with just undersevenminutesleftinregulation. However, the ensuing extra-point attempt was batted down by Pollock and a final Princeton drive in the closing minutes resulted in a turnover on downs. Cornell wideout Brian Romney hauledinthefirsttwotouchdownpasses ofhiscareerinthewin.Thetwoscoring plays by Romney combined for 78 yards and were the first two touchdown passes ever thrown by quarterback Ryan Kuhn, who took over the starting role the week before. Princeton entered the game with the second-best pass defense in the Ivies at 156 yards per contest, but it yielded a combined 320 yardsintheairtoBigRedquarterbacks Kuhn and D.J. Busch. Chad Nice, who hauled in a 79-yard scoring pass from Busch in the third quarter,hadfourcatchesfor142yards and Romney had 114 yards of his own, markingthefirsttimeinoverfouryears thattwoBigRedplayerseachpassedthe 100-yard mark in the same game. Their 256combinedreceivingyardsisthethird most ever by a Cornell duo and the highesttotalsinceEricKrawczykandPat Dutton combined for 281 yards in a 44-

GAME 8

WWW .CORNELL B IG R ED . COM

Nov. 6, 2004

38overtimelossagainstColgatein1997. Princeton quarterback Matt Verbit threw for a game-high 260 yards, including an 80-yard touchdown pass tofreshmanBillForan. Princeton Cornell

0 7

7 7 0 14

6 0

— —

20 21

1st Quarter C—Romney 54-yard pass from Kuhn (Weitsman kick), 8:52 2nd Quarter P—Foran 80-yard pass from Verbit (Javaronekick),6:37 3rd Quarter C—Romney 24-yard pass from Kuhn (MacMeekin kick), 6:20 C—Nice 79-yard pass from Busch (MacMeekin kick), 3:23 P—Veach 3-yard run (Javarone kick), 0:37 4th Quarter P—Fields 6-yard run (Javarone kick blocked), 6:48 Team Stats Princeton Cornell First downs 12 16 Rushes-yards 27-69 38-62 Passing 260 320 Passing A-C-I 39-19-2 37-18-0 Total plays-yards 66-329 75-382 Return yards 4-47 3-88 Punts-avg. 9-43.8 10-33.6 Fumbles-lost 1-0 1-0 Penalties-yards 3-38 10-82 3rd down con. 4-17 7-21 4th down con. 1-3 1-1 Time of possession 29:34 30:26

CORNELL 14, DARTMOUTH 7

Princeton Individual Stats

Cornell Individual Stats

Rushing Att. Net Branden Benson ... 16 50 Jon Veach ........ 6 21 Matt Verbit ....... 3 1 Greg Fields ....... 2 -3

TD 0 1 0 0

Lg 12 12 11 6

Passing A-C-I Yds Matt Verbit .. 39-19-2 260

TD Lg 1 80

Receiving Rec Yds Greg Fields ....... 8 121 BillForan ......... 4 86 Eric Walz ......... 2 38 Jay McCareins ..... 1 8 Joel Mancl ........ 1 4 Clinton Wu ....... 1 4 Jon Veach ........ 1 1 Branden Benson .... 1 -2

TD 0 1 0 0 0 0 0 0

Lg 37 80 32 8 4 4 1 0

Rushing Att. Net Joshua Johnston ... 20 62 Luke Siwula ....... 3 7 D.J. Busch ........ 3 2 Brian Romney ..... 1 -1 Ryan Kuhn ....... 10 -6

TD Lg 0 27 0 3 0 3 0 0 0 12

Passing A-C-I Yds Ryan Kuhn ... 27-13-0 208 D.J. Busch .... 10-5-0 112

TD Lg 2 54 1 79

Receiving Rec Yds Brian Romney ..... 5 114 Chad Nice ........ 4 142 Anthony Jackson .... 4 46 Chris Eckstein ...... 3 23 Patrick Blakemore ... 1 1 Joshua Johnston .... 1 -6

TD 2 1 0 0 0 0

Lg 54 79 22 17 1 0

Punting Att Yds Avg Lg I20 Colin McDonough 9 394 43.8 65 1

Punting Att Yds Avg Lg I20 Mike Baumgartel 10 336 33.6 46 3

Field Goal Attempts None

Field Goal Attempts A.J. Weitsman 2nd ... 2:54 .... 36-yards .. Missed 3rd ... 9:48 .... 35-yards .. Missed

Punt Returns: Greg Fields 4-82. Kickoff Returns: Greg Field 2-24, Jay McCareins 2-23. TackleLeaders:Zak Keasey 6-4, Abi Fadeyi 6-3,BrandonMueller3-3,JustinStull3-3. Sacks:AlanBorelli1-4,JamesWilliams11. Tacklesforloss:AbiFadeyi3-4,ZakKeasey 2-12,AlanBorelli2-5,JayMcCareins1-10, Charles Bahlert 1-8, Peter Kelly 1-8, Tim Boardman 1-1, Jake Marshall 1-1, Justin Stull1-1,JamesWilliams1-1. Forced Fumble: Abi Fadeyi. Passbreakups:J.J.Artis,BrandonMueller, Dave Ochotorena.

Punt Returns: Brian Romney 6-37. KickoffReturns:Anthony Jackson 3-88. TackleLeaders:Brad Kitlowski 5-4, Jason Cloyd5-1,JonathanLucas5-1,SeanNassoiy 4-2, Mike McGinty 2-3. Sacks: Mike McGinty 1-8. Tackles for loss: Mike McGinty 4-13, Jonathan Lucas 3-12, Matt Pollock 1-2, Nate Tarsi 1-2, Patrick Potts 1-1, Ryan Lempa 1-1. Interceptions:NateTarsi1-3,JasonCloyd 1-0. Forced Fumble: Jeff Hahn. Pass breakups: Matt Grant 2, Jeff Hahn 2, Ryan Lempa 2, Kevin Rex.

Dartmouth Individual Stats

Cornell Individual Stats

Rushing Att. Net Chad Gaudent .... 10 37 Pat Risha ......... 1 2 Dan Shula ........ 1 1 ChrisLittle ........ 5 0 Bob Murphy ....... 1 0 Steve Hunt ....... 1 -3 Charlie Rittgers .... 5 -23

TD Lg 0 10 0 2 0 1 0 4 0 0 0 0 0 0

Rushing Att. Net Joshua Johnston ... 30 42 Brian Romney ..... 1 0 Ryan Kuhn ........ 6 -4 D.J. Busch ........ 1 -20

TD Lg 0 5 0 0 0 11 0 0

Passing A-C-I Yds Ryan Kuhn ... 22-12-1 135 D.J. Busch .... 13-7-0 74

TD Lg 1 50 0 22

Passing A-C-I Yds Charlie Rittgers 16-11-0 175 Dan Shula .... 11-4-1 47

TD Lg 1 73 0 26

2nd Quarter C—Tarsi 50-yardfumble return (Zell kick),14:46 C—Nice 50-yard pass from Kuhn (Zellkick),11:17

Receiving Rec Yds Bob Murphy ....... 6 113 Andrew Hall ....... 3 31 Ryan Fuselier ...... 2 23 JoeKillefer ........ 1 26 Sam McDonald .... 1 20 ChrisLittle ........ 1 5 Ray Rochester ..... 1 4

TD 1 0 0 0 0 0 0

Receiving Rec Yds Brian Romney ..... 8 95 Chad Nice ........ 5 77 Anthony Jackson .... 3 12 Chris Eckstein ...... 2 17 Joshua Johnston .... 1 8

TD 0 1 0 0 0

3rd Quarter D—Murphy 73-yard pass from Rittgers(Hinterbichlerkick),6:04

Punting Att Yds Avg Lg I20 Grant Wagner 11 395 35.9 45 5

4th Quarter No scoring

Field Goal Attempts None

Team Stats Dartmouth Cornell First downs 7 13 Rushes-yards 24-14 40-16 Passing 222 209 Passing A-C-I 27-15-1 35-19-1 Total plays-yards 51-236 75-225 Return yards 2-23 2-28 Punts-avg. 11-35.9 10-36.5 Fumbles-lost 2-2 1-0 Penalties-yards 6-40 5-39 3rd down con. 1-13 6-21 4th down con. 0-0 0-1 Time of possession 25:18 34:42

Punt Returns: Steve Hunt 4-8. KickoffReturns:Steve Jensen 2-23. Tackle Leaders: Anthony Gargiulo 8-4, Mike Ribero 7-4, Steve Jensen 7-0, Derham Cato 5-2, Chris Dodds 2-5. Sacks: Anthony Gargiulo 4-21, Mike Rabil 1-7, Josh Dooley 1-6, Ryan Conger 1-3. Tackles for loss: Anthony Gargiulo 6-30, Ryan Conger 3-6, Chris Dodds 2-2, Derham Cato1-10,MikeRabil1-7,JoshDooley1-6. Interception: Mike Rabil 1-0. Forced Fumble: Anthony Gargiulo. Pass breakups: Clayton Smith 2, Mike Rabil,MikeRibero.

Schoellkopf Field

Behindanotherstrongeffortfromits defense and a pair of second-quarter touchdowns, the Cornell football team won its second consecutive game with a 14-7 home triumph over Dartmouth atSchoellkopfField. After a first quarter which saw the two teams combine for just 66 total yards, the Big Red came through with 50-yard scoring plays on both sides of the ball to post a 14-0 lead in the second quarter. Dartmouth quarterback Dan Shula completed a pass to Andrew Hall at midfield, but Cornell safety Brad Kitlowski jarred the ball loose and Nate Tarsi picked up the fumble and raced to the end zone for thegame’sfirstscore. After the Big Red forced Dartmouth topuntafterthreeplaysontheensuing possession, the home team started its drive at its own 30-yard line. An unsportsmanlike conduct call against Dartmouth on third down helped to continueCornell’sdrive,whichculminated in a 50-yard touchdown pass off of a spectacular play fake from Ryan Kuhn to Chad Nice. Freshman kicker Peter Zell earned the first two points of his career with successful PAT attempts on both Big Red touchdowns. The Cornell defense allowed just twofirstdownsfromthevisitorsinthe firsthalfandenteredthebreakwiththe 14-point cushion. Charlie Rittgers replaced Shula at quarterbackearlyoninthethirdquarter and promptly completed passes on

2005 FOOTBALL

Ithaca, N.Y.

fourofhisfirstfiveattempts,including a 73-yard touchdown pass along the right sideline to Bob Murphy. A successful extra-point attempt by Erik Hinterbichler cut the deficit in half, making it a 14-7 contest. The scoring playenteredtheBigGreenrecordbooks, tying for the ninth-longest touchdown pass in program history. Dartmouth 0 0 Cornell 0 14

7 0

0 0

— —

7 14

1st Quarter No scoring

Lg 73 12 17 26 20 5 4

Lg 22 50 7 12 8

Punting Att Yds Avg Lg I20 Mike Baumgartel 10 365 36.5 49 2 Field Goal Attempts Peter Zell 4th ... 14:05 ... 32-yards .. Missed Punt Returns: Brian Romney 6-22. KickoffReturns:Anthony Jackson 2-28. TackleLeaders:Kevin Rex 3-4, Ryan Lempa 2-5,PatrickPotts4-2,BradKitlowski2-4, JasonCloyd2-4. Sacks: Patrick Potts 2-8, Ryan Lempa 2-4, Dan Collins 1-8, Jeff Hahn 1-3. Tacklesforloss:PatrickPotts2-8,JeffHahn 2-5, Ryan Lempa 2-4, Dan Collins 1-8, Jason Cloyd 1-3, Mike McGinty 1-2, Matt Pollock1-2,JonathanLucas1-1. Interception: Sean Nassoiy 1-0. Forced Fumbles: Brad Kitlowski, Kevin Rex. Fumble Returns: Nate Tarsi 1-50, Kevin Rex 1-11. Pass breakups: Nate Tarsi 2, Ryan Lempa, PatrickPotts.

2004 IN REVIEW/IVY LEAGUE GAME 9 Nov. 13, 2004

CORNELL 32, COLUMBIA 26 Wien Stadium

In one of the most improbable comebacksinCornellfootballhistory, the Big Red rallied from a 26-7 deficit with 9:33 to play for a 32-26 victory over Columbia at Wien Stadium. D.J. Busch threw a pair of fourth-quarter touchdowns, including the game winner, as the Big Red became the second Ivy League team to go 0-7 one season and clinch a winning record the next. Cornellregistered422yardsoftotal offense on the afternoon, including 291 in the air. Busch tallied 178 yards in the air on 10-of-14 passing for two touchdowns, while Ryan Kuhn had 113 yards. Joshua Johnston rushed for 71 yards and two touchdowns on 21 carriestoleadtheCornellgroundgame, while Chad Nice and Brian Romney combined for 15 catches for 190 yards, with each player catching a touchdown. Sean Nassoiy led the defensive effort with a pair of fourth quarter interceptionsleadingtoBigRedtouchdowns. Kevin Rex had a game-high 14 tackles and a sack. Rashad Biggers had 21 carries for 70 yards and two scores, while Jeff Otis passed for 193 yards and a touchdown. He was also intercepted once. Backup Craig Hormann had 68 yards and a touchdown in the air, with the primary recipient being Brandon Bowser, who had six catches for 116 yards and two touchdowns. The win was the third straight for Cornell, its longest streak since the 2000 season, and the first of the year on the road, snapping a seven-game roadlosingskid.

GAME 10 Nov. 20, 2004

Cornell Columbia

New York, N.Y.

0 7

7 25 0 12

— —

32 26

1st Quarter Col—Biggers 4-yard run (Rudd kick), 10:20 2nd Quarter Col—Bowser 39-yard pass from Otis (Rudd kick), 14:53 3rd Quarter Cor—Kuhn 5-yard run (MacMeekin kick),6:58 4th Quarter Col—Bowser 14-yard pass from Hormann (Rudd kick failed), 14:55 Col—Biggers 8-yard run (Hormann passfailed),11:29 Cor—Johnston 1-yard run (Johnston rushfailed),9:33 Cor—Johnston 1-yard run (MacMeekin kick), 6:08 Cor—Nice 23-yard pass from Busch (MacMeekin kick blocked), 5:17 Cor—Romney 38-yard pass from Busch(Zellkickfailed),0:37 Team Stats Cornell Columbia First downs 21 20 Rushes-yards 42-131 34-69 Passing 291 261 Passing A-C-I 36-21-2 46-25-2 Total plays-yards 78-422 80-330 Return yards 5-102 5-76 Punts-avg. 6-37.3 7-39.6 Fumbles-lost 2-1 1-0 Penalties-yards 6-42 2-15 3rd down con. 8-16 8-18 4th down con. 1-2 1-3 Time of possession 29:26 30:34

PENN 20, CORNELL 14 Schoellkopf Field

Ithaca, N.Y.

a pass and broke up two others. Matt Pollockwasaforceinthemiddlewithfive tackles,includingtwoforlossandasack aswellastwopassdeflections.BothNate TarsiandDanCollinsblockedakicktohelp Cornellsetanewschoolrecordwitheight blocksinaseason. Penn Cornell

7 0

6 0 0 14

— —

20 14

1st Quarter P—Fallon 17-yard interception return (Zoch kick), 10:07 2nd Quarter P—Stanton 5-yard pass from Marabella (Zoch kick), 0:16 3rd Quarter P—Ambrogi 14-yard run (Zoch kick failed),0:07 4th Quarter Cor—Busch 1-yard run (Weitsman kick),8:44 Cor—Johnston 4-yard run (Weitsman kick),4:54 Team Stats Penn Cornell First downs 18 16 Rushes-yards 31-88 43-89 Passing 262 232 Passing A-C-I 37-20-1 29-15-2 Total plays-yards 68-350 72-321 Return yards 2-22 4-82 Punts-avg. 7-41.0 7-32.4 Fumbles-lost 2-2 3-2 Penalties-yards 5-55 2-20 3rd down con. 5-16 5-16 4th down con. 1-1 1-2 Time of possession 28:02 31:58

Columbia Individual Stats

Rushing Att. Net Joshua Johnston ... 21 71 Ryan Kuhn ....... 11 31 Marcus Blanks ..... 3 13 Brian Romney ..... 3 10 Anthony Jackson .... 1 7 Chi Chi Ibegbu ..... 1 1 D.J. Busch ........ 2 -2

TD 2 1 0 0 0 0 0

Lg 13 11 11 7 7 1 0

Passing A-C-I Yds D.J. Busch .... 13-9-0 172 Ryan Kuhn ... 23-12-2 119

TD Lg 2 41 0 22

Receiving Rec Yds Chad Nice ........ 8 98 Brian Romney ..... 8 98 Anthony Jackson .... 3 57 Chris Eckstein ...... 1 20 Joshua Johnston .... 1 18

TD 1 1 0 0 0

Lg 23 38 41 20 18

Punting Att Yds Avg Lg I20 Mike Baumgartel 6 224 37.3 56 2 Field Goal Attempts None Punt Returns: Brian Romney 5-39. KickoffReturns: Anthony Jackson 5-102. TackleLeaders:Kevin Rex 6-8, Dan Collins 5-5, Brad Kitlowski 3-7, Jason Cloyd 4-3, Nate Tarsi 3-3. Sacks: Mike McGinty 1-8, Kevin Rex 1-8, JeffHahn1-5. Tackles for loss: Jeff Hahn 2-9, Mike McGinty 1-8, Kevin Rex 1-8, Ryan Lempa 1-3,PatrickPotts1-2,NateTarsi1-2,Dan Collins1-1. INTs: Sean Nassoiy 2-45. Pass breakups: Jason Cloyd 2, Jonathan Lucas.

Penn Individual Stats

Rushing Att. Net Rashad Biggers ... 21 70 Ayo Oluwole ...... 6 15 Nick Rudd ........ 1 9 Craig Hormann .... 2 -7 JeffOtis .......... 4 -18

TD Lg 2 13 0 7 0 9 0 1 0 4

Passing A-C-I Yds JeffOtis ..... 33-16-1 193 Craig Hormann 13-9-1 68

TD Lg 1 42 1 14

Receiving Rec Yds Nic DeGasperis .... 8 52 Brandon Bowser .... 6 116 Wade Fletcher ..... 3 37 Pete Chromiak ..... 2 28 John Reuter ....... 2 14 Gordon Radlein .... 2 9 Adrian Demko ..... 1 5 Mike DeFazio ...... 1 0

TD 0 2 0 0 0 0 0 0

Lg 13 42 26 22 9 7 5 0

Punting Att Yds Avg Lg I20 Nick Rudd .... 7 277 39.6 56 1 Field Goal Attempts None Punt Returns: Tad Crawford 1-17. Kickoff Returns: Brandon Bowser 3-38, Tad Crawford 2-38. TackleLeaders:ProsperNwokocha5-4,Bill Beechum 3-5. Sacks:KirkMullings1-5. Tackles for loss:Mike Quarshie 2-2, Kirk Mullings1-5,ToddAbrams1-1,TadCrawford 1-1, Dan Daylamani 1-1, Shay Murphy 1-1. INTs: Shay Murphy 1-3, Keenan Shaw 1-0. Blocked Kick: Adam Brekke. Forced Fumble: Bayo Aregbe. Fumble Recovery: Mike Quarshie. Pass breakups: Chuck Britton, Tad Crawford,EvanTryforos.

Cornell Individual Stats

Rushing Att. Net Kyle Ambrogi ..... 17 49 Von Bryant ........ 5 18 Matt Makovsky ..... 3 12 TEAM ........... 6 9

TD Lg 1 14 0 8 0 7 0 6

Passing A-C-I Yds Bryan Walker . 36-19-1 257 Gabe Marabella . 1-1-0 5

TD Lg 0 57 1 5

Receiving Rec Yds Dan Castles ....... 8 124 Matt Carre ....... 4 67 Gabe Marabella .... 4 35 Kyle Ambrogi ...... 2 9 Kevin DeSmedt .... 1 22 J.J.Stanton ....... 1 5

TD 0 0 0 0 0 1

Lg 53 57 23 8 22 5

Punting Att Yds Avg Lg I20 Josh Appel .... 7 287 41.0 58 1 Field Goal Attempts Derek Zoch 2nd ... 9:09 .... 36-yards .. Blocked 3rd ... 8:26 .... 44-yards .. Missed 4th ... 10:41 ... 39-yards .. Blocked Punt Returns: Matt Carre 2-9. Kickoff Returns: Von Bryant 1-12, Duvol Thompson 1-10. Tackle Leaders: Kory Gedin 9-2, Scott Williams 5-2, Michael Sangobowale 5-1. Sacks:ScottWilliams2-9,BobbyFallon1-3, MichaelSangobowale1-3,LukeHadden1-2. Tacklesforloss:CaseyEdgar2-5,Michael Johns 2-4,Greg Jones 2-2, Scott Williams 1.5-9, Kyle Ambrogi 1-3, Luke Hadden 12, Bryan Arguello 1-1, Kory Gedin 1-1, Naheem Harris 1-1, Bobby Fallon 0.5-3. INTs:BobbyFallon1-17,MichaelJohns1-0. FumbleRecovery:KevinJunge,BradMartinez. Pass breakups:Michael Johns 2, Bobby Fallon,J.J.Stanton.

Rushing Att. Net Joshua Johnston ... 18 71 Ryan Kuhn ....... 12 21 D.J. Busch ........ 6 4 Chi Chi Ibegbu ..... 4 2 Anthony Jackson .... 1 -1

TD Lg 1 18 0 12 1 5 0 3 0 0

Passing A-C-I Yds D.J. Busch ... 19-11-2 177 Ryan Kuhn ..... 9-3-0 32 Mike Baumgartel 1-1-0 23

TD 0 0 0

Lg 50 16 23

Receiving Rec Yds Brian Romney ..... 7 115 Anthony Jackson .... 3 71 Chad Nice ........ 2 27 Joshua Johnston .... 2 -4 Nate Tarsi ........ 1 23

TD 0 0 0 0 0

Lg 30 50 16 0 23

Punting Att Yds Avg Lg I20 Mike Baumgartel 7 227 32.4 43 2 Field Goal Attempts A.J. Weitsman 2nd ... 5:26 .... 41-yards .. Missed Punt Returns: Brian Romney 5-26. KickoffReturns:Anthony Jackson 4-82. TackleLeaders:Kevin Rex 6-3, Nate Tarsi 6-1, Jason Cloyd 5-1, Dan Collins 5-1. Sacks:Matt Pollock 1-9. Tackles for loss:Matt Pollock 2-14, Sean Nassoiy2-2,JonathanLucas1-2,KevinRex 1-1, Dan Collins 0.5-2, Ryan Lempa 0.5-1. INTs: Kevin Rex 1-0. Forced Fumble: Jonathan Lucas. Fumble Recovery: Sean Nassoiy, Rich Trumka. Blocked Kick: Dan Collins, Nate Tarsi. Pass breakups: Matt Pollock 2, Kevin Rex 2, Jason Cloyd, Jonathan Lucas, Sean Nassoiy.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

The script had already been written the week before in one of the great comebacksinschoolhistory.Justseven dayslater,playinginfrontofaSenior Day crowd at Schoellkopf Field, the Cornell football team looked to spring an even larger surprise on defending Ivy League champion Penn, but this time the Quakers rewrote the ending in earning a 20-14 win over the Big Red. Trailing 20-0 with nine minutes to play,Cornellscoredconsecutivetouchdowns and looked to be driving for the go-ahead score with under two minutes to play, but Penn cornerback Michael Johns intercepted a D.J. Busch pass in the end zone to preserve the victory. Trailing20-0afterthreeperiods,the Big Red took advantage of a blocked field goal and a Quaker fumble to score twice in less than four minutes. Busch ranoverfromthe1-yardlinetocapa51yard drive, and Joshua Johnston followed with a 4-yard carry for another touchdown to bring Cornell within six points. The Big Red defense forced Penntopuntandtookoveratits36with justoverthreeminutestoplay.TheBig Red quickly moved to the Quakers’ 25, buthisnextpassslippedoutofhishands and was intercepted by Johns. Johnston ended the game with 77 yardsrushingon18carriestogoalongwith hisscore,whileBuschledthewaythrough theairwith11-of-19passingfor177yards. The main recipient was Romney, who madesevencatchesfor115yards.Defensively, Kevin Rex had a team-high nine tackles,includingoneforaloss,intercepted

Cornell Individual Stats

2004 IN REVIEW/IVY LEAGUE 2004 IVY LEAGUE STANDINGS Standings Harvard Penn Cornell Brown Princeton Yale Columbia Dartmouth

LEAGUE W-L-T Pct. 7-0-0 1.000 6-1-0 .857 4-3-0 .571 3-4-0 .429 3-4-0 .429 3-4-0 .429 1-6-0 .167 1-6-0 .167

OVERALL W-L-T Pct. 10-0-0 1.000 8-2-0 .800 4-6-0 .400 6-4-0 .600 5-5-0 .500 5-5-0 .500 1-9-0 .100 1-9-0 .100

2004 All-Ivy Offense First Team *Brian Edwards (Sr., Harvard) Dan Castles (Sr., Penn) Jarrett Schreck (Jr., Brown) Wade Fletcher (Sr., Columbia) *Kevin Boothe (Sr., Cornell) Brian Lapham (Sr., Harvard) Rory Hennessey (Sr., Yale) Will Burroughs (Sr., Brown) Will Johnson (Jr., Harvard) *Ryan Fitzpatrick (Sr., Harvard) *Nick Hartigan (Jr., Brown) *Clifton Dawson (So., Harvard) Matt Schindel (Fr., Harvard)

Pos. WR WR WR TE OL OL OL OL OL QB RB RB RB PK

2004 All-Ivy Defense

WWW .CORNELL B IG R ED . COM

First Team Michael Quarshie (Sr., Columbia) Anthony Gargiulo (Jr., Dartmouth) Ryan Conger (Sr., Dartmouth) Mike Sangobowale (Sr., Penn) *Bobby Everett (Sr., Harvard) Zak DeOssie (So., Brown) Luke Hadden (Sr., Penn) Zak Keasey (Sr., Princeton) *Duvol Thompson (Sr., Penn) Clayton Smith (Sr., Dartmouth) Jay McCareins (Jr., Princeton) Sean Tracy (Sr., Harvard) *Josh Appel (Sr., Penn)

Pos. DL DL DL DL LB LB LB LB DB DB DB DB P

* = unanimous selection Second Team Ralph Plumb (Sr., Yale) Correy Mazza (So., Harvard) David Turner (Jr., Brown) Michael Pierce (Sr., Penn) Kevin Coco (Sr., Columbia) Ed McCarthy (So., Yale) Jeremy Moore (Sr., Princeton) Alex Jury (Jr., Brown) Alvin Cowan (Sr., Yale) Robert Carr (Sr., Yale) Rashad Biggers (Sr., Columbia) Sam Mathews (Jr., Penn) Steve Morgan (Fr., Brown) * = unanimous selection Second Team Ryan Lempa (Sr., Cornell) James Frazier (So., Brown) Mike Berg (So., Harvard) Bobby Fallon (Sr., Penn) Matt Thomas (Jr., Harvard) Justin Stull (Jr., Princeton) Ben Breunig (Sr., Yale) Josh Dooley (Jr., Dartmouth) Gary Sonkur (Sr., Harvard) Kevin Rex (Jr., Cornell) Barton Simmons (Sr., Yale) Jamie Gasparella (Jr., Brown) Colin McDonough (So., Princeton)

Honorable Mention Offense Wide Receiver — Brian Romney (Jr., Cornell); Chandler Henley (Jr., Yale); Greg Fields (Jr., Princeton). Tight End — Jon Dekker (Jr., Princeton); Chris Mizell (So., Penn). Linemen — Don Snyder (Jr., Penn); Luke Catenacci (Sr., Dartmouth); Frank Fernandez (So., Harvard); Vik Tiku (Sr., Dartmouth). Quarterbacks — Pat McDermott (Jr., Penn). Running Back — Jon Veach (Sr., Princeton). Place-Kicker — Derek Javarone (Jr., Princeton). Honorable Mention Defense Linemen — Brandon Dyches (Jr., Yale); Matt McBurney (Sr., Harvard). Linebackers — Chuck Britton (Sr., Columbia); Abi Fadeyi (Jr.,Princeton). Secondary — Sean Nassoiy (Sr., Cornell); Kevin Stefanski (Sr., Penn); Prosper Nwokocha (Jr., Columbia); Kenan Shaw (Jr., Columbia); Keith Howell (Jr., Harvard); Michael Johns (Jr., Penn); Casey Edgar (So., Penn); Tim Strickland (So., Princeton); Fred Jelks (Sr., Yale). Punter — Steve Morgan (Fr., Brown). Player of the Year *Ryan Fitzpatrick, Harvard (Sr., QB) Rookie of the Year Steve Morgan, Brown (Fr., PK/P)

2005 FOOTBALL

Ivy League Champions 1956-2004 Year 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Team ................ Record Yale ................... 7-0-0 Princeton ............... 6-1-0 Dartmouth ............. 6-1-0 Penn .................. 6-1-0 Yale ................... 7-0-0 Columbia .............. 6-1-0 Harvard ................ 6-1-0 Dartmouth ............. 7-0-0 Dartmouth ............. 5-2-0 Princeton ............... 5-2-0 Princeton ............... 7-0-0 Dartmouth ............. 7-0-0 Dartmouth ............. 6-1-0 Harvard ................ 6-1-0 Princeton ............... 6-1-0 Yale ................... 7-0-0 Yale ................... 6-0-1 Harvard ................ 6-0-1 Dartmouth ............. 6-1-0 Yale ................... 6-1-0 Princeton ............... 6-1-0 Dartmouth ............. 7-0-0 Cornell ................ 6-1-0 Dartmouth ............. 6-1-0 Dartmouth ............. 5-1-1 Dartmouth ............. 6-1-0 Harvard ................ 6-1-0 Yale ................... 6-1-0 Harvard ................ 6-1-0 Brown ................. 6-1-0 Yale ................... 6-1-0 Yale ................... 6-1-0 Dartmouth ............. 6-1-0 Yale ................... 6-1-0 Yale ................... 6-1-0 Dartmouth ............. 6-1-0 Yale ................... 6-1-0 Harvard ................ 5-2-0 Penn .................. 5-2-0 Dartmouth ............. 5-2-0 Harvard ................ 5-1-1 Penn .................. 5-1-1 Penn .................. 7-0-0 Penn .................. 6-1-0 Penn .................. 7-0-0 Harvard ................ 6-1-0 Cornell ................ 6-1-0 Penn .................. 6-1-0 Princeton ............... 6-1-0 Yale ................... 6-1-0 Cornell ................ 6-1-0 Dartmouth ............. 6-1-0 Dartmouth ............. 6-0-1 Dartmouth ............. 6-1-0 Princeton ............... 6-1-0 Penn .................. 7-0-0 Penn .................. 7-0-0 Princeton ............... 5-1-1 Dartmouth ............. 7-0-0 Harvard ................ 7-0-0 Penn .................. 6-1-0 Brown ................. 6-1-0 Yale ................... 6-1-0 Penn .................. 6-1-0 Harvard ................ 7-0-0 Penn .................. 7-0-0 Penn .................. 7-0-0 Harvard ................ 7-0-0

2004 IN REVIEW/IVY LEAGUE The Asa S. Bushnell Cup

2004 Final Ivy League Team Statistics SCORING OFFENSE Harvard Penn Brown Princeton Yale Cornell Columbia Dartmouth

G 10 10 10 10 10 10 10 10

TD 43 32 27 25 23 21 19 14

XP 34 25 26 22 23 15 14 9

2XP 4 0 0 0 0 1 0 0

DXP 0 0 0 0 0 0 0 0

FG 13 7 13 13 6 8 4 5

Saf 0 0 0 0 0 0 0 0

Pts 339 238 227 211 179 167 140 108

Avg 33.9 23.8 22.7 21.1 17.9 16.7 14.0 10.8

SCORING DEFENSE Harvard Penn Cornell Brown Dartmouth Princeton Yale Columbia

G 10 10 10 10 10 10 10 10

TD 17 17 26 24 25 28 25 36

XP 14 12 18 21 25 19 24 31

2XP 0 1 2 1 0 1 0 0

DXP 0 0 0 0 0 0 0 0

FG 6 9 1 9 10 6 11 6

Saf 0 1 0 0 0 0 0 0

Pts 134 145 181 194 205 207 207 265

Avg 13.4 14.5 18.1 19.4 20.5 20.7 20.7 26.5

PASS OFFENSE Penn Cornell Yale Brown Dartmouth Columbia Harvard Princeton

G 10 10 10 10 10 10 10 10

Att 367 342 328 312 380 369 283 296

Cmp 197 176 181 158 196 208 163 167

Int 7 11 10 11 16 12 6 8

Pct. .537 .515 .552 .506 .516 .564 .576 .564

Yards 2,462 2,172 2,140 2,140 2,108 2,077 2,051 1,768

Avg. 6.7 6.4 6.5 6.9 5.5 5.6 7.2 6.0

T D Yds/G 14 246.2 8 217.2 16 214.0 8 214.0 9 210.8 8 207.7 16 205.1 7 176.8

PASS DEFENSE Columbia Princeton Harvard Penn Brown Yale Cornell Dartmouth

G 10 10 10 10 10 10 10 10

Att 266 283 333 314 295 313 320 367

Cmp 155 133 164 180 173 188 174 209

Int 9 9 13 11 11 8 9 8

Pct. .583 .470 .492 .573 .586 .601 .544 .569

Yds 1,741 1,768 1,894 1,975 1,981 2,118 2,276 2,315

Avg. 6.5 6.2 5.7 6.3 6.7 6.8 7.1 6.3

T D Yds/G 17 174.1 9 176.8 7 189.4 7 197.5 8 198.1 8 211.8 15 227.6 13 231.5

RUSHING OFFENSE Harvard Brown Princeton Penn Yale Columbia Cornell Dartmouth

G 10 10 10 10 10 10 10 10

Att 472 440 380 350 335 352 372 316

Yards 2,091 1,478 1,424 1,296 1,185 1,099 937 733

Avg. 4.4 3.4 3.7 3.7 3.5 3.1 2.5 2.3

T D Yds/G 22 209.1 19 147.8 15 142.4 15 129.6 7 118.5 9 109.9 12 93.7 5 73.3

RUSHING DEFENSE Cornell Dartmouth Harvard Brown Penn Princeton Yale Columbia

G Rush 10 351 10 371 10 347 10 374 10 422 10 431 10 448 10 454

Yards 1,011 1,077 1,168 1,183 1,287 1,459 1,565 1,776

Avg. 2.9 2.9 3.4 3.2 3.0 3.4 3.5 3.9

T D Yds/G 9 101.1 6 107.7 10 116.8 14 118.3 10 128.7 19 145.9 15 156.5 18 177.6

TOTAL OFFENSE Harvard Penn Brown Yale Princeton Columbia Cornell Dartmouth

G 10 10 10 10 10 10 10 10

Rush 2,091 1,296 1,478 1,185 1,424 1,099 937 733

Pass 2,051 2,462 2,140 2,140 1,768 2,077 2,172 2,108

Plays 755 717 752 663 676 721 714 696

Yards 4,142 3,758 3,618 3,325 3,192 3,176 3,109 2,841

Avg./P 5.5 5.2 4.8 5.0 4.7 4.4 4.4 4.1

TD 38 29 27 23 22 17 20 14

Yds/G 414.2 375.8 361.8 332.5 319.2 317.6 310.9 284.1

TOTAL DEFENSE Harvard Brown Princeton Penn Cornell Dartmouth Columbia Yale

G 10 10 10 10 10 10 10 10

Rush 1,168 1,183 1,459 1,287 1,011 1,077 1,776 1,565

Pass 1,894 1,981 1,768 1,975 2,276 2,315 1,741 2,118

Plays 680 669 714 736 671 738 720 761

Yards 3,062 3,164 3,227 3,262 3,287 3,392 3,517 3,683

Avg 4.5 4.7 4.5 4.4 4.9 4.6 4.9 4.8

TD 17 22 28 17 24 19 35 23

Yds/G 306.2 316.4 322.7 326.2 328.7 339.2 351.7 368.3

Ivy League Player of the Year The Asa S. Bushnell Cup is an annual award initiated in 1970 which honors Asa S. Bushnell, Princeton ‘21, and commissioner of the Eastern College Athletic Conference from 1938-70. The Bushnell Cup is presented by the Eastern Association of Intercollegiate Football Officials and is awarded by vote of the Ivy League’s eight head football coaches to that player in the league who displays outstanding qualities of leadership, competitive spirit, contribution to the team and accomplishments on thefield. 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Jim Chasey, QB, Dartmouth Ed Marinaro, RB, Cornell Ed Marinaro, RB, Cornell Dick Jauron, RB, Yale Jim Stoeckel, QB, Harvard Walt Snickenberger, RB, Princeton Doug Jackson, RB, Columbia John Pagliaro, RB, Yale John Pagliaro, RB, Yale Buddy Teevens, QB, Dartmouth Tim Tumpane, LB, Yale Kevin Czinger, MG, Yale Rich Diana, RB, Yale John Witkowski, QB, Columbia Derrick Harmon, RB, Cornell Tim Chambers, DB, Penn Tom Gilmore, DT, Penn Rich Comizio, RB, Penn Kelly Ryan, QB, Yale Jason Garrett, QB, Princeton Judd Garrett, RB, Princeton Shon Page, RB, Dartmouth Al Rosier, RB, Dartmouth Jay Fiedler, QB, Dartmouth KeithElias,RB,Princeton Pat Goodwillie, LB, Penn Dave Patterson, LB, Princeton Chad Levitt, RB, Cornell Sean Morey, WR, Brown Jim Finn, RB, Penn James Perry, QB, Brown Gavin Hoffman, QB, Penn Carl Morris, WR, Harvard Carl Morris, WR, Harvard Mike Mitchell, QB, Penn Ryan Fitzpatrick, QB, Harvard

Ivy League Rookie of the Year Established in 1981 as the sophomore of the year, the name was changed in 1993 to reflect freshman eligibility. The award is determined by a vote of the eight head football coaches. Derrick Harmon, RB, Cornell Mike Caraviello, QB, Dartmouth Doug Butler, QB, Princeton Rich Comizio, RB, Penn Chris Flynn, RB, Penn Craig Morton, WR, Dartmouth Bryan Keys, RB, Penn Solomon Johnson, RB, Columbia John McNiff, RB, Cornell Matt Brzica, QB, Dartmouth Jay Fiedler, QB, Dartmouth Pat Goodwillie, LB, Penn Miles Macik, WR, Penn Eion Hu, RB, Harvard Sean Morey, WR, Brown Isaiah Kacyvenski, LB, Harvard Todd Tomich, DB/KR, Yale Johnathan Reese, RB, Columbia Chas Gessner, WR, Brown Dante Balestracci, LB, Harvard Steve Jensen, DB, Dartmouth Josh Dooley, LB, Dartmouth Ed McCarthy, OL, Yale Steve Morgan, PK/P, Brown

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

2004 IN REVIEW/IVY LEAGUE 2004 Final Ivy League Individual Statistics RUSHING OFFENSE Clifton Dawson, Harvard Nick Hartigan, Brown Rob Carr, Yale Rashad Biggers, Columbia Sam Mathews, Penn

G 10 10 10 10 10

Att 248 323 252 197 178

Yds 1,302 1,263 1,185 770 716

Avg. 5.2 3.9 4.7 3.9 4.0

T D Yds/G 17 130.2 17 126.3 7 118.5 6 77.0 7 71.6

WWW .CORNELL B IG R ED . COM

PASS OFFENSE G Att C m p Int Pct. Yds T D Yds/G Pat McDermott, Penn 9 294 158 5 .537 1,995 12 221.7 Alvin Cowan, Yale 10 325 181 10 .557 2,140 16 214.0 CharlieRittgers,Dart. 9 320 170 14 .531 1,866 8 207.3 RyanFitzpatrick,Harv. 10 276 158 6 .572 1,986 13 198.6 Joe DiGiacomo, Brown 8 216 112 9 .519 1,514 4 189.2

TOTAL OFFENSE RyanFitzpatrick,Harv. Pat McDermott, Penn Alvin Cowan, Yale Joe DiGiacomo, Brown CharlieRittgers,Dart.

G 10 9 10 8 9

Rush 448 47 -6 64 -147

Pass 1,986 1,995 2,140 1,514 1,866

Plays 394 343 386 268 359

Yds 2,434 2,042 2,134 1,578 1,719

Yds/G 243.4 226.9 213.4 197.2 191.0

RECEIVING YDS/G Jarret Schreck, Brown Dan Castles, Penn Ralph Plumb, Yale Corey Mazza, Harvard Brian Romney, Cornell

G 10 10 10 10 10

Rec. 62 70 79 51 59

Yds 1,035 966 939 773 760

TDs 3 8 5 7 3

YPC 16.7 13.8 11.9 15.2 12.9

Yds/G 103.5 96.6 93.9 77.3 76.0

ALL-PURPOSE Rob Carr, Yale Greg Fields, Princeton Clifton Dawson, Harvard Brian Edwards, Harvard Nick Hartigan, Brown

G Rush 10 1,185 10 169 10 1,302 10 109 10 1,263

Rec 15 511 129 646 128

Yds 90 48 42 138 41

KR 489 521 0 321 0

Yds Yds/G 1,709 170.9 1,572 157.2 1,431 143.1 1,424 142.4 1,391 139.1

INTERCEPTIONS Clayton Smith, Dartmouth SeanNassoiy,Cornell Tim Strickland, Princeton R. Williamson, Harvard Sean Tracy, Harvard

G 10 10 10 9 10

ALL-PURPOSE RyanFitzpatrick,Harv. Alvin Cowan, Yale Pat McDermott, Penn Matt Verbit, Princeton Joe DiGiacomo, Brown

Att C m p INT Pct. Yds T D Eff 276 158 6 .572 1,986 13 128.9 325 181 10 .557 2,140 16 121.1 294 158 5 .537 1,995 12 120.8 291 167 8 .574 1,768 7 110.9 216 112 9 .519 1,514 4 108.5

G 10 10 9 10 8

INT 4 4 4 3 3

PR 20 371 0 348 0

TD 0 0 0 1 0

INT/G 0.40 0.40 0.40 0.33 0.30

PUNT RETURNS Brian Edwards, Harvard Greg Fields, Princeton Tad Crawford, Columbia Adam Francks, Penn Brandon Markey, Brown

G 10 10 10 9 10

Ret 29 31 13 39 19

Yds 348 371 122 343 142

TD 3 0 0 0 0

Avg 12.0 12.0 9.4 8.8 7.5

KICKOFF RETURNS Brian Edwards, Harvard Prosper Nwokocha, Col. Steve Jensen, Dartmouth Duvol Thompson, Penn Rob Carr, Yale

G 10 10 10 10 10

Ret 12 15 24 10 21

Yds 321 378 581 235 489

TD 1 0 0 0 0

Avg 26.8 25.2 24.2 23.5 23.3

Yds 2,289 2,367 2,087 2,894 1,816

Avg 40.9 37.6 37.3 36.6 36.3

PUNTING Josh Appell, Penn Nick Rudd, Columbia Colin McDonough, Princeton Grant Wagner, Dartmouth Steve Morgan, Brown

2005 FOOTBALL

G 10 10 10 10 10

Punts 56 63 56 79 50

SCORING Clifton Dawson, Harvard Nick Hartigan, Brown Matt Schindel, Harvard Steve Morgan, Brown Derek Javarone, Princeton

G 10 10 10 10 10

FIELD GOALS Matt Schindel, Harvard Derek Javarone, Princeton Steve Morgan, Brown Trevor MacMeekin, Cornell A.Sullivan,Yale

G 10 10 10 8 10

TD 18 17 0 0 0 FG 13 13 13 6 6

TACKLES G Pos Zak Keasey, Princeton 10 LB JustinStull,Princeton 10 LB Ben Breunig, Yale 10 LB Zak DeOssie, Brown 10 LB Barton Simmons, Yale 10 D B Tad Crawford, Columbia 10 D B KevinRex,Cornell 10 S Craig Young, Brown 10 S Matt Thomas, Harvard 10 LB Cole Harris, Yale 10 LB Bobby Everett, Harvard 10 LB Josh Dooley, Dartmouth 10 LB Chris Dodds, Dartmouth 10 SS Steve Jensen, Dartmouth 10 C B Don Smith, Yale 10 DE Luke Hadden, Penn 10 LB Matt Handlon, Yale 10 D B Clayton Smith, Dart. 10 D B Sean Tracy, Harvard 10 D B BradKitlowski,Cornell 10 SS DanCollins,Cornell 10 LB SACKS Anthony Gargiulo, Dart. James Frazier, Brown Matt Thomas, Harvard Ryan Conger, Dart. Zak Keasey, Princeton

G 9 10 10 10 10

XPT 0 0 34 26 22

Pos DE DL LB DE LB

UA 57 46 44 55 54 53 45 37 35 34 39 37 36 49 36 32 28 35 27 25 34

FG 0 0 13 13 13

FGA 17 18 19 11 12 A 70 60 54 43 43 41 41 47 47 45 38 38 36 21 33 34 35 28 36 38 29 UA 8 6 5 4 8

Pct. 76.5 72.2 68.4 54.5 50.0

TOT 127 106 98 98 97 94 86 84 82 79 77 75 72 70 69 66 63 63 63 63 63 A 4 3 3 4 0

TACKLES FOR LOSS Michael Quarshie, Columbia Matt Thomas, Harvard James Frazier, Brown Zak Keasey, Princeton

G 10 10 10 10

TFL 19 18 17 16

FUMBLES FORCED KevinRex,Cornell Luke Hadden, Penn Abi Fadeyi, Princeton Zak DeOssie, Brown Chris Dodds, Dartmouth Josh Dooley, Dartmouth Bryan Arguello, Penn James Frazier, Brown

G 10 10 10 10 10 10 9 10

FF 4 2 2 2 2 2 2 2

FUMBLES RECOVERED Peter Kelly, Princeton Clayton Smith, Dartmouth James Williams, Princeton Steve Jensen, Dartmouth Bobby Everett, Harvard Pat Curran, Brown Doug Middleton, Penn Matt Thomas, Harvard Ryan Lempa, Cornell

G 10 10 10 10 10 10 8 10 10

FR 2 2 2 2 2 2 2 2 2

PASSES DEFENDED Mike Ribero, Dartmouth Clayton Smith, Dartmouth Jay McCareins, Princeton SeanNassoiy,Cornell Steve Jensen, Dartmouth

G 10 10 10 10 10

Brup 13 8 10 5 7

Pts 108 102 73 65 61

AVG/G 12.7 10.6 9.8 9.8 9.7 9.4 8.6 8.4 8.2 7.9 7.7 7.5 7.2 7.0 6.9 6.6 6.3 6.3 6.3 6.3 6.3 Yds 65 51 39 43 64

Pts/G 10.8 10.2 7.3 6.5 6.1 FG/G 1.30 1.30 1.30 0.75 0.60 Sacks 8 4 2 4 0 0 2 0 8 0 1 2 3 0 0 3 1 0 3 1 1 Total 12 9 8 8 8 Yds 74 60 71 86

INT 0 4 2 4 1

Total 13 12 12 9 8

HISTORY

AND

RECORDS

WWW .CORNELL B IG R ED . COM

History and Records 2005 FOOTBALL

HISTORY

Over A Century of Tradition Few collegiate football programs have the storied history of Cornell University. With 118 seasons of football in the books, the Big Red has collected five national titles, won nearly 600 games and has had legendary players and coaches perform on historic Schoellkopf Field. Names such as Glenn “Pop” Warner and Heisman Trophy finalist and NCAA record-breaker Ed Marinaro have suited up for Cornell, while seven College Football Hall of Famers (including Warner, Gil Dobie and Carl Snavely) and multiple-time Super Bowl winner George Seifert have set the strategy as head coaches. Now with Cornell alum Jim Knowles ‘87 leading the program, there’s little doubt that history will continue to be made.

AND

RECORDS

Cornell Football Timeline 1869 The first football game, an intramural contest featuring 40 players per side, occurs on campus. 1874 Cornell president Andrew D. White refuses to let Cornellians travel for a football game against Michigan in Cleveland because “I refuse to let 40 of our boys travel 400 miles merely to agitate a bag of wind.” 1887 Cornell relents, and the first intercollegiate game under modern rules is played against Union College on No. 12, 1887. Union wins the game 24-10 in the contest played where Day and Stimson halls stand today. 1888 Cornell picks up its first win in program history, topping Palmyra 26-0 in the season opener on Oct. 20 en route to a 4-2 record. 1892 Glenn (Pop) Warner ‘94 saw his first football game at Cornell, thinking it was “just a schoolboy scramble with a few bloody noses,” gave it a try, and went on to become the best known of the sport’s pioneering coaches. He caused more rule changes than all other coaches combined. 1897 Warner begins the first of his two coaching stints at Cornell, going 5-3-1 with wins over Syracuse and Penn State. He ended his Cornell career with a 36-13-3 record.

Cornell’s first football team, 1887.

Glenn (Pop) Warner ’94 was a football pioneer.

1901 Cornell wins a record 11 games, going 11-1 under first-year coach Ray Starbuck. Cornell outscores foes 324-38, dropping an 8-6 decision to Princeton in the eighth game of the year. It was the first points the Big Red had allowed all year.

WWW .CORNELL B IG R ED . COM

The Playing Fields

Schoellkopf Field has been an indelible mark of Cornell football since it opened in 1915 and this year will be the 90th season at the home field. A gift from Willard Straight ‘01 and the family of Henry (Heinie) Schoellkopf ‘02 made the construction possible for the current stadium. The Big Red’s first year on the field was one of its best, going 9-0 and winning the national championship. In 1915, General Electric Company completed work on a flood searchlight system for the field, and in 1924 a construction project was completed to bring capacity from 9,000 to 21,500 by adding the famed Crescent. In 1947 that was increased to its current capacity of 25,597 and a press box was added. In 1971 a gift was made to put artificial turf on the field, and it has since been resurfaced three times, the latest in 1999. A new press box was built in 1986. Schoellkopf Memorial Hall, which houses the Big Red football offices, locker rooms and a tradition room, finished a renovation this past summer. Schoellkopf Field is the fourth-oldest Division I-AA stadium, opening in 1915. Only Penn’s Franklin Field (1895), Harvard Stadium (1903) and the Yale Bowl (1914) are older. Its capacity of 25,597 ranks as the eighth-largest stadium in Division I-AA. Tennessee State’s Coliseum seats 67,500 to lead all stadiums. The record crowd, when there were bleachers in the end zones and beneath the Crescent and west stands, was 35,300 for Michigan, Nov. 10, 1951. The playing area before World War I was Percy Field, alongside Fall Creek, the present site of Ithaca High School. 2005 FOOTBALL

In 1951, the Big Red defeated Michigan 20-7 in front of the largest crowd in Schoellkopf history (35,300). Opened: 1915 Record at Schoellkopf Field: 269-149-15 (.639) Largest Football Crowd (all-time): 35,300 vs. Michigan (W, 20-7) on Nov. 10, 1951 Largest Football Crowd (since 1970): 23,000 vs. Columbia (W, 24-21) on Oct. 30, 1971

HISTORY

AND

RECORDS

1915 Cornell picks a great year to open play at Schoellkopf Field. Charley Barrett ‘16 scores a first-quarter TD to lead Cornell to a 10-0 victory over Harvard in a game of unbeatens. The Big Red handed the Crimson its first loss in four years and was declared national champion, the first of five national titles for Cornell.

Jerome “Brud” Holland ‘39 The college football Hall of Famer is known for much more than being the first black football player at Cornell. A two-time firstteam All-American at end, Holland scored 10 career touchdowns, and later watched as his son, Joe Holland ‘78, became one of the school’s all-time leading rushers. But it was his greatness as a statesman that earned him international fame.

1919 The Big Red plays its first of six games in seven years at the Polo Grounds against Dartmouth and Columbia, going 3-3. 1920 Cornell’s all-time winningest coach Gil Dobie leads the Big Red to a 6-2 mark. Dobie’s next three squads would win national championships. 1921 The Big Red goes 8-0, claims the mythical national title and begins its school record 26-game win streak. Cornell outscores its foes 392-21.

Jerome Heartwell Holland Born: Jan. 9, 1916 Died: Jan. 13, 1985 College Football Hall of Fame: Inducted 1965 Cornell Athletics Hall of Fame: Inducted 1978

1922 Cornell wins its second straight crown, going 8-0 and outscoring opponents 33927.

HONORS AND TITLES • U.S. ambassador to Sweden • Chairman American Red Cross • Chairman Salvation Army • Chairman Planned Parenthood • First African American director of the New York Stock Exchange • 1985 Medal of Freedom Award (nation’s highest civilian award) • President of Hampton Institute • President of Delaware State • Trustee Emeritus, Cornell University • Sports Illustrated’s Silver Anniversary Award (outstanding contributions to American life)

Cornell In The Major College Polls Year 1938 1939 1940 1948 1949 1950

1923 National title No. 4 and the third in a row, the Big Red goes 8-0 and blisters foes by a 320-23 margin. 1938 Cornell begins its second longest win streak (18) with a win over Penn State. The streak ends with the Fifth Down game two years later. 1939 The 1939 team goes 8-0 and claims the program’s fifth national crown and is the Lambert Trophy winner, with Cornell defeating Syracuse, Princeton, Penn State, Big Ten champion Ohio State, Columbia, Colgate, Dartmouth and Penn. Cornell overcame a 14-0 deficit in the first quarter to beat powerful Buckeyes 23-14 in Columbus. The rumor of an invite to the Rose Bowl was quickly quelled by the Big Red administration, which did not want to further strain the players ‘ academic situations.

1943 In the heart of World War II, travel restrictions limit options for a venue to play a contest against Dartmouth. They were unable to travel to each other as no rail line ran between Ithaca and Hanover. Instead, the two teams met in Boston and played at Fenway Park in the shadow of the “Green Monster.” The Big Green won 20-0. 1948 Bob Dean ‘49 scores from 1-foot out and kicks the PAT with 2:40 left, giving the Big Red a 27-26 come-from-behind victory over Dartmouth in front of 30,000 fans at

AP 12 4 15 19 12 —

Coaches — — — — — 20

Do You Know Bo? You should ... a sensational three-sport star at Cornell (football, track and field and basketball), Irvin “Bo” Roberson ‘58 still holds the Cornell record for longest kickoff return (100 yards). The late Dick Schaap ‘55, a legendary Cornellian himself, said Roberson was the greatest natural athlete ever in the Ivy League.

All-time greats Bob Dean (left) and Pete Dorset

The Trustees’ Cup Since 1995, the winner of the Cornell-Penn football game has been awarded the Trustees’ Cup. Alumni from Penn and Cornell gathered at the New York Penn Club on Sept. 6, 1995 for the dedication of the Trustees’ Cup, which thereafter has been presented to the winner of the annual football game. The idea evolved from a series of discussions between officials and alumni of both universities, focusing on what would be the best way to honor one of college football’s most celebrated rivalries. The decision was made to establish an award to be presented at an annual luncheon, with the winning team taking the prize home and displaying it for a year.

Top 10 Division I-AA All-Time Wins 1. 2. 3. 4. 5. 6. 7. 8. 9. 10.

Yale ............. 826 Penn ............ 776 Harvard .......... 767 Princeton ......... 757 Fordham ......... 720 Dartmouth ........ 636 Lafayette ......... 612 Delaware ......... 607 Lehigh ........... 601 Cornell .......... 594

The Big Red’s 1948 squad and the 1949 team (pictured here) both won Ivy championships while going 8-1 both years. The 1950 unit went 7-2 for a phenomenal three-year record of 23-4. 2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

1940 The Fifth-Down Game. No. 1 Cornell improved to 6-0 with a 7-3 victory over Dartmouth in Hanover, scoring on the last play of the game. After reviewing game film on Monday, Coach Carl Snavely and acting athletic director Robert J. Kane wire Dartmouth officials to tell them Cornell scored on a fifth down. The Big Green accepts the forfeit, winning the contest 30. Cornell also becomes the only Ivy League school to reach No. 1 in the Associated Press poll, hitting the top spot for three weeks.

Record 5-1-1 8-0-0 6-2-0 9-1-0 8-1-0 7-2-0

HISTORY

Cornell’s National Champions 1915

AND

RECORDS

Schoellkopf Field. The Big Red takes the mythical Ivy League championship with a perfect record behind the feats of Hillary Chollet ‘50 and Pete Dorset ‘50. 1951 Cornell defeats defending Big Ten Conference and Rose Bowl champion Michigan, 20-7, in front of the largest crowd in Schoellkopf history (35,300).

According to Helms Athletic Foundation, Houlgate System, National Championship Foundation and Parke Davis

1921 According to Helms Athletic Foundation, Houlgate, National Championship Foundation and Parke Davis

1922

According to Helms Athletic Foundation and Parke Davis

1923

1963 Pete Gogolak kicks a then-NCAA record 50-yard field goal against Lehigh. He also sets a major college record with 44 consecutive PAT kicks. 1969 Sophomore Ed Marinaro bursts onto the collegiate scene with a 162-yard effort against Colgate in the season opener. He ran for 100 yards in seven of the team’s nine games, posting a school record 1,409 yards on the ground and 14 touchdowns. Included is a then-school record 281 yard performance against Harvard. 1970 Not to be outdone, Marinaro breaks his own school record with 1,425 yards and shares the Asa S. Bushnell Cup for Ivy Player of the Year with Dartmouth’s Jim Chasey. 1971 Marinaro caps off his fine career with a then-NCAA record 1,881 yards and 24 touchdowns en route to earning first-team All-America honors. He claims all of the major national player of the year awards except the coveted Heisman Trophy, which he finishes second to Auburn’s Pat Sullivan in one of the award’s closest votes. The Big Red shares its first-ever Ivy crown on Marinaro’s shoulders, matching Dartmouth’s 6-1 record in Ancient Eight action. 1981 Derrick Harmon becomes the first Cornell player to earn Ivy League Sophomore of the Year (now Rookie of the Year). 1982 Cornell moves to the Division I-AA classification.

WWW .CORNELL B IG R ED . COM

1986 The Big Red made an unlikely run for the league title, finishing the year with just one loss in Ivy play a year after going 3-7 overall. Cornell drops a 31-21 decision to Penn in the season finale as the Quakers claimed the crown.

According to Sagarin

1939

1988 CornellbroughttheIvyLeaguetrophyback totheEastHillin1988whentheteamearned sixvictoriesagainstitsAncientfoes.Five individualsearnedfirst-teamAll-Ivyhonors, includingCornellHallofFamersScottMalaga (RB)andMitchLee(LB).Theteamoutscored its opponents by nearly 100 points while averaging 345.0 yards per game. 1989 Cornell makes a Thanksgiving Day appearance on ESPN, playing a 10 a.m. contest against Penn. The Big Red wins 20-6 and is 3-0 all-time on ESPN.

According to Litkenhous and Sagarin

2005 FOOTBALL

1990 Cornell posts a 6-1 Ivy mark and a share of theAncientEighttitleunderthedirection of first-year head coach and former gridirongreatJimHofher’79.TheBigRedleads theleagueinrushing(242.9ypg.)andtotal offense(375.0ypg.)whileoutscoringits opponents 180-95. Three of the team’s

Ed Marinaro looks for a hole in the 1971 game against Columbia.

CORNELL ALL-TIME FOOTBALL TEAM (1887–2003) Pos. W R ... W R ... TE .... O T ... O T ... O G ... O G ... O G ... O C ... Q B ... RB ... RB ... RB ... FB .... FB .... PK .... Ret ... Ret ...

OFFENSE Name Eric Krawczyk ..... Joe Splendorio .... Brud Holland ..... Nick Drahos ...... Frank Wydo ...... Bill Warner ....... Sid Roth ......... Chris Field ....... Greg Bloedorn .... Gary Wood ...... Ed Marinaro ...... Derrick Harmon ... Chad Levitt ...... Jeff Fleischmann ... Scott Malaga ..... Pete Gogolak ..... Pete Larson ...... Bo Roberson .....

Class 1998 2001 1939 1941 1950 1903 1939 1991 1996 1964 1972 1984 1997 1951 1989 1964 1967 1958

Pos. DE ... DE ... DE ... DL ... DL ... DL ... LB .... LB .... LB .... LB .... D B ... D B ... D B ... D B ... P .... P ....

DEFENSE Name John O’Hearn ..... Tom McHale ..... Seth Payne ....... Phil Ratner ....... John Sponheimer .. Mike Phillips ..... Walt Matuszak .... Bob Lally ........ Mitch Lee ....... Chris Zingo ...... Eddie Kaw ....... George Pfann ..... Hillary Chollet .... Mike Raich ....... Bob Dean ....... Erik Bernstein .....

Class 1915 1987 1997 1966 1969 1974 1941 1974 1990 1994 1923 1924 1950 1988 1949 1987

* - as voted on by the members of the Cornell Football Association (CFA) in 2003.

HISTORY

AND

RECORDS

The Fifth Down Game “In view of the conclusions reached by the officials that the Cornell touchdown was scored on a fifth down, Cornell relinquishes claim to the victory and extends congratulations to Dartmouth.” -Statement from Cornell Athletic Director James Lynah to Dartmouth College“I accept the final conclusion of the officials and without reservation concede the victory to Dartmouth ... with hearty congratulations to you and the gallant Dartmouth team.” -Statement from Cornell head coach Carl Snavely to Dartmouth College“Thank you for your wire. Dartmouth accepts the victory and your congratulations and salutes the Cornell team, the honored and honorable opponent of her longest unbroken football rivalry.” -Statement from Dartmouth Athletic Director William McCarter to Cornell UniversityArguably the greatest example of sportsmanship in the history of athletic competition, the Nov. 16, 1940 Cornell-Dartmouth game has become known as the “Fifth Down Game.” The Big Red, ranked No. 1 in the nation and riding an 18-game win streak, seemingly escaped Hanover, N.H., with a 7-3 victory against the underdog Big Green, scoring on a a 6-yard touchdown pass by Walter Scholl on the game’s final play. After reviewing game film on Monday, Coach Carl Snavely and acting athletic director Robert J. Kane wired Dartmouth officials to tell them Cornell scored on an inadvertent fifth down, as referee Red Friesell had lost track of the downs. After Snavely called a team meeting later that day, he let the players make the decision on how to handle the situation. Led by captain Walt Matuszak, Cornell voted to forfeit the contest. Though there were no rules compelling the outcome to be changed, in an unprecendeted act of sportsmanship, the Big Red relinquished claims to the win. The Big Green accepted the forfeit and the 30 victory. It remains the only time a collegiate sporting contest has been decided off the field after the completion of a game.

Some of Cornell’s Greatest Games ...

offensive linemen — Jay Bloedorn, Greg Finnegan and Chris Field — earnedfirst-teamAll-Ivyhonors,leadingtheBigRed’s14overallselections. ScottOliarorunsforaschool-record 288 yards against Yale.

Union 24, Cornell 10 (Nov. 12, 1887 at Ithaca, N.Y.) Cornell’s first official varsity game. The Big Red jumped out to a 102 lead before a more experienced Union squad used its greater understanding of the rules of the day to score 22 straight points.

1991 The Big Red travelled to Division I StanfordtocelebratetheCentennial Anniversaryofitssisterschoolfromthe West.TheCardinalwin56-6.

Cornell 10, Harvard 0 (Oct. 23, 1915 at Cambridge, Mass.) Cornell’s first national championship season was highlighted by a stunning 10-0 victory over Harvard, snapping a 10-game Crimson win streak to begin the all-time series.

1995 Cornell wins five straight Ivy games midway through the season and finishes tied for second in the Ancient Eightstandings.

Cornell 23, Ohio State 14 (Oct. 28, 1939 at Columbus, Ohio) The powerful Big Ten champs jumped out to a 14-0 lead in the second quarter with 86- and 72-yard touchdown drives, but Cornell rallied, scoring the game’s final 23 points to claim the upset. Walter ‘Pop’ Scholl ‘41 ran for a 79-yard touchdown, passed for a 26-yard score to knot the game, then watched as Hal McCullough gave the Big Red the lead for good. All-America tackle Nick Drahos ‘41 kicked a field goal to give Cornell the win. Dartmouth 3, Cornell 0 (Nov. 16, 1940 at Hanover, N.H.) The famous “Fifth Down Game.” See above.

Ricky Rahne runs across the goal line in a 24-23 victory over Yale in 2000.

Cornell 20, Michigan 7 (Nov. 10, 1951 at Ithaca, N.Y.) In front of a Schoellkopf Field record crowd of 35,300, the Big Red blitzed defending Rose Bowl champion and four-time defending Big Ten champion Michigan 20-7. The Big Redlimited theWolverines to39yardsrushing, just16inthesecond half, tostifle thevisitors. Cornell rallied from a 7-0 halftime deficit for the crowd-pleasing victory.

Cornell 19, Penn 6 (Nov. 19, 1988 at Ithaca, N.Y.) The Big Red claimed a share of the Ivy League title by topping previously unbeaten Penn 20-6 in the season finale. Cornell scored 16 unanswered points in the fourth quarter to erase a 6-3 deficit. Included was a goalline stand with less than four minutes remaining in the third quarter keyed by a fourth-down stop by Brent Felitto at the 1-yard line on fourth-and-two. The Cornell offense then took the ball and marched 99 yards for the go-ahead score, a 15-yard run by Steve Lutz.

Cornell 29, Harvard 28 (Oct. 7, 2000 at Cambridge, Mass.) Joe Splendorio ‘01 blocked a 27-yard game-winning field goal try in the final seconds as Cornell stormed back from a 28-0 halftime deficit for a 29-28 win. It was the second straight year Splendorio blocked a field goal in the waning seconds to protect a one-point Big Red win over the Crimson. Cornell 32, Columbia 26 (Nov. 13, 2004 at New York, N.Y.) First-year head coach Jim Knowles ’87 preached all year to his players that they must believe in themselves. He saw the result of that belief in one of the most improbable comebacks in Cornell football history. The Big Red rallied from a 26-7 deficit with 9:33 to play for a 32-26 victory over Columbia. D.J. Busch ‘05 threw a pair of fourth-quarter touchdowns, including the game-winner to Brian Romney ‘06 with 37 seconds to play. During the rally, Sean Nassoiy ‘05 intercepted two fourth-quarter passes.

2000 BigRedfansprovidedwithplentyofexcitement,asCornell’sall-timeleadingpasser, Ricky Rahne ’02, led the team through some amazing fourth-quarter comebacks. The squad battled to win three games by onepointeachtochallengefortheIvytitle, finishing the season in second place. 2001 TheseasonopeneratBucknelliscancelled after the attacks of Sept. 11. When the season begins, Ricky Rahne ‘02 builds on his passing totals and graduates as the school’s career leader in passing (7,710 yards) and touchdown passes (54). 2002 KeithFerguson‘03graduatesastheschool’s all-timeleaderinreceivingyards(2,569) and becomes the first Cornell player to record 200 career catches (202). 2004 Despite being picked to finish last in the preseason poll by the league’s coaches after an 0-7 campaign the previous year, first-year head coach Jim Knowles ‘87 breathesnewlifeintotheprogram.Cornell goes 4-3 in Ivy play, becoming the second Ancient Eight team to go from a winless leaguerecordtoawinningmarkinthespan ofoneyear.Theteamfinishesthirdinthe final standings behind a defense ranked among the best in the country.

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Cornell 33, Princeton 27 (Sept. 21, 1996 at Ithaca, N.Y.) The Big Red wins the first overtime game in school history as Cornell and Princeton battled to two extra sessions to determine a winner. Cornell scored 13 unanswered points in the fourth quarter to tie the game on a 45-yard John Rodin field goal. After both teams scored in the first overtime, Brian Opre ran in from 1yard out to collect the win.

1996 TheBigRedplaysitsfirstovertimegame, defeating Princeton 33-27 athomein the season and home opener. Chad Levitt‘97falls58yardsshyoftheschool’s careerrushingrecordafterbeinghurtin hisfinalcollegiategame,endinghis four-yearrunwith4,657yards.Heis named second-team All-America and theIvyLeaguePlayeroftheYear.

HISTORY

AND

RECORDS

Cornell Football Legends Glenn Scobey (Pop) Warner • Gridiron’s Greatest Strategist Glenn Scobey (Pop) Warner was a colorful individual during his playing days at Cornell and then during an illustrious, uninterrupted 45-year coaching career. Warner was born in Springville, N.Y., on April 5, 1871, only two days after the first college football game between Princeton and Rutgers. Not only was he one of Cornell’s outstanding football players, but he also excelled in track and field, and was its heavyweight boxing champion in 1893. Upon graduation from Cornell Law School in 1895, Warner began his coaching career at Georgia. He returned to his alma mater for the 189798 seasons, then went to Carlisle from 1899-1903. “Pop” came back to Ithaca for a second stint coaching the Big Red from 1904-06, before heading back to Carlisle, where he coached legendary Jim Thorpe. After leaving Carlisle in 1914, Warner later coached at Pittsburgh (1915-23), Stanford (1924-32) and Temple (1933-38). At the age of 67, he returned to his permanent residence of Palo Alto, Calif., and served as an advisory coach at San Jose State from 1939-40. After coaching 44 All-Americans and introducing so many of the football practices that we still use today, Warner returned to his oil and water paints, and to his work bench. His imaginative mind produced the screen pass, the rolling block, the naked reverse, series plays and the unbalanced line. He also introduced the numbering of players, huddle, wearing of headgear, spiral punt and the blocking dummy. Warner was the only coach ever to actually invent a system of offense. “Pop” died on Sept. 7, 1954, at age 83, 25 years after founding the Pop Warner Youth Football League, which is still a mainstay for nearly all young football players. Thirty-nine years after his death, Warner passed the late Amos Alonzo Stagg and became the second winningest coach in major college football. In 1993, Warner was credited by the NCAA with six more victories, increasing his total to 319, with Stagg having 314. His overall 44-year coaching record was 319-106-29. On July 25, 1997, the U.S. Postal Service issued four stamps commemorating Warner, Vince Lombardi of the Green Bay Packers, George Halas of the Chicago Bears and Paul “Bear” Bryant of the University of Alabama.

Pete Gogolak • Just For Kicks One of the first soccer-style kickers in collegiate and pro football history, Pete Gogolak is recognized as one of the great football players inCornellhistory. While at Cornell, Gogolak set a major college record by connecting on 44 consecutive kick conversions from 1961 to 1963 and still holds the Cornell record for consecutive conversions and career conversion percentage (.982, 54-of-55). His 50-yard field goal vs. Lehigh in 1963 was the nation’s longest in a major college game. He booted nine career field goals, including eight of 40 yards or more. After Cornell, Gogolak signed with the Buffalo Bills after being drafted in the 12th round of the AFL Draft. He played two seasons with the Bills, including kicking for the 1965 AFL champion team. He was named kicker of the AFL all-pro team and in 1984, was named to the Silver Anniversary all-time team. After playing out his option with Buffalo, Gogolak signed with the New York Giants and played 10 seasons, becoming the franchise’s all-time leading scorer and kicking the longest field goal in team history (54 yards). Gogolak’s family came to the United States from Hungary in 1956. His brother, Charlie, is theall-timetopplace-kickerinthehistoryofPrincetonfootball.Thefamily’sstorywasfeatured in Life Magazine in 1963.

Year 1961 1962 1963 Totals

GP 9 9 9 27

X-Pts Made-Att 16-17 20-20 18-18 54-55

FGM-FGA 3-10 0-5 6-12 9-27

Lg 41 — 50 50

Pts 25 20 36 81

WWW .CORNELL B IG R ED . COM

Gary Wood • The No. 1 Option

In a game where quarterbacks beat teams with their arms and their legs, Gary Wood was a pioneer. Wood remains one of the great all-around players in Ivy League history more than 40 years after he last dressed for the Big Red. A three-time AP All-Ivy first-team and two-time Coaches All-Ivy first-team pick, Wood was named to the AP’s All-East squad as a senior.HesetIvyLeaguerecordsforcareertotaloffense(3,457yards)andrushing(2,156yards)aswellassingle-seasontotaloffense(1,612 yardsin1962)andrushing(813yardsin‘62).Healsoheldtherecordfortotaloffenseinagame(387yardsvs.Penn,1962).Anexplosive player,Woodscoredonplaysof40yardsormoresixtimesinhisthreeseasons,includingan89-yardkickoffreturnandan80-yardrunin 1963. He was named one of four “Most Spectacular Players” of the 1962 season and was named national “Back of the Week” by the APandSportsIllustratedforhis1962performanceinawinoverPrinceton.HeremainstheonlyplayerinIvyLeaguehistorytorushfor 2,000 yards and pass for 1,000 more. That doesn’t even take into account his 1,326 yards on 50 returns (26.5 yard average). After graduating from Cornell, Wood joined the New York Giants. Standing just 5-11 and wighing 185 pounds, many said he was too small to play quarterback in the NFL. Wood proved his naysayers wrong, playing five years with the Giants and another with the New Orleans Saints. He later played with the Ottawa Rough Riders of the Canadian Football League.

Year 1961 1962 1963 Totals

GP 9 9 9 27

2005 FOOTBALL

Comp 28 60 47 135

Att 75 117 119 311

Pct. .373 .513 .395 .434

Yds 456 890 545 1,891

TD 6 8 4 18

Int 3 8 7 18

Rushes 94 173 166 311

Yds 449 889 818 2,156

Avg. 4.8 5.1 4.9 4.9

TD 3 9 6 18

HISTORY

AND

RECORDS

Ed Marinaro • An Era to Remember In his three seasons as Cornell’s tailback (1969-70-71), Ed Marinaro set rushing and scoring records wholesale and won every major honor with the exception of the Heisman Trophy for which he placed a close second to quarterback Pat Sullivan of Auburn University. In the 24th game of his 27-game career, against Columbia at Ithaca, he broke Steve Owens’ alltime NCAA career rushing record of 3,867 yards, set in 1969, by gaining 272 yards for a total of 4,132— the first player to go over the 4,000 mark in three seasons. He finished up with 4,715. During his three years at Cornell, he set an NCAA season record of 1,881 yards and a season pergame average of 209.0. His career average of 174.6 is also an NCAA record. Overall he established eight NCAA career records and tied another, six NCAA single-season records and three other NCAA records. Marinaro won the national triple-crown in 1971—rushing, all-purpose running and scoring, each based on game-average. All-purpose running includes pass receiving and kick returns. He averaged 214.7 yards with 51 on pass receptions. He still holds 11 Ivy League records, including career and season rushing yardage (3,391 and 1,375), carries (707 and 275), touchdowns (36 and 16) and points scored (224 and 100). He was inducted into the National Football Foundation’s College Football Hall of Fame in 1991. Marinaro played professionally for the Minnesota Vikings, New York Jets and Seattle Seahawks before beginning an acting career that saw him, most notably, play Officer Joe Coffey on “Hill Street Blues” and Sonny St. Jacques on “Laverne & Shirley.” He has also been seen on “Dynasty,” “The Twilight Zone,” “Touched By An Angel,” “Third Watch,” “Eight Simple Rules For Dating My Teenage Daughter,” and “Monk” among others. Year 1969 1970 1971 Totals

GP 9 9 9 27

Rushes 277 285 356 918

Yds 1,409 1,425 1,881 4,715

Avg 5.1 5.0 5.3 5.1

TD 14 12 24 50

PATs 0 1 2 3

Rec. 6 11 6 23

Rec. Yds 52 129 51 232

TD 0 2 0 2

Pts 84 86 148 318

Seth Payne • From Walk-On to NFL Success

Year 1993 1994 1995 1996 Totals

GP 4 10 10 10 34

Tackles 2 25 25 55 107

Assists 6 22 18 29 75

For Loss 1-2 5-9 6-12 26-107 38-130

Sacks 0-0 6-32 4-9 9-49 19-90

From the Ivies to the Super Bowl Tailback Derrick Harmon excelled on both the playing field and in the classroom. He was a two-time Academic All-American and made theAssociatedPressDivisionI-AAAll-America second team as a senior. In his final season, Derrick won the Asa BushnellAwardastheIvyLeague’sPlayerofthe Year, after being named the league’s Sophomore of the Year in 1981. He became only the fourth person in the history of the league to go over 1,000 yards in one season when he ran for 1,056 markers in seven Ivy games in 1983. Atwo-timeAll-Ivyfirstteam selection, Harmon rushed for 3,074 yards on 546 carries in three years andranksthirdonCornell’s all-timerushinglistandin career rushes. He set the school’s single season record for yards per carry (5.9in1983)andthecareer recordforyardspercarry(5.6,1981-83).During his three years, he had 14 games of over 100 yardsrushing.Healsoranksthirdincareerallpurpose running with 3,800 yards. An engineering physics major from New York City, Harmon was the recipient of an NCAA postgraduate scholarship. He was drafted in the ninth round by the San Francisco 49ers and earned a Super Bowl ring in 1985 against the Miami Dolphins. Year 1981 1982 1983 Totals

GP 9 8 10 27

Rushes 173 157 216 546

Yds 893 905 1,276 3,074

Avg 5.2 5.8 5.9 5.6

TD 5 9 12 26

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

From walk-on to three-time All-Ivy selection, defensive end Seth Payne ’96 remains the school’s career leader in sacks with 19 and has gone on to make a name for himself with the NFL’s Houston Texans. As a member of the Big Red, Payne was named first-team All-Ivy as a senior after leading the team with a career-best nine sacks and ranking among the top five on the team in tackleswith84.Duringhis career he earned the defense’s Big Play Award, Most Improved Player, the Sid Roth Award twice (designatedfortheteam’smost valuable down lineman), and the Red Helmet Award fortheoutstandingvarsity player on defense. The four-year letter winner capped off his career by being selected by the Jacksonville Jaguars in the fourth round of the 1997 NFL Draft. After five productive seasons with the Jaguars, including 51 starts, Payne was selected by the Texans in the league’s expansion draft and made an immediate impact. He started all 16 games in 2002, leading the Texans defensive line with 147 tackles to rank third on the team. His only sack of the season was a safety late in the fourth quarter thatledHoustontoitsfirstwininfranchisehistory,atriumphoverthestoriedDallasCowboys. Payne was voted by teammates as the recipient of NFL Player’s Association 2002 Unsung Hero Award, and was selected to USA Today’s 11th annual “All-Joe Team” as one of the most underrated players in the NFL who makes a difference with their work ethic and demeanor. He opened the 2003 season as the starter at tackle before suffering a season-ending knee injury, but has regained his starting spot and re-signed with the Texans this past summer. The 6-4, 303-pounder has made a home for himself in Houston, where he is well known for his work with many charitable organizations, including Teach For America and both the Children’s and Shriner’s hospitals.

Derrick Harmon

HISTORY Running With The Best Duringhisfour-yearcareerinaBigReduniform, tailback Chad Levitt rushed for 4,657 yards, coming just 59 yards shy of breaking the all-time Cornell and Ivy League rushing records. A freak elbow injury in the ninth game of the ‘96 season kept him from shattering the mark. Levitt led the Ivy League in rushing, scoring and all-purpose running per game for three straight years. During the 1996 season, he rushed for 1,435 yards on 267 carries for the second-best season ever at Cornell. The three-time All-Ivy first-team back was named ECAC Division I-AA Player of the Year, the Asa S. Bushnell Cup Player of the Year in the Ivy League, and The Football News named him Ivy League Player of the Year for the third consecutive time. He set a school and league career record for most rushing attempts 922), established a school-best mark for 100-yard rushing games in a career (24) and broketheschool’s all-purpose running standard with 5,036 yards. He ranks second on the all-time scoring list with 292 points. The 6-2, 240pounder was a two-time ECAC first-teamselection and was named to the Associated Press Division I-AA All-America second team following his senior year. He was invited to play in the EastWest Shrine and the Blue-Gray all-star games. A graduate of Cheltenham High School and a Melrose Park, Pa., native, Levitt was a fourthround draft pick by the Oakland Raiders in the 1997 NFL Draft and started two games as a rookie. He also appeared on rosters for the St. Louis Rams and the Chicago Bears.

WWW .CORNELL B IG R ED . COM

GP 9 10 10 9 38

Rushes 88 275 292 267 922

Yds 475 1,319 1,428 1,435 4,657

RECORDS

Tom McHale • Sack Artist

Chad Levitt

Year 1993 1994 1995 1996 Totals

AND

Avg 5.4 4.8 4.9 5.4 5.1

TD 6 12 13 13 44

Tom McHale parlayed his love of football into a longtime NFL career. After excelling as one of the finest defensive linemen in Big Red history, he was called upon to play several positions in the pros, even settling in as a starting offensive guard during his seven-year NFL career. The 6-4, 260-pound defensive end was named to the Kodak Division I-AA All-America team by the American Football Coaches Association in 1986 to join his awards as an AssociatedPressDivisionI-AAfirst-teamandAll-Ivyfirst-team selection. He was the runner-up for Ivy League Player of the Year after setting Cornell records for season (12) and career quarterback sacks (14). He was chosen to play for the East team in the East-West Shrine Game. McHale transferred to Cornell from Maryland, where he was a starting defensive tackle and played on two bowl teams. In 1987 he signed as a free agent with the Tampa Bay Buccaneers andmovedtotheoffensiveline,eventuallyplayingsevenseasonsintheNFLatguardfortheBucs, the Philadelphia Eagles and the Miami Dolphins. After retirement, McHale served as president of the Tampa chapter of the NFL Players Association’s Retired Players division. He also put his degree in hotel administration to good use, opening several restaurants in the Tampa area. Year 1985 1986 Totals

GP 3 10 13

Tackles 10 46 56

Assists 3 28 31

Sacks 2 12 14

Ricky Rahne • Passing Fancy One of the great quarterbacks in the history of the Ivy League, Ricky Rahne holds nearly every career passing record for the Big Red. He rejoined the Cornellfootballfamilythispastyearasanassistantcoachandwillsharehis experiences with a new generation of Big Red student-athletes. Rahne finished his career as a three-year starter and three-time team MVP. He remains the all-time leader in completions (678), yards (7,710), touchdown passes (54) and 200-yard games (25). He took over the top spot in total offense with 7,994 yards (7,710 passing, 284 rushing) and finished his career ranked as the Ivy League’s third all-time career passing leader. Rahne also garnered awards, being named honorable mention AllAmerica by Don Hansen’s Football Gazette in 2000 as well as honorable mention All-Ivy as a sophomore and junior. He also had a penchant for unbelievable comebacks, helping the 2000 team to the nickname “The Comeback Kids.” Rahne worked as an intern in the National Football League office during the summer before his senior year before putting his degree in industrial and labor relations to work at the Cintas Corporation as part of the company’s management trainee program. He then joined the coaching ranks, spending the 2004 season as an assistant at Holy Cross.

Year 1998 1999 2000 2001 Totals

GP 1 10 10 9 30

Comp 2 225 252 199 678

Att 4 388 479 355 1,226

Pct. .500 .580 .526 .561 .553

Yds 20 2,762 2,944 1,984 7,710

TD 0 25 18 11 54

Int 0 13 13 5 31

Pete Larson • All-Purpose Runner An excellent halfback from 1964-66, Pete Larson led the team in rushing as a senior and pass receiving as a sophomore. In three years, he rushed for 1,751 yards on 354 carries, caught 34 passes for 430 yards and scored 22 touchdowns. In 1966, Larson ranked among the top 10 nationally in rushing with 979 yards, leading the Ivy League. He also set league records for both rushing and scoring in a season en route to first-team All-Ivy honors. In addition, Larson was named AP honorable mention All-America, to the All-East second team and the ECAC all-star first-team. As a junior he was an AP All-East and All-Ivy honorable mention selection. After college, Larson played for two seasons for the Washington Redskins, scoring three touchdowns.

Year 1964 1965 1966 Totals

2005 FOOTBALL

GP 7 9 9 25

Rushes 37 111 206 354

Yds 132 640 979 1,751

Avg 3.6 5.8 4.8 4.9

TD 3 5 9 17

HISTORY

AND

RECORDS

Passing Records MOST YARDS PASSING Game: 446 by Ricky Rahne at Brown, 10-21-00 Season: 2,944 by Ricky Rahne, 2000 Career: 7,710 by Ricky Rahne, 1998-2001 MOST PASSES ATTEMPTED Game: 64 by Ricky Rahne at Bucknell, 9-16-00 (completed 28) Season: 479 by Ricky Rahne, 2000 (completed 252) Career: 1,226 by Ricky Rahne, 1998-2001 (completed 678) MOST PASSES COMPLETED Game: 37 by Bill Lazor at Columbia, 11-14-92 (59 attempts) Season: 252 by Ricky Rahne, 2000 (479 attempts) Career: 678 by Ricky Rahne, 1998-2001 (1,226 attempts) MOST PASSES INTERCEPTED Game: 6 by Marty Stallone at Princeton, 11-23-85 Season: 21 by Chris Cochrane, 1989 Career: 31 by RIcky Rahne, 1998-2001 MOST TOUCHDOWN PASSES 4 by Mark Allen at Brown, 11-11-72; by Mark Allen vs. Columbia, 11-3-73; by Mike Hood vs. Buffalo, 10-3-98; by Ricky Rahne vs. Fordham, 9-25-99; by Ricky Rahne vs. Columbia, 11-13-99; by Ricky Rahne at Harvard, 10-7-00 Season: 25 by Ricky Rahne, 1999 Career: 54 by Ricky Rahne, 1998-2001

Game:

HIGHEST COMPLETION PERCENTAGE Game: .821 by Mike Hood at Fordham, 10-25-97 (23-28) (min. 15 att.) Season: .636 by Mike Hood, 1997 (138-217) (min. 90 att.) Career: .607 by Mike Hood, 1996-98 (334-550) (min. 150 att.) HIGHEST PASSING EFFICIENCY Season: 135.2 by Steve Joyce, 1995 Career: 191.2 by Steve Joyce, 1994-95 MOST YARDS GAINED PER ATTEMPT Game: 12.2 by Steve Joyce at Brown, 10-28-95 (28-341) (min. 20 att.) Season: 8.4 by Rick Furbush, 1970 (104-876) (min. 100 att.) Career: 8.2 by Rocco Calvo, 1950-51 (171-1405) (min. 170 att.) MOST YARDS GAINED PER COMPLETION Game: 25.7 by Aaron Sumida at Columbia, 11-12-88 (12-231) (min. 10 comp.) Season: 15.37 by Rick Furbush, 1970 (57-876) (min. 55 comp.) Career: 15.8 by Rocco Calvo, 1950-51 (89-1,405) (min. 85 comp.) MOST 200-YARD PASSING GAMES Season: 10 by Ricky Rahne, 2000 Career: 25 by Ricky Rahne, 1998-2001 (fr.-0, so.-9, jr.-10, sr.-6) MOST 300-YARD PASSING GAMES Season: 4 by Ricky Rahne, 2000 Career: 7 by Ricky Rahne, 1998-2001 (fr.-0, so.-2, jr.-4, sr.-1) MOST CONSECUTIVE PASSES COMPLETED 13 by Pete Dorset, vs. Lehigh, Navy, Columbia, 1947

MOST CONSECUTIVE GAMES THROWING A TD PASS 15 by Ricky Rahne, Sept. 18, 1999-Oct. 14, 2000 MOST YARDS PASSING BY A FRESHMAN Game: 31 by Ryan Kuhn vs. Penn, 11-23-02 Season: 31 by Ryan Kuhn, 2002 MOST YARDS PASSING BY A SOPHOMORE Game: 443 by Ricky Rahne at Brown, 10-2-99 Season: 2,762 by Ricky Rahne, 1999 MOST YARDS PASSING BY A JUNIOR Game: 446 by Ricky Rahne at Brown, 10-21-00 Season: 2,944 by Ricky Rahne, 2000 MOST YARDS PASSING BY A SENIOR Game: 395 by Mark Allen at Penn, 11-24-73 Season: 2,255 by Steve Joyce, 1995

Pct. .468 .500 .627 .482 .491 .519 .643 .620 .700 .500 .438 .554 .625 .600 .576 .467 .606

T D Yds .. 3 . 446 .. 2 . 443 .. 3 . 400 .. 2 . 395 .. 4 . 391 .. 1 . 344 .. 3 . 341 .. 2 . 321 .. 4 . 320 .. 1 . 317 .. 2 . 314 .. 1 . 314 .. 1 . 312 .. 0 . 307 .. 2 . 307 .. 0 . 306 .. 1 . 302

SEASON PASSING Ricky Rahne .... Ricky Rahne .... SteveJoyce .... BillLazor ...... BillLazor ...... RIcky Rahne .... Mike Hood .... KevinSigler .... Mark Allen ..... ScottCarroll ... Mick Razzano ... D.J.Busch ..... BillLazor ...... Marty Stallone .. ScottCarroll ...

Year Att-Comp.-Int. 2000 .... 479-252-13 .. 1999 .... 388-225-13 .. 1995 .... 274-156-9 ... 1992 .... 328-169-4 ... 1993 .... 328-172-13 .. 2001 .... 355-199-5 ... 1998 .... 294-173-15 .. 1974 .... 248-143-14 .. 1973 .... 270-119-11 .. 1996 .... 262-125-13 .. 2002 .... 276-137-7 ... 2004 .... 234-121-7 ... 1991 .... 217-129-9 ... 1986 .... 226-110-12 .. 1997 .... 239-131-11 ..

Pct .526 .580 .569 .515 .524 .561 .588 .577 .441 .477 .496 .517 .595 .487 .548

.. .. .. .. .. .. .. .. .. .. .. .. .. .. ..

Yds 2,944 . 2,762 . 2,255 . 2,206 . 2,030 . 1,984 . 1,910 . 1,648 . 1,590 . 1,583 . 1,556 . 1,534 . 1,461 . 1,446 . 1,378 .

TD 18 25 13 15 11 11 11 8 10 9 7 5 8 12 10

Years Att-Comp.-Int. Pct 1998-2001 . 1226-678-31 . .553 .. 1991-93 .. 873-470-26 .. .538 .. 1996-98 .. 550-334-22 .. .607 .. 1971-73 .. 543-249-27 .. .459 .. 1995-97 .. 502-256-24 .. .510 .. 2002-04 .. 469-241-15 .. .514 .. 1988-90 .. 438-234-27 .. .534 .. 1983-85 .. 562-292-29 .. .520 .. 1994-95 .. 342-194-13 .. .567 .. 1967-68 .. 372-175-19 .. .470 ..

Yds 7,710 . 5,697 . 3,406 . 3,313 . 2,961 . 2,892 . 2,784 . 2,702 . 2,669 . 2,503 .

TD 54 34 20 22 19 12 11 5 15 15

CAREER PASSING Ricky Rahne .... BillLazor ...... Mike Hood .... Mark Allen ..... ScottCarroll ... D.J.Busch ..... Chris Cochrane . Shawn Maguire . SteveJoyce .... BillRobertson ..

LONGEST PASS PLAYS 98 yards .......... Bob Dean to Norman Dawson vs. Navy, 1947 90 yards ............... Rocco Calvo to Stu Merz at Yale, 1951 88 yards ............ Steve Joyce to Steve Busch at Brown, 1995 79 yards ............. Chris Metz to Jim Burry vs. Harvard, 1979 79 yards ........... D.J. Busch to Chad Nice vs. Princeton, 2004 78 yards ............ Per Larson to Chad Levitt at Bucknell, 1994 77 yards ....... Jay LaRochelle to Tim LaBeau vs. Columbia, 1975 77 yards ............. D.J. Busch to Chad Nice at Harvard, 2004 76 yards ........... Bill Robertson to Chris Ritter at Brown, 1968 76 yards ......... Dave McKelvey to Phil Taylor at Harvard, 1959 75 yards ..... Mark Allen to George Milosevic vs. Dartmouth, 1972 74 yards ............ Bill DeGraaf to Art Boland at Brown, 1955 72 yards .......... Chris Metz to Terry Thomas vs. Colgate, 1981 71 yards ............ Steve Joyce to Ron Mateo at Lehigh, 1995 71 yards ....... Dave Dase to Shaun Hawkins vs. Columbia, 1987 71 yards ..... Marty Sponaugle to Stu Fullerton vs. Princeton, 1965

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

MOST CONSECUTIVE PASS ATTEMPTED WITHOUT AN INTERCEPTION Game: 59 by Bill Lazor at Columbia, 11-14-92 Season: 124 by Bill Lazor, Oct. 10, 1992-Nov. 7, 1992

SINGLE-GAME PASSING Player, Opp., Year Att.-Comp.-Int. Ricky Rahne at Brown, 2000 ........ 62-29-1 .. Ricky Rahne at Brown, 1999 ........ 58-29-1 .. Bill Lazor at Columbia, 1992 ....... 59-37-0 .. Mark Allen at Penn, 1973 ......... 56-27-3 .. Ricky Rahne at Harvard, 2000 ...... 57-28-1 .. ScottCarrollatBuffalo,1996 ....... 52-27-1 .. Steve Joyce at Brown, 1995 ........ 28-18-2 .. Bill Lazor at Brown, 1991 .......... 50-31-3 .. Ricky Rahne vs. Columbia, 1999 ..... 40-28-1 .. BillLazorvs.Yale,1991 ........... 44-22-1 .. Ricky Rahne at Bucknell, 2000 ...... 64-28-3 .. Ricky Rahne vs. Harvard, 2001 ...... 56-31-0 .. D.J Busch vs. Columbia, 2003 ....... 40-25-2 .. Chris Cochrane at Yale, 1989 ...... 45-27-2 .. Ricky Rahne at Princeton, 1999 ..... 33-19-1 .. Ricky Rahne vs. Penn, 2000 ........ 60-28-3 .. Mick Razzano vs. Dartmouth, 2002 ... 33-20-1 ..

HISTORY

Rushing Records MOST RUSHING ATTEMPTS Game: 55 by Joe Holland at Harvard, 10-14-78 (244 yards) Season: 356 by Ed Marinaro, 1971 (1881 yards) Career: 922 by Chad Levitt, 1993-96 (4,657 yards) MOST YARDS GAINED Game: 288 by Scott Oliaro vs. Yale, 11-3-90 (35 att.) Season: 1,881 by Ed Marinaro, 1971 (356 att.) Career: 4,715 by Ed Marinaro, 1969-71 (918 att.) MOST YARDS GAINED PER GAME Season: 209.0 by Ed Marinaro, 1971 (1,881 in nine games) Career: 174.6 by Ed Marinaro, 1969-71 (4,715 in 27) MOST YARDS GAINED BY A QUARTERBACK Game: 207 by Gary Wood at Penn, 11-24-62 (31 att.) Season: 889 by Gary Wood, 1962 (173 att.) Career: 2,156 by Gary Wood, 1961-63 (433 att.) HIGHEST AVERAGE GAIN PER RUSH Game: 13.0 by Bill Scazzero at Columbia, 11-4-50 (12-156) (min. 10 att.) Season: 5.9 by Derrick Harmon, 1983 (216-1,276) (min. 150 att.) Career: 5.6 by Derrick Harmon, 1981-83 (546-3,074) (min. 250 att.) MOST TOUCHDOWNS SCORED BY RUSHING 5 by Ed Marinaro vs. Harvard, 10-18-69: by Ed Marinaro at Penn, 11-20-71 Season: 24 by Ed Marinaro, 1971 Career: 50 by Ed Marinaro, 1969-71

Game:

MOST 100-YARD GAMES Season: 9 by Ed Marinaro, 1971 Career: 24byChadLevitt,1993-96(fr.-1,so.-8,jr.-8,sr.-7) MOST 200-YARD GAMES Season: 5 by Ed Marinaro, 1971 Career: 10 by Ed Marinaro, 1969-71 (so.-2, jr.-3, sr.-5) MOST CONSECUTIVE 100-YARD GAMES 10 by Ed Marinaro (last game of 1970 through 1971 season) MOST CONSECUTIVE 200-YARD GAMES 3 by Ed Marinaro (last game of 1970 and first two of 1971) MOST YARDS GAINED BY A FRESHMAN Game: 126 by Terry Smith at Columbia, 11-12-94 (13 att.) Season: 671 by Terry Smith, 1994 (118 att.) MOST YARDS GAINED BY A SOPHOMORE Game: 281 by Ed Marinaro vs Harvard, 10-18-69 (40 att.) Season: 1,409 by Ed Marinaro, 1969 (356 att.)

WWW .CORNELL B IG R ED . COM

MOST YARDS GAINED BY A JUNIOR Game: 288 by Scott Oliaro vs. Yale, 11-3-90 (35 att.) Season: 1,428 by Chad Levitt, 1995 (292 att.)

MOST YARDS GAINED BY A SENIOR Game: 272 by Ed Marinaro vs Columbia, 10-30-71 (47 att.) Season: 1,881 by Ed Marinaro, 1971 (277 att.) SUPERLATIVES 100-Yard Games: Chad Levitt (24), Ed Marinaro (23), Derrick Harmon (13), John McNiff (11), Scott Malaga (8), Dan Malone (7), Deon Harris (6), Joe Holland (6), Pete Larson (6), Terry Smith (6), Gary Wood (6), Tony Baker (5), Jeff Johnson (5), Bo Roberson (5), Evan Simmons (5), Don Fanelli (4), Bob McAniff (4), Scott Oliaro (4), Bill Wilson (4), Pete Fitzpatrick (3), Rick Furbush (3), Dick Jackson (3), Art Boland (2), Craig Jaeger (2), Brad Kiesendahl (2), Rich Russo (2), John Tagliaferri (2), Ken Talton (2), Bob Baker, Guy Bedrosian, Frank Bradley, Horace Bradshaw, Ken Davis, Bill DeGraaf, Dwayne Dowtin, Bob Engel, Jeff Fleischmann, Ron Gervase, Neal Hall, Andre Hardaway, Joshua Johnston, Stu Merz, Bob Milne, Bill Scazarro, Kevin Scott, Matt Speicher, Brian Ulbricht, Steve Vago, Tom Weidenkopf, Bill Whelan. 200-Yard Games: Ed Marinaro (10), Chad Levitt (5), Derrick Harmon (2), Joe Holland (2), Scott Oliaro (1), Tom Weidenkopf (1), Gary Wood (1). 250-Yard Games: Ed Marinaro (4), Joe Holland (1), Scott Oliaro (1).

2005 FOOTBALL

SINGLE-GAME RUSHING Player, Opp., Year Scott Oliaro at Yale, 1990 ........... Ed Marinaro vs. Harvard, 1969 ........ Ed Marinaro vs. Columbia, 1971 ...... Joe Holland vs. Penn, 1978 .......... Ed Marinaro vs. Lehigh, 1970 ......... Ed Marinaro vs. Colgate, 1971 ........ Tom Weidenkopf at Dartmouth, 1979 .. Ed Marinaro at Rutgers, 1971 ........ Ed Marinaro at Rutgers, 1969 ........ Joe Holland at Harvard, 1978 ........ Chad Levitt vs. Dartmouth, 1996 ...... Ed Marinaro at Penn, 1971 .......... Ed Marinaro at Yale, 1971 ........... Chad Levitt at Harvard, 1994 ........ Ed Marinaro at Brown, 1970 ......... Derrick Harmon vs. Columbia, 1983 .... Chad Levitt at Yale, 1996 ........... Derrick Harmon vs. Yale, 1983 ........ Chad Levitt vs. Colgate, 1996 ........ Gary Wood at Penn, 1962 ........... Ed Marinaro at Princeton, 1970 ....... Chad Levitt at Brown, 1995 ..........

AND

RECORDS

Att. Avg. T D Yds 35 ... 8.2 ... 3 ... 288 40 ... 7.1 ... 5 ... 281 47 ... 5.8 ... 2 ... 272 38 ... 6.9 ... 4 ... 263 32 ... 8.2 ... 4 ... 260 43 ... 6.0 ... 4 ... 260 30 ... 8.2 ... 1 ... 247 38 ... 6.5 ... 4 ... 246 41 ... 6.0 ... 1 ... 245 55 ... 4.4 ... 4 ... 244 30 ... 8.1 ... 3 ... 241 42 ... 5.5 ... 5 ... 230 43 ... 5.3 ... 3 ... 230 30 ... 7.6 ... 1 ... 227 40 ... 5.6 ... 2 ... 225 34 ... 6.5 ... 2 ... 222 39 ... 5.6 ... 1 ... 218 25 ... 8.4 ... 4 ... 210 23 ... 9.1 ... 2 ... 209 31 ... 6.7 ... 2 ... 207 47 ... 4.3 ... 0 ... 203 27 ... 7.4 ... 2 ... 201

SEASON RUSHING Year Ed Marinaro ...... 1971 Chad Levitt ....... 1996 Chad Levitt ....... 1995 Ed Marinaro ...... 1970 Ed Marinaro ...... 1969 Joe Holland ....... 1978 Chad Levitt ....... 1994 Derrick Harmon .... 1983 Scott Malaga ...... 1988 John McNiff ....... 1990 PeteLarson ....... 1966 Dan Malone ...... 1972 Derrick Harmon .... 1982 JeffJohnson ....... 1986 Derrick Harmon .... 1981

.. .. .. .. .. .. .. .. .. .. .. .. .. .. ..

Att 356 ... 267 ... 292 ... 285 ... 277 ... 273 ... 275 ... 216 ... 256 ... 176 ... 206 ... 196 ... 157 ... 191 ... 173 ...

Avg. 5.3 ... 5.4 ... 4.9 ... 5.0 ... 5.1 ... 5.1 ... 4.8 ... 5.9 ... 4.3 ... 5.7 ... 4.8 ... 4.7 ... 5.8 ... 4.7 ... 5.2 ...

TD 24 ... 13 ... 13 ... 12 ... 14 ... 16 ... 12 ... 12 ... 12 ... 10 ... 9 .... 5 .... 9 .... 4 .... 5 ....

Yds 1,881 1,435 1,428 1,425 1,409 1,396 1,319 1,276 1,097 998 979 913 905 902 893

Avg. TD 5.1 ... 50 .. 5.1 ... 44 .. 5.6 ... 26 .. 4.7 ... 22 .. 5.0 ... 19 .. 4.2 ... 14 .. 4.7 ... 18 .. 4.9 ... 19 .. 4.7 ... 20 .. 4.8 ... 8 ...

Yds 4,715 4,657 3,074 2,557 2,156 1,925 1,755 1,751 1,713 1,579

CAREER RUSHING Years Ed Marinaro ...... 1969-71 Chad Levitt ....... 1993-96 Derrick Harmon .... 1981-83 John McNiff ....... 1989-91 Gary Wood ....... 1961-63 Scott Malaga ...... 1986-88 Joe Holland ....... 1976-78 PeteLarson ....... 1964-66 ScottOliaro ....... 1989-92 Tony Baker ........ 1982-84

Att .. 918 .. 922 .. 546 .. 539 .. 433 .. 461 .. 370 .. 354 .. 361 .. 330

.. .. .. .. .. .. .. .. .. ..

LONGEST RUSHES 95 yards .................... John McNiff at Columbia, 1990 91 yards ........................ Art Boland at Penn, 1956 88 yards ..................... Chad Levitt vs. Colgate, 1996 87 yards ..................... Whit Baker at Princeton, 1939 86 yards ...................... Bernie Babula at Penn, 1949 85 yards ..................... Pete Larson vs. Colgate, 1966 84 yards ...................... BillKirk vs.Columbia,1949 83 yards ........................ Walt Kretz at Penn, 1946 81 yards .................... JeffJohnsonvs.Princeton,1986 80 yards ........................ Gary Wood vs. Yale, 1963 79 yards ...................... Ed Marinaro vs. Lehigh, 1970 79 yards ...................... Walt Scholl at Harvard, 1939 79 yards .................... Walt Scholl at Ohio State, 1939 78 yards ...................... Bob Milne at Harvard, 1963

HISTORY

AND

RECORDS

Receiving Records MOST PASSES CAUGHT Game: 15 by John Tagliaferri at Princeton, 11-23-85 Season: 89 by Eric Krawczyk, 1997 Career: 202 by Keith Ferguson, 1999-2002 MOST PASSES CAUGHT BY A WIDE RECEIVER Season: 89 by Eric Krawczyk, 1997 Career: 202 by Keith Ferguson, 1999-2002 MOST PASSES CAUGHT BY A TIGHT END Season: 37 by George Milosevic, 1972 Career: 56 by Dan Suren, 1980-82 MOST PASSES CAUGHT BY A RUNNING BACK Season: 61 by John Tagliaferri, 1985 Career: 113 by Justin Dunleavy, 1998-2001 MOST YARDS GAINED Game: 204 by Joe Splendorio at Brown, 10-2-99 (11 catches) Season: 1,042 by Eric Krawczyk, 1997 (89 catches) Career: 2,569 by Keith Ferguson, 1999-2002 (202 catches) HIGHEST AVERAGE GAIN PER CATCH Season: 22.5 by Shaun Hawkins, 1986 (20-449) (min. 20 catches) Career: 20.5 by Shaun Hawkins, 1985-87 (58-1,187) (min. 40 catches) MOST TOUCHDOWN PASSES CAUGHT 3 by Bill Murphy vs Princeton, 10-14-67; Eric Krawczyk at Dartmouth, 10-4-97 Season: 11 by Eric Krawczyk, 1997 Career: 20 by Joe Splendorio, 1997-2000 Game:

MOST CONSECUTIVE GAMES CATCHING A PASS Season: 10 by John Tagliaferri, 1985; Jim Perrello, 1985; Scott Oliaro, 1990; Mike Grant, 1991; Mike Jamin, 1992; Aaron Berryman, 1993; Pete Fitzpatrick, 1993; Ron Mateo, 1995; Steve Busch, 1995; Eric Krawczyk, 1995; Eric Krawczyk, 1996; Justin Bush, 1997; Eric Krawczyk, 1997; Joe Splendorio, 1998; Keith Ferguson, 1999; Joe Splendorio, 2000; Keith Ferguson, 2000; Keith Ferguson, 2002; John Kellner, 2002; John Kellner, 2003; Vic Yanz, 2003; Chad Nice, 2004; Brian Romney, 2004. Career: 39 by Keith Ferguson, 1999-2002 MOST YARDS GAINED BY A FRESHMAN Game: 94 by Keith Ferguson vs. Fordham, 9-25-99 (4 catches) Season: 530 by Keith Ferguson, 1999 (41 catches) MOST YARDS GAINED BY A SOPHOMORE Game: 164 by Keith Ferguson vs. Princeton, 10-28-00 (8 catches) Season: 680 by Keith Ferguson, 2000 (41 catches) MOST YARDS GAINED BY A JUNIOR Game: 204 by Joe Splendorio at Brown, 10-2-99 (11 catches) Season: 944 by Joe Splendorio, 1999 (65 catches)

SUPERLATIVES 100-Yard Games: Eric Krawczyk (10), Joe Splendorio (9), Keith Ferguson (7), Mike Jamin (5), Steve Busch (4), Shaun Hawkins (3), Ron Mateo (3), Bill Murphy (3), Bruce Starks (3), Rick Furbush (2), Eamon McEneaney (2), George Milosevic (2), Chad Nice (2), Chris Ritter (2), Brian Romney (2), Vic Yanz (2), Aaron Berryman (1), Ned Burke (1), Ed Burnap (1), Erv Bratcher (1), Jack Corrigan (1), Pat Dutton (1), Stu Fullerton (1), Chris Hahn (1), Derrick Harmon (1), Tim Hermann (1), Craig Jaeger (1), John Kellner (1), Stu Merz (1), Scott Oliaro (1), Jim Perrello (1), Mike Ready (1). 150-Yard Games: Keith Ferguson (4), Mike Jamin (2), Aaron Berryman (1), Eric Krawczyk (1), Stu Merz (1), Bill Murphy (1), Chris Ritter (1), Joe Splendorio (1). 200-Yard Games: Joe Splendorio (1).

Rec. Avg. T D Yds 11 ... 18.5 .. 1 ... 204 14 ... 12.6 .. 0 ... 177 11 ... 15.9 .. 0 ... 175 14 ... 12.2 .. 2 ... 171 5 .... 32.8 .. 1 ... 164 8 .... 20.5 .. 1 ... 164 10 ... 16.3 .. 1 ... 163 7 .... 23.0 .. 0 ... 161 6 .... 25.8 .. 1 ... 155 3 .... 51.7 .. 0 ... 155 12 ... 12.8 .. 2 ... 154 7 .... 21.4 .. 1 ... 150 9 .... 16.4 .. 1 ... 148 12 ... 12.2 .. 3 ... 146 12 ... 12.0 .. 1 ... 144 13 ... 11.1 .. 0 ... 144 4 .... 35.5 .. 1 ... 142 13 ... 10.8 .. 1 ... 141 7 .... 20.0 .. 1 ... 140

SEASON RECEIVING YARDS Year EricKrawczyk ...... 1997 .. Joe Splendorio ..... 1999 .. BillMurphy ....... 1967 .. Keith Ferguson ..... 2002 .. Mike Jamin ....... 1992 .. EricKrawczyk ...... 1996 .. Brian Romney ..... 2004 .. Steve Busch ....... 1996 .. Ron Mateo ........ 1995 .. Keith Ferguson ..... 2000 .. Joe Splendorio ..... 1998 .. Joe Splendorio ..... 2000 .. BruceStarks ....... 1974 .. JohnKellner ....... 2003 .. Steve Busch ....... 1995 .. JimPerrello ....... 1985 .. Aaron Berryman .... 1994 ..

Avg. 11.7 .. 14.5 .. 17.1 .. 12.2 .. 16.2 .. 14.8 .. 12.8 .. 12.6 .. 14.8 .. 16.6 .. 14.7 .. 13.7 .. 13.2 .. 11.9 .. 21.5 .. 15.7 .. 15.7 ..

Rec. 89 ... 65 ... 50 ... 70 ... 49 ... 53 ... 60 ... 57 ... 47 ... 41 ... 46 ... 46 ... 47 ... 49 ... 27 ... 36 ... 36 ...

CAREER RECEIVING YARDS Years Rec. Keith Ferguson ..... 1999-2002 202 .. Joe Splendorio ..... 1997-2000 165 .. EricKrawczyk ...... 1995-97 .. 176 .. JohnKellner ....... 2001-03 .. 116 .. Steve Busch ....... 1994-96 .. 91 ... BruceStarks ....... 1973-75 .. 92 ... Mike Jamin ....... 1990-92 .. 84 ... Ron Mateo ........ 1992-95 .. 95 ... Shaun Hawkins .... 1985-87 .. 58 ... Aaron Berryman .... 1992-94 .. 80 ...

Avg. 12.7 14.1 13.0 13.0 15.8 13.3 15.2 13.0 20.5 14.1

TD 11 ... 10 ... 9 .... 2 .... 6 .... 5 .... 3 .... 4 .... 3 .... 5 .... 6 .... 3 .... 2 .... 3 .... 4 .... 5 .... 4 ....

Yds 1,042 944 853 852 794 786 766 720 695 680 677 630 619 582 581 566 565

TD .. 14 .. .. 20 .. .. 17 .. .. 8 ... .. 9 ... .. 5 ... .. 7 ... .. 9 ... .. 15 .. .. 9 ...

Yds 2,569 2,337 2,285 1,512 1,435 1,292 1,280 1,235 1,187 1,135

LONGEST RECEPTIONS 98 yards ........ Norman Dawson from Bob Dean vs. Navy, 1947 90 yards ............. Stu Merz from Rocco Calvo at Yale, 1951 88 yards .......... Steve Busch from Steve Joyce at Brown, 1995 79 yards ........... Jim Burry from Chris Metz vs. Harvard, 1979 79 yards .......... Chad Nice from D.J. Busch vs. Princeton, 2004 78 yards .......... Chad Levitt from Per Larson at Bucknell, 1994 77 yards ..... Tim LaBeau from Jay LaRochelle vs. Columbia, 1975 77 yards ........... Chad Nice from D.J. Busch at Harvard, 2004 76 yards ......... Chris Ritter from Bill Robertson at Brown, 1968 76 yards ....... Phil Taylor from Dave McKelvey at Harvard, 1959 75 yards ... George Milosevic from Mark Allen vs. Dartmouth, 1972 74 yards .......... Art Boland from Bill DeGraaf at Brown, 1955 72 yards ........ Terry Thomas from Chris Metz vs. Colgate, 1981

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

MOST YARDS GAINED BY A SENIOR Game: 177 by Keith Ferguson at Brown, 10-26-02 (14 catches) Season: 1,042 by Eric Krawczyk, 1997 (89 catches)

SINGLE-GAME RECEIVING YARDS Player, Opp., Year Joe Splendorio at Brown, 1999 ....... Keith Ferguson at Brown, 2002 ....... Keith Ferguson vs. Dartmouth, 2002 .... Eric Krawczyk vs. Colgate, 1997 ....... Mike Jamin vs. Brown, 1992 .......... Keith Ferguson vs.Princeton, 2000 ..... Bill Murphy vs. Harvard, 1967 ........ Mike Jamin vs. Yale, 1991 ........... Aaron Berryman at Columbia, 1994 .... Stu Merz at Yale, 1951 ............. Keith Ferguson at Harvard, 2002 ...... Chris Ritter at Columbia, 1968 ....... Eric Krawczyk at Lafayette, 1996 ...... Eric Krawczyk at Dartmouth, 1997 ..... SteveBuschvs.Princeton,1996 ....... Steve Busch at Buffalo, 1996 ......... Chad Nice vs. Princeton, 2004 ........ Eric Krawczyk at Fordham, 1997 ...... Jack Corrigan vs. Harvard, 1973 .......

HISTORY

Total Offense Records MOST PLAYS Game: 71 by Ricky Rahne at Bucknell, 9-16-00 Season: 552 by Ricky Rahne, 2000 Career: 1,448 by Ricky Rahne, 1998-2001 MOST YARDS GAINED 440 by Ricky Rahne at Brown, 10-21-00 (66 plays, -6 rushing, 446 passing) Season: 3,036 by Ricky Rahne, 2000 (552 plays, 92 rushing, 3,036 passing) Career: 7,994 by Ricky Rahne, 1998-2001 (1,448 plays, 284 rushing, 7,710 passing)

Game:

HIGHEST AVERAGE GAIN PER PLAY 10.9 by Gary Wood vs Princeton, 10-27-62 (31plays-337 yards) (min. 20 plays) Season: 6.8 by Steve Joyce, 1995 (319 plays-2,166 yards) (min. 175 plays) Career: 5.7 by Derrick Harmon, 1981-83 (558 plays-3,160 yards) (min. 330 plays) Game:

MOST TOUCHDOWNS RESPONSIBLE FOR (TDs scored or passed for) Game: 5 by Ed Marinaro at Penn, 11-20-71 (scored 5, passed for 0) 5 by Ed Marinaro vs. Harvard, 10-18-69 (scored 5, passed for 0) 5 by Marty Sponaugle at Brown, 11-6-65 (scored 2, passed for 3) Season: 25 by Ricky Rahne, 1999 (scored 0, passed for 25) Career: 59 by Ricky Rahne, 1998-2001 (scored 5, passed for 54) MOST YARDS GAINED BY A FRESHMAN 126 by Terry Smith at Columbia, 11-12-94 (13 plays, 126 rushing, 0 passing) Season: 671 by Terry Smith, 1994 (118 plays, 671 rushing, 0 passing)

Game:

MOST YARDS GAINED BY A SOPHOMORE 430 by Ricky Rahne at Brown, 10-2-99 (60 plays, -13 rushing, 443 passing) Season: 2,696 by Ricky Rahne, 1999 (432 plays, -66 rushing, 2,762 passing)

Game:

MOST YARDS GAINED BY A JUNIOR 440 by Ricky Rahne at Brown, 10-21-2000 (66 plays, -6 rushing, 446 passing) Season: 3,036 by Ricky Rahne, 2000 (552 plays, 92 rushing, 2,944 passing) Game:

MOST YARDS GAINED BY A SENIOR 388 by Mark Allen at Penn, 11-24-73 (66 plays, -7 rushing, 395 passing) Season: 2,255 by Ricky Rahne, 2001 (457 plays, 271 rushing, 1,984 passing)

WWW .CORNELL B IG R ED . COM

Game:

All-Purpose Records

SEASON TOTAL OFFENSE Year Plays Ricky Rahne .... 2000 .. 552 .. Ricky Rahne .... 1999 .. 432 .. BillLazor ...... 1992 .. 405 .. RIcky Rahne .... 2001 .. 457 .. Steve Joyce ..... 1995 .. 319 .. BillLazor ...... 1993 .. 403 .. Mike Hood ..... 1998 .. 364 .. Ed Marinaro .... 1971 .. 356 .. Gary Wood ..... 1962 .. 290 .. Mick Razzano ... 2002 .. 369 .. Chris Cochrane .. 1990 .. 268 .. Kevin Sigler .... 1974 .. 299 .. Mark Allen ..... 1973 .. 368 .. ScottCarroll .... 1996 .. 286 .. D.J.Busch ...... 2004 .. 275 .. BillLazor ...... 1991 .. 274 .. CAREER TOTAL OFFENSE Years Plays Ricky Rahne .. 1998-2001 1,448 . BillLazor .... 1991-93 .. 1,082 . Ed Marinaro .. 1969-71 .. 919 .. Chad Levitt .. 1993-96 .. 922 .. Gary Wood ... 1961-63 .. 744 .. Mark Allen ... 1971-73 .. 854 .. Mike Hood ... 1996-98 .. 731 .. Chris Cochrane 1988-90 .. 631 .. Derrick Harmon 1981-83 .. 558 .. ScottCarroll .. 1995-97 .. 548 ..

Rec. 51 ...... 163 ..... 270 ..... 407 ..... 129 .....

PR Kr 0 ..... 0 ..... 0 ..... 455 ... 5 ..... 19 .... 9 ..... 351 ... 0 ..... 0 .....

IR 0 ..... 0 ..... 0 ..... 0 ..... 0 .....

Yds 1,932 ..... 1,616 ..... 1,570 ..... 1,556 ..... 1,555 .....

Avg. 214.7 161.6 157.0 155.6 172.8

CAREER ALL-PURPOSE Years Chad Levitt .... 1993-96 Ed Marinaro .... 1969-71 Derrick Harmon . 1981-83 John McNiff .... 1989-91 Gary Wood* .... 1961-63

Rush 4,657 4,715 3,074 2,557 2,156

Rec. 379 ..... 232 ..... 679 ..... 375 ..... 22 ......

PR 0 ..... 0 ..... 5 ..... 0 ..... 126 ...

IR 0 ..... 0 ..... 0 ..... 0 ..... 0 .....

Yds 5,117 ..... 4,947 ..... 3,800 ..... 3,558 ..... 3,352 .....

Avg. 134.7 183.2 140.7 127.1 124.1

2005 FOOTBALL

Rush 92 ... -66 ... 174 .. 271 .. -89 ... 44 ... -3 .... 1,881 . 889 .. 108 .. 387 .. -35 ... -23 ... -48 ... -8 .... 63 ...

Pass 2,944 . 2,762 . 2,206 . 1,984 . 2,255 . 2,030 . 1,910 . 0 .... 890 .. 1,556 . 1,266 . 1,648 . 1,590 . 1,583 . 1,534 . 1,461 .

Avg. Yds 5.5 .. 3,036 6.2 .. 2,696 5.9 .. 2,380 4.9 .. 2,255 6.8 .. 2,166 5.2 .. 2,074 5.2 .. 1,907 5.3 .. 1,881 6.1 .. 1,779 4.5 .. 1,664 6.2 .. 1,653 5.4 .. 1,613 4.3 .. 1,567 5.4 .. 1,535 5.5 .. 1,526 5.6 .. 1,524

Rush Pass 284 .... 7,710 . 281 .... 5,697 . 4,715 .. 0 .... 4,657 .. 0 .... 2,156 .. 1,891 . 613 .... 3,313 . 257 .... 3,406 . 544 .... 2,784 . 3,074 .. 86 ... -56 .... 2,961 .

Avg. 5.5 .. 5.5 .. 5.1 .. 5.1 .. 5.4 .. 4.6 .. 5.0 .. 5.3 .. 5.7 .. 5.3 ..

Yds 7,994 5,978 4,715 4,657 4,047 3,926 3,663 3,328 3,160 2,905

MOST ALL-PURPOSE YARDS GAINED (Yards gained rushing, receiving and runbacks) Game: 395 by Scott Oliaro at Yale, 11-3-90 (288 rush., 85 rec., 22 ret.) Season: 1,932 by Ed Marinaro, 1971 (1,881 rush., 51 rec.) Career: 5,117 by Chad Levitt, 1993-96 (4,657 rush., 379 rec., 81 ret.)

Rush 1,881 .... 998 ..... 1,276 .... 789 ..... 1,426 ....

.... .... .... .... ....

RECORDS

SINGLE-GAME TOTAL OFFENSE Player, Opp., Year Plays Rush Pass Avg. Yds Ricky Rahne at Brown, 2000 ...... 66 ... -6 .. 446 . 6.8 . 440 Ricky Rahne at Brown, 1999 ...... 60 .. -13 .. 443 . 7.4 . 430 Bill Lazor at Columbia, 1992 ...... 65 ... 9 ... 400 . 6.2 . 409 Ricky Rahne at Harvard, 2000 ..... 59 ... 5 ... 391 . 6.6 . 396 Mark Allen at Penn, 1973 ........ 66 ... -7 .. 395 . 6.0 . 388 Gary Wood at Penn, 1962 ........ 54 .. 207 .. 180 . 7.2 . 387 Ricky Rahne at Penn, 2000 ....... 70 ... 45 .. 306 . 5.0 . 351 Mick Razzano vs. Dartmouth, 2002 . 44 ... 38 .. 302 . 7.7 . 340 Scott Carroll at Buffalo, 1996 ..... 57 ... -6 .. 344 . 5.9 . 338 Gary Wood vs. Princeton, 1962 .... 31 .. 125 .. 212 . 10.7 . 337 D.J. Busch vs. Columbia, 2003 ..... 46 ... 14 .. 312 . 7.1 . 326 Steve Joyce at Brown, 1995 ....... 31 .. -16 .. 341 . 10.5 . 325 Bill Lazor vs. Yale, 1991 .......... 51 ... 7 ... 317 . 6.4 . 324 Ricky Rahne vs. Harvard, 1999 ..... 57 ... 25 .. 297 . 5.6 . 322 Bill Lazor at Brown, 1991 ........ 54 ... -4 .. 321 . 5.9 . 317 Ricky Rahne vs. Princeton, 2000 .... 60 ... 37 .. 279 . 5.3 . 316 Ricky Rahne vs. Columbia, 1999 ... 41 ... -8 .. 320 . 7.6 . 312 Mike Hood vs. Bucknell, 1998 ..... 47 ... 15 .. 296 . 6.6 . 311 Bill Lazor vs. Columbia, 1993 ..... 48 ... 27 .. 283 . 6.5 . 310 Ricky Rahne at Princeton, 1999 .... 35 ... 3 ... 307 . 8.9 . 310

SEASON ALL-PURPOSE Year Ed Marinaro .... 1971 ..... John McNiff .... 1990 ..... Derrick Harmon . 1983 ..... PeteFitzpatrick . 1993 ..... Ed Marinaro .... 1970 .....

.. .. .. .. ..

AND

Kr 81 .... 0 ..... 42 .... 626 ... 1,048 ..

* - punt and kick returns not kept in 1961

HISTORY

AND

RECORDS

Scoring Records MOST POINTS SCORED Game: 32 by Ed Marinaro at Penn, 11-20-71 Season: 148 by Ed Marinaro, 1971 Career: 318 by Ed Marinaro, 1969-71 MOST TOTAL TOUCHDOWNS 5 by Ed Marinaro vs. Harvard, 10-18-69: by Ed Marinaro at Penn, 11-20-71 Season: 24 by Ed Marinaro, 1971 Career: 52 by Ed Marinaro, 1969-71

Game:

MOST RUSHING TOUCHDOWNS 5 by Ed Marinaro vs. Harvard, 10-18-69: by Ed Marinaro at Penn, 11-20-71 Season: 24 by Ed Marinaro, 1971 Career: 50 by Ed Marinaro, 1969-71

Game:

MOST PASSING TOUCHDOWNS 4 by Mark Allen at Brown, 11-11-72; by Mark Allen vs. Columbia, 11-3-73; by Mike Hood vs. Buffalo, 10-3-98; by Ricky Rahne vs. Fordham, 9-25-99; by Ricky Rahne vs. Columbia, 11-13-99; by Ricky Rahne at Harvard, 10-7-00 Season: 25 by Ricky Rahne, 1999 Career: 54 by Ricky Rahne, 1998-2001

Game:

MOST POINTS SCORED BY A KICKER Game: 14 by Mike Cochrane vs. Lafayette, 10-3-92 Season: 63 by Mathew Hepfer, 1990; Mike Cochrane, 1992; John McCombs, 1997 Career: 148 by John McCombs, 1997-99 MOST FIELD GOALS MADE Game: 4 by Trevor MacMeekin vs. Yale, 9-25-04 Season: 13 by Mike Cochrane, 1992 (23 attempts) Career: 26 by John McCombs, 1997-99 (35 attempts) MOST EXTRA POINTS MADE 7 by Keith Manz at Penn, 9-22-79 7 by Pete Zogby at Lehigh, 10-2-65 7 by Peter Iverson vs. Dartmouth, 11-4-00 Season: 30 by Mathew Hepfer, 1990 (32 attempts); 30 by John McCombs, 1997 (31 attempts) Career: 71 by Bill Kirk, 1949-51 (95 attempts); 71 by John Rodin, 1993-96 (77 attempts)

Game:

CAREER

TOUCHDOWNS Years Ed Marinaro, RB .... 1969-71 Chad Levitt, RB .... 1993-96 JeffFleischmann,HB . 1948-50 Derrick Harmon, RB . 1981-83 John McNiff, RB .... 1989-91 Pete Larson, HB .... 1964-66 ScottOliaro,RB .... 1989-92 DonFanelli,RB ..... 1973-75 Joe Splendorio, WR . 1997-00 Gary Wood, QB .... 1961-63 TOUCHDOWNS Year Ed Marinaro, RB .... 1971 Joe Holland, RB .... 1978 Chad Levitt, RB .... 1995 Ed Marinaro, RB .... 1969 Ed Marinaro, RB .... 1970 Chad Levitt, RB .... 1996 Chad Levitt, RB .... 1994 Derrick Harmon, RB . 1983 Scott Malaga, RB ... 1988

Run 50 ... 44 ... 28 ... 26 ... 22 ... 19 ... 20 ... 21 ... 0 .... 18 ...

Rec. 2 .... 4 .... 0 .... 2 .... 1 .... 3 .... 2 .... 0 .... 20 ... 0 ....

Ret. 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 1 ....

TDs 52 48 28 28 23 22 22 21 20 19

Run 24 ... 16 ... 13 ... 14 ... 14 ... 13 ... 12 ... 12 ... 12 ...

Rec. 0 .... 0 .... 2 .... 0 .... 0 .... 1 .... 1 .... 0 .... 0 ....

Ret. 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 ....

TDs 24 16 15 14 14 14 13 12 12

SEASON

.. .. .. .. .. .. .. .. ..

CAREER KICKING POINTS Years John McCombs ..... 1997-99 .. John Rodin ......... 1993-96 .. JohnKillian ........ 1969-71 .. PeterIverson ....... 1998-01 .. Mike Cochrane ..... 1991-92 .. Trevor MacMeekin ... 2002-04 .. Pete Zogby ........ 1965-67 .. Pete Gogolak ....... 1961-63 .. BillKirk ........... 1949-51 .. Tom Aug .......... 1985-86 ..

PAT 70-72 71-77 60-66 53-56 33-38 34-39 50-62 54-55 71-95 32-37

FG ... 26-35 .... ... 25-45 .... ... 17-36 .... ... 14-26 .... ... 19-31 .... ... 17-29 .... ... 11-22 .... ... 9-27 ..... ... 2 ....... ... 14-30 ....

Pts. 148 146 111 95 90 85 83 81 77 74

MOST TWO-POINT CONVERSIONS Game: 2 by three players. Last: Dan Malone at Brown, 11-11-72 Season: 3 by Rick Furbush, 1970 Career: 3 by Derrick Harmon, 1981-83; Ed Marinaro, 1969-71; Rick Furbush, 1969-70

SEASON

SCORING Year 1971 1978 1995 1970 1996 1969 1994 1983 1988 1966

Rush Pass Other PAT-K PAT-R/P ....... 24 ....... 0 ..... 0 ....... 0 ..... 1-r,1-p ...... ....... 16 ....... 0 ..... 0 ....... 0 ....... 0 ........ ....... 13 ....... 2 ..... 0 ....... 0 ..... 1-r,0-p ...... ....... 14 ....... 0 ..... 0 ....... 0 ..... 1-r,0-p ...... ....... 13 ....... 1 ..... 0 ....... 0 ..... 1-r,0-p ...... ....... 14 ....... 0 ..... 0 ....... 0 ....... 0 ........ ....... 12 ....... l..... 0 ....... 0 ....... 0 ........ ....... 12 ....... 0 ..... 0 ....... 0 ..... 1-r,0-p ...... ....... 12 ....... 0 ..... 0 ....... 0 ....... 0 ........ ....... 11 ....... 0 ..... 0 ....... 0 ..... 1-r,0-p ......

FG SAF Pts 0 ..... 0 ..... 148 0 ..... 0 ..... 96 0 ..... 0 ..... 92 0 ..... 0 ..... 86 0 ..... 0 ..... 84 0 ..... 0 ..... 84 0 ..... 0 ..... 78 0 ..... 0 ..... 74 0 ..... 0 ..... 72 0 ..... 0 ..... 68

CAREER SCORING Ed Marinaro .......... Chad Levitt .......... Derrick Harmon ....... Jeff Fleischmann ....... John McCombs ........ John Rodin ........... John McNiff .......... Pete Larson ........... Scott Oliaro .......... Don Fanelli ...........

Years 1969-71 1993-96 1981-83 1948-50 1997-99 1993-96 1989-91 1964-66 1989-92 1973-75

Rush Pass Other PAT-K PAT-R/P FG SAF Pts .... 50 ....... 2 ..... 0 ....... 0 ..... 2-r,1-p ...... 0 ..... 0 ..... 318 .... 44 ....... 4 ..... 0 ....... 0 ..... 2-r,0-p ...... 0 ..... 0 ..... 292 .... 26 ....... 2 ..... 0 ....... 0 ..... 3-r,0-p ...... 0 ..... 0 ..... 174 .... 28 ....... 0 ..... 0 ....... 0 ....... 0 ........ 0 ..... 0 ..... 168 ..... 0 ....... 0 ..... 0 ..... 70-72 ..... 0 ....... 26-35 ... 0 ..... 148 ..... 0 ....... 0 ..... 0 ..... 71-77 ..... 0 ....... 25-45 ... 0 ..... 146 .... 22 ....... 1 ..... 0 ....... 0 ..... 1-r,0-p ...... 0 ..... 0 ..... 140 .... 19 ....... 3 ..... 0 ....... 0 ..... 1-r,0-p ...... 0 ..... 0 ..... 134 .... 20 ....... 2 ..... 0 ....... 0 ....... 0 ........ 0 ..... 0 ..... 132 .... 21 ....... 0 ..... 0 ....... 0 ..... 0-r,1-p ...... 0 ..... 0 ..... 128

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Ed Marinaro .......... Joe Holland .......... Chad Levitt .......... Ed Marinaro .......... Chad Levitt .......... Ed Marinaro .......... Chad Levitt .......... Derrick Harmon ....... Scott Malaga ......... Pete Larson ...........

HISTORY

Defensive Records TACKLES (officially recorded since 1977) MOST TACKLES Game: 27 by Chris Zingo at Brown, 11-2-91 Season: 179 by Chris Zingo, 1992 Career: 530 by John Hanson, 1995-98 MOST TACKLES BY A LINEMAN Season: 88 by Kevin McCarthy, 1982; Steve Duca, 1981 Career: 185 by Steve Duca, 1980-82 MOST TACKLES BY A LINEBACKER Season: 179 by Chris Zingo, 1992 Career: 530 by John Hanson, 1995-98 MOST TACKLES BY A DEFENSIVE BACK Season: 132 by Chris Allen, 1996 Career: 331 by Chris Allen, 1994-97

PASS DEFENSE MOST INTERCEPTIONS Game: 3 by Scott Walter vs Brown, 10-16-82; Scott Walter at Columbia, 11-13-82; Dave Kimichik at Columbia, 11-15-80; Chris Hanson at Fordham, 9-24-94; Doug Knopp vs. Holy Cross, 9-23-95 Season: 8 by Scott Walter, 1982; Chris Hanson, 1994 Career: 15 by Hillary Chollet, 1945-46, 48-49 MOST YARDS ON INTERCEPTION RETURNS Game: 120 by Carl Holland vs Syracuse, Nov. 8, 1947 (2 INTs) Season: 169 by Jim Frontero, 1986 (7 INTs) Career: 218 by Hillary Chollet, 1945-46 and 1948-49 (15 INTs) MOST TOUCHDOWNS ON INTERCEPTION RETURNS Career: 2 by Rip Haley, 1949; Chris Ruth, 1966-68; Chris Mazoue, 1989-91 MOST PASSES BROKEN UP Season: 15 by Mike Raich, 1985 Career: 32 by Mike Raich, 1985-87 99 yards 97 yards 95 yards 81 yards 74 yards 72 yards 71 yards

LONGEST INTERCEPTION RETURNS ......................... Mark Broderick vs. Brown, 1990 ............................... Ken Davis at Army, 1942 .......................... Carl Holland vs. Syracuse, 1947 ...................... Keith Cummins at Dartmouth, 1967 ........................... Jim Frontero vs. Brown, 1986 ............................. Chip Ruth at Brown, 1968 ........................... John Webster at Brown, 1958

SACKS (officially recorded since 1977) MOST QUARTERBACK SACKS Season: 12 by Tom McHale, 1986 Career: 19 by Seth Payne, 1993-96 MOST SACKS BY A LINEMAN Season: 12 by Tom McHale, 1986 Career: 19 by Seth Payne, 1993-96 MOST SACKS BY A LINEBACKER Season: 8 by Chris Zingo, 1992 Career: 18 by Chris Zingo, 1991-93

WWW .CORNELL B IG R ED . COM

MOST SACKS BY A DEFENSIVE BACK Season: 4 by Brent Felitto, 1986; Gerry Willinger, 1990 Career: 5 by Brent Felitto, 1985-87

SEASON TACKLES

John Hanson .... Chris Zingo .... JohnVitullo ..... Mike Scully ..... Mitch Lee ...... Chris Allen ..... Jim DeStefano .. Seth Payne ..... Tom Bernardo .. Tom Nunes .....

... ... ... ... ... ... ... ... ... ...

Solo Assists Sacks 127 ... 52 .... 8 ..... 106 ... 67 .... 4 ..... 112 ... 48 .... 6 ..... 108 ... 49 .... 1 ..... 90 .... 64 .... 2 ..... 98 .... 51 .... 2 ..... 95 .... 45 .... 0 ..... 100 ... 35 .... 1 ..... 67 .... 67 .... 0 ..... 74 .... 58 .... 0 .....

Totals 179 173 160 157 154 149 140 135 134 132

Years 1995-98 1991-93 1992-95 1981-83 1987-89 1994-97 1978-80 1993-96 1984-86 1995-98

... ... ... ... ... ... ... ... ... ...

Solo Assists Sacks 359 ... 171 ... 5 ..... 345 ... 167 ... 18 .... 257 ... 149 ... 3 ..... 193 ... 156 ... 3 ..... 225 ... 107 ... 5 ..... 188 ... 143 ... 0 ..... 160 ... 153 ... 10 .... 109 ... 184 ... 19 .... 155 ... 136 ... 0 ..... 206 ... 71 .... 1 .....

Totals 530 512 406 349 332 331 313 293 291 277

SEASON INTERCEPTIONS Year Chris Hanson ...... 1994 Scott Walter ....... 1982 Jim Frontero ....... 1986 Dick Jackson ....... 1954 Dave Kimichik ..... 1980 Pete Knight ....... 1972 Frank Farace ....... 1984 Doug Knopp ...... 1995 PaulTully ......... 1989

..... ..... ..... ..... ..... ..... ..... ..... .....

INT Yards 8 ....... 83 ....... 8 ....... 40 ....... 7 ....... 169 ...... 7 ....... 83 ....... 7 ....... 19 ....... 7 ....... 96 ....... 6 ....... 68 ....... 6 ....... 6 ........ 6 ....... 70 .......

Avg. 10.4 5.0 24.2 11.9 2.7 13.7 11.3 1.0 11.7

CAREER INTERCEPTIONS Years HillaryChollet ..... 1945-49 ... Doug Knopp ...... 1993-95 ... Rip Haley ......... 1948-50 ... Dave Kimichik ..... 1980-81 ... Dick Meade ....... 1953-55 ... Mike Raich ........ 1985-87 ... Dick Jackson ....... 1953-55 ... PaulTully ......... 1988-90 ... Frank Farace ....... 1982-84 ... Jim Frontero ....... 1984-86 ...

INT Yards 15 ...... 218 ...... 13 ...... 33 ....... 11 ...... 162 ...... 11 ...... 42 ....... 11 ...... 75 ....... 11 ...... 83 ....... 10 ...... 124 ...... 10 ...... 70 ....... 9 ....... 96 ....... 9 ....... 193 ......

Avg. 14.5 2.5 14.7 3.8 6.8 7.5 12.4 7.0 10.6 21.4

SEASON SACKS Tom McHale ...... Bob Garvey ........ Kevin McCarthy .... Bob Weggler ...... Seth Payne ........ Gary Rinkus ........ Kevin Marcus ...... StuartTross ....... Chris Zingo ....... Pete Combe ....... CAREER SACKS

Chris Zingo â&#x20AC;&#x2DC;94

2005 FOOTBALL

RECORDS

Year 1992 1993 1991 1988 1996 1977 1997 1998 1983 1996

Chris Zingo ....... Chris Zingo ....... Chris Zingo ....... Mitch Lee ......... John Hanson ....... Terry Lee ......... John Hanson ....... John Hanson ....... Mike Scully ........ Chris Allen ........ CAREER TACKLES

AND

Seth Payne ........ Chris Zingo ....... Bryan Sacco ....... Tom McHale ...... Gary Rinkus ........ Pete Combe ....... Jay Bolton ......... Tom Crone ........ Bob Garvey ........ Kevin McCarthy ....

Year 1986 1993 1982 1978 1996 1986 1991 1987 1992 2002

.......... .......... .......... .......... .......... .......... .......... .......... .......... ..........

Pos. DE ........... DE ........... DE ........... DE ........... DE ........... D T ........... D T ........... DE ........... LB ........... DL ...........

Sacks 12 11 11 10 9 9 8 8 8 7.5

Years 1993-96 ........ 1991-93 ........ 1998-01 ........ 1985-86 ........ 1985-87 ........ 1999-02 ........ 1998-00 ........ 1998-00 ........ 1992-93 ........ 1980-82 ........

Pos. DE ........... LB ........... DE ........... DE ........... D T ........... DL ........... DL ........... DL ........... DE ........... DE ...........

Sacks 19 18 15.5 14 13 12.5 12 11 11 11

HISTORY

AND

RECORDS

Special Teams Records PUNT RETURNS MOST PUNT RETURNS Game: 8 by Dan Jystad at Harvard, 10-11-86 8 by Peter Knight at Princeton, 11-25-72 Season: 34 by Brian Romney, 2004 Career: 57 by Chris Allen, 1994-97 MOST YARDS ON PUNT RETURNS Game: 113 by Hillary Chollet vs. Niagara, 9-24-49 (5 returns) Season: 261 by Hillary Chollet, 1949 (22 returns) Career: 606 by Keith Cummins, 1967-69 (44 returns) HIGHEST AVERAGE GAIN PER PUNT RETURN Game: 25.7 by Chris Allen vs. Yale, 11-8-97 (3-77) (min. 3 returns) Season: 14.7 by Walter Kretz, 1946 (15-220) (min. 9 returns) Career: 13.8 by Keith Cummins, 1967-69 (44-606) (min. 18 returns)

PUNTING MOST PUNTS Season: 69 by Bill Arthur, 1968 (2,583 yds., 37.4 avg.); 69 by Mike Baumgartel, 2004 (2,449 yds., 35.5 avg.); Career: 244 by Mike Baumgartel, 2001-04 (8,774 yds., 37.0 avg.) MOST PUNTING YARDS Season: 2,610 by Charles Watson, 1998 (64 punts, 40.8 avg.) Career: 8,774 by Mike Baumgartel, 2001-04 (244 punts, 37.0 avg.) PUNTING AVERAGE Season: 40.78 by Charles Watson, 1998 (64 punts, 2,610 yds.) Career: 39.7 by Charles Watson, 1995-98 (187 punts, 7,416 yds.)

KICK BLOCKS BLOCKED KICKS Season: 4 by Ed Groszewski, 1991 Career: 6 by Joel Sussman, 2001-pr.

LONG

KICKOFF RETURNS MOST KICKOFF RETURNS Game: 9 by Vince Bates at Brown, 10-21-00 Season: 40 by Vince Bates, 2000 Career: 79, by Vince Bates, 1999-2002 MOST YARDS ON KICKOFF RETURNS Game: 198 by Vince Bates at Brown, 10-21-00 (9 returns) Season: 814 by Vince Bates, 2000 (40 returns) Career: 1,443 by Vince Bates, 1999-2002 (79 returns) HIGHEST AVERAGE GAIN PER RETURN Game: 52.7 by Bob Baker vs. Yale, 10-24-64 (3-158) (min. 3 returns) Season: 35.1 by Bob Baker, 1964 (11-386) (min. 9 returns) Career: 27.7 by Bob Baker, 1962-64 (23-636) (min. 20 returns)

PLACE-KICKING MOST POINTS SCORED BY A KICKER Game: 14 by Mike Cochrane vs. Lafayette, 10-3-92 Season: 63 by Mathew Hepfer, 1990; Mike Cochrane, 1992; John McCombs, 1997 Career: 148 by John McCombs, 1997-99 MOST FIELD GOALS ATTEMPTED Game: 6 by Mike Cochrane vs. Lehigh, 9-26-92 Season: 23 by Dave Quarles, 1987; Mike Cochrane, 1992 Career: 45 by John Rodin, 1993-96 MOST FIELD GOALS MADE Game: 4 by Trevor MacMeekin vs. Yale, 9-25-04 (4 attempts) Season: 13 by Mike Cochrane, 1992 (23 attempts) Career: 26 by John McCombs, 1997-99 (35 attempts)

TOUCHDOWN

CONVERSIONS

MOST EXTRA POINTS ATTEMPTED Game: 8 by Bill Kirk vs. Columbia, 10-29-49 Season: 41 by Bill Kirk, 1949 Career: 95 by Bill Kirk, 1949-51

LONGEST KICKOFF RETURNS 100 yards ................ Bo Roberson at Colgate, 1956 99 yards .................... Pete Larson vs. Yale, 1966 98 yards ................ Chris Ritter vs. Dartmouth, 1966 98 yards ............... Dick Jackson vs. Dartmouth, 1954 97 yards .................. Dan Malone vs. Lehigh, 1973 97 yards ................ Barrett Rosser at Harvard, 1972 90 yards 82 yards 80 yards 80 yards 73 yards

LONGEST PUNT RETURNS .................... Dan Walker at Penn, 1967 .................. Mike Raich vs Lafayette, 1987 ............... Keith Cummins vs Colgate, 1969 ................... Bill Kirk vs Dartmouth, 1950 ................ Vincent Bates vs. Harvard, 1999

88 yards 81 yards 77 yards 75 yards 74 yards 73 yards

LONGEST PUNTS ................... Bob Dean vs. Colgate, 1948 ............. Mike Baumgartel vs. Harvard, 2001 ................ Mike Baumgartel vs. Yale, 2002 ............. Charles Watson at Dartmouth, 1997 .............. Charles Watson vs. Princeton, 1997 ............. Charles Watson vs. Dartmouth, 1998

HIGHEST PERCENTAGE OF EXTRA POINTS MADE Season: 1.000 by Keith Manz, 1978 (23-23); John McCombs, 1999 (22-22); Pete Gogolak, 1962 (20-20); Pete Gogolak, 1963 (18-18); Peter Iverson, 2001 (21-21) (min. 15 made) Career: .982 by Pete Gogolak, 1961-63 (54-55) (min. 35 made) MOST CONSECUTIVE EXTRA POINTS MADE Career: 44 by Pete Gogolak, Nov. 18, 1961 through 1963 MOST TWO-POINT CONVERSIONS Game: 2 by three players. Last: Dan Malone at Brown, 11-11-72 Season: 3 by Rick Furbush, 1970 Career: 3 by Derrick Harmon, 1981-83; Ed Marinaro, 1969-71; Rick Furbush, 1969-70

Mike Baumgartel â&#x20AC;&#x2DC;05 2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

MOST EXTRA POINTS MADE 7 by Keith Manz at Penn, 9-22-79; 7 by Pete Zogby at Lehigh, 10-2-65; 7 by Peter Iverson vs. Dartmouth, 11-4-00 Season: 30 by Mathew Hepfer, 1990 (32 attempts); 30 by John McCombs, 1997 (31 attempts) Career: 71 by Bill Kirk, 1949-51 (95 attempts); 71 by John Rodin, 1993-96 (77 attempts)

Game:

54 yards 52 yards 50 yards 50 yards 50 yards 49 yards 48 yards 46 yards 46 yards 46 yards

PLAYS

LONGEST FIELD GOALS ................ John Killian vs. Columbia, 1969 .............. Tim McDermott vs. Harvard, 1993 .................. John Rodin vs. Harvard, 1995 .................. BillGoldyvs.Princeton,1984 ................. Pete Gogolak vs. Lehigh, 1963 ................ PeterBaccillevs.Harvard,1983 ................... Andy Bednar vs. Penn, 1988 ................... Tom Aug at Lafayette, 1986 ............... Mike Cochrane vs. Harvard, 1991 ................ Mike Cochrane vs. Lehigh, 1992

HISTORY

Cornell Team Records Team Game Records TOTAL OFFENSE Most Plays: 103 vs. Colgate, 9-30-72 (37-7) Most Yards Gained: 640 at Brown, 10-28-95 (38-28) Highest Average Gain Per Play: 8.3 vs. Princeton, 10-27-62, 50 plays, 415 yds (35-34) RUSHING Most Rushes: 83 vs. Colgate, 9-30-72 (37-7) Most Yards Gained: 484 vs. Penn, 11-18-78 (3517) Highest Average Gain Per Rush: 7.4 vs. Penn, 11-18-78 (35-17) PASSING Most Passes Attempted: 64 at Bucknell, 9-16-00 (15-38) Most Passes Completed: 41 vs. Colgate, 9-27-97 (38-44 OT) Most Yards Gained: 446 at Brown, 10-21-00 (40-56) Most Passes Had Intercepted: 7 at Princeton, 1121-87 (6-23) Highest Percentage Completed: (min. 15 att.) .813 vs. Princeton, 10-27-62 (35-34) Most Touchdown Passes: 5 at Penn, 11-22-03 (7-59); at Brown, 10-21-00 (40-56) INTERCEPTIONS Most Interceptions: 6 at Columbia, 11-15-80 (24-0); vs. Columbia, 10-29-49 (54-0) Most Yards on Interception Returns: 133 vs. Syracuse, 11-8-47 (12-6) PUNT RETURNS Most Punt Returns: 8 on 3 occasions; Last: at Harvard, 10-11-86 (3-0) Most Yards on Punt Returns: 157 vs. Bucknell, 9-28-46 (21-0) KICKOFF RETURNS Most Kickoff Returns: 10 at Princeton, 10-27-51 (15-53) Most Yards on Kickoff Returns: 228 at Princeton, 10-26-63 (14-51)

WWW .CORNELL B IG R ED . COM

SCORING (modern - since 1937) Most Points Scored: 57 at Columbia, 10-31-64 (57-20) Most Points Scored in One Quarter: 35 at Brown, 11-11-72 (2nd) Most Points Scored in One Half: 41 at Brown, 11-11-72(first) Most Touchdowns Scored: 8 at Columbia, 1031-64 (57-20); vs. Columbia, 10-29-49 (54-0) Most Extra Points Made by Kicking: 7 at Lehigh, 10-2-65 (49-13); at Penn, 9-22-79 (52-13); vs. Dartmouth, 11-4-00 (49-31) Most Field Goals Made: 4 vs. Yale, 9-25-2004 (19-7)

FIRST DOWNS Most First Downs: 31 vs. Merchant Marine, 1030-82 (34-0); vs. Colgate, 9-25-71 (38-20); at Columbia, 11-14-92 (30-35); vs. Columbia, 1115-97 (33-22) Most First Downs Rushing: 25 vs. Colgate, 9-2571 (38-20) Most First Downs Passing: 26 at Columbia, 1114-92 (30-35) Most First Downs by Penalty: 5 vs. Brown, 1111-67 (14-14); at Dartmouth, 10-4-97 (20-24); vs. Penn, 11-19-88 (19-6) PUNTING Most Punts: 24 vs. Penn State, 10-17-42 (0-0) Highest Average Per Punt (min. 5 att.): 51.4 vs. Dartmouth, 10-24-98 (14-11) FUMBLES Most Fumbles: 9 at Michigan, 11-8-52 (7-49); vs. Navy, 10-4-52 (7-31) Most Fumbles Lost: 6 on three occasions; Last: vs. Navy, 10-4-52 (7-31) PENALTIES Most Penalties: 16 at Harvard, 10-8-49 (33-14); at Yale, 11-9-85 (20-14) Most Yards Penalized: 160 at Yale, 11-9-85 (2014) TOTAL DEFENSE Fewest Plays Allowed: 23 vs. Lehigh, 9-27-47 (27-0) Fewest Yards Allowed: 41 vs. Lehigh, 9-27-47 (27-0) Fewest First Downs Allowed: 3 at Harvard, 1017-64 (0-16); vs. Lehigh, 9-27-47 (27-0) RUSHING DEFENSE Fewest Rushes Allowed: 20 vs. Lehigh, 9-27-47 (27-0) Fewest Rushing Yards Allowed: -62 vs. New York Univ., 9-25-48 (47-6) PASSING DEFENSE Fewest Attempts Allowed: 0 vs. Dartmouth, 1115-58 (15-32) Fewest Completions Allowed: 0 vs. Dartmouth, 11-15-58 (15-32); at Penn, 11-25-64 (33-0) Fewest Passing Yards Allowed: 0 vs. Dartmouth, 11-15-58 (15-32); at Penn, 11-25-64 (33-0) TURNOVERS Most Fumbles Caused: 10 vs. Colgate, 9-30-72 (37-7) Most Fumbles Recovered: 5,many times; Last: vs. Colgate, 9-30-72 (37-7)

John Bohrman’s swan dive into the end zone on a 63-yard touchdown reception highlighted the Big Red’s 23-14 win at undefeated Ohio State in 1939.

2005 FOOTBALL

AND

RECORDS

Team Season Records TOTAL OFFENSE Most Plays: 782 in 1997 (6-4) Most Yards: 4,199 in 1995 (6-4) Highest Average Gain per Play: 5.94 in 1940, 496 plays, 2,945 yds (6-2-0) RUSHING Most Rushes: 535 in 1982 (4-6) Most Yards Gained: 2,884 in 1971 (8-1) Highest Average Gain Per Rush: 5.14 in 1949 (8-1) PASSING Most Passes Attempted: 482 in 2000 (5-5) Most Passes Completed: 269 in 1997 (6-4) Most Yards Gained: 2,944 in 2000 (5-5) Most Passes Had Intercepted: 26 in 1987 (5-5) Highest Percentage Completed: .606 in 1990 (7-3) Most Touchdown Passes: 26 in 1999 (7-3) INTERCEPTIONS Most Interceptions: 25 in 1939 (8-0) Most Yards on Interception Returns: 355 in 1949 (8-1) PUNT RETURNS Most Punt Returns: 47 in 1986 (8-2) Most Yards on Punt Returns: 461 in 1946 (5-31) KICKOFF RETURNS Most Kickoff Returns: 56 in 2000 (5-5) Most Yards on Kickoff Returns: 1,019 in 2000 (5-5) SCORING (modern - since 1937) Most Points Scored: 284 in 1949 (record 8-1) Most Touchdowns Scored: 42 in 1949 (8-1) Most Extra Points Made by Kicking: 30 in 1990 (7-3); 1997 (6-4) Most Field Goals Made: 13 in 1992 (7-3) Most Field Goals Attempted: 23 in 1987 (5-5); 1992 (7-3) FIRST DOWNS Most First Downs: 224 in 1997 (6-4) Most First Downs Rushing: 145 in 1971 (8-1) Most First Downs Passing: 144 in 2000 (5-5) Most First Downs by Penalty: 24 in 1997 (6-4) PUNTING Most Punts: 80 1952 (2 7) Highest Average Per Punt: 40.2

1998 (4 6)

FUMBLES Most Fumbles: 51 1952 (2 7) Most Fumbles Lost: 25 1952 (2 7), 1950 (7 2) PENALTIES Most Penalties: 86 1949 (8 1) Most Yards Penalized: 740 1989 (4 6) TURNOVERS Most Turnovers: 43 in 1987 (17 fumbles, 26 interceptions) MISCELLANEOUS CATEGORIES Most Games Played: 12 in 1901 (11-1) Most Victories: 11 in 1901 (11-1) Most Losses: 9 in 2003 (1-9) Most Games Tied: 2 in 1906 (8-1-2), 1927 (3-3-2), 1928 (3-3-2) Undefeated Seasons: 5 — 1915 (9-0), 1921 (8-0), 1922 (8-0), 1923 (8-0), 1939 (8-0) Most Consecutive Victories: 26 (19211924) Most Consecutive Losses: 10 (1975-76); 10 (2004-05) Most Consecutive Games Without Being Shutout: 69 (Sept. 28, 1991-Nov. 22, 1997)

HISTORY

AND

RECORDS

Opponent Team Records Game Records Most Plays: 97 at Brown, 10-21-2000 (40-56) Most Yards Gained: 690 at Brown, 10-21-00 (40-56) Highest Average Gain Per Play: 8.4 at Harvard, 10-12-02, 66 plays, 553 yards (23-52) RUSHING Most Rushes: 69 vs. Colgate, 10-19-96 (21-31) Most Yards Gained: 415 vs. Yale, 9-28-2002 (23-50) Highest Average Gain Per Rush: 7.9 vs. Brown, 10-20-01, 29 rushes, 228 yards (21-49) PASSING Most Passes Attempted: 58 vs. Dartmouth, 11-902 (21-19) Most Passes Completed: 37 vs. Dartmouth, 119-02 (21-19) Most Yards Gained: 443 at Brown, 10-21-00 (40-56) Most Passes Had Intercepted: 6 at Columbia, 1115-80 (24-0); vs. Columbia, 10-29-49 (54-0) Highest Percentage Completed: (min. 15 att.) .794 vs. Penn, 11-18-00 (15-45) Most Touchdown Passes: 5 at Penn, 11-22-03 (7-59) INTERCEPTIONS Most Interceptions: 7 at Princeton, 11-21-87 (623) Most Yards on Interception Returns: 127 at Princeton, 11-21-87 (6-23) PUNT RETURNS Most Punt Returns: 7 at Yale, 9-22-01 (13-40); 7 at Princeton, 11-1-03 (6-28) Most Yards on Punt Returns: 182 vs. Georgetown, 10-18-03 (20-42) KICKOFF RETURNS Most Kickoff Returns: 9 vs. Lafayette, 10-3-92 (44-33) Most Yards on Kickoff Returns: 214 at Yale, 113-90 (41-31) SCORING (modern - since 1937) Most Points Scored: 60 vs. Colgate, 9-24-83 (760) Most Points Scored in One Quarter: 28 at Penn, 11-22-03 (1st) Most Points Scored in One Half: 42 at Brown, 10-21-00(first) Most Touchdowns Scored: 8 at Colgate, 10-1699 (16-55); at Brown, 10-21-00 (40-56); at Penn, 11-22-03 (7-59) Most Extra Points Made by Kicking: 8 at Brown, 10-21-00 (40-56); at Penn, 11-22-03 (7-59) Most Field Goals Made: 5 at Brown, 10-19-85 (0-22)

PUNTING Most Punts: 11 vs. Dartmouth, 11-6-04 (14-7); 11 vs. Harvard, 10-9-93 (27-0) Highest Average Per Punt (min. 5 att.): 49.0 at Princeton, 9-19-98 (0-6) FUMBLES Most Fumbles: 10 vs. Colgate, 9-30-72 (37-7) Most Fumbles Lost: 5,many times; Last: vs. Princeton, 9-22-84 (9-17)

TOTAL DEFENSE Fewest Plays Allowed: 49 vs. Northeastern, 9-3089 (0-20) Fewest Yards Allowed: 88 vs. Brown, 10-31-98 (7-20) Fewest First Downs Allowed: 7 vs. Brown, 1031-98 (7-20) RUSHING DEFENSE Fewest Rushes Allowed: 13 at Brown, 10-21-00 (40-56) Fewest Rushing Yards Allowed: -25 at Brown, 10-22-99 (33-28) PASSING DEFENSE Fewest Attempts Allowed: 7 vs. Columbia, 1112-83 (31-6) Fewest Completions Allowed: 2 vs. Lehigh, 101-94 (21-17) Fewest Passing Yards Allowed: 23 vs. Lehigh, 10-1-94 (21-17) TURNOVERS Most Fumbles Caused: 9 at Michigan, 11-8-52 (7-49); vs. Navy, 10-4-52 (7-31) Most Fumbles Recovered: 6 on three occasions; Last: vs. Navy, 10-4-52 (7-31)

Individual Game RUSHING Attempts: 42 by Dom Fischer, Colgate, 1969 Yards: 282 by Jabu Powell, Bucknell, 2000 PASSING Attempts: 53 by Bill Pienias, Brown, 1992 Completions: 33 by Chad Andrzejewski, Columbia, 1992 Yards: 422 by Eric Webber, Brown, 2000 Completion Percentage: .882 by Dick Kazmaier, Princeton, 1951 Touchdowns: 6 by A.J. “Swede” Oberlander, Dartmouth, 1925 Touchdowns (since 1947): 5 by Mike Mitchell, Penn, 2003 RECEIVING Catches: 14 by Bob Farnham, Brown, 1975; 14 by Scott Wedum, Dartmouth, 2002 Yards: 252 by Karl Hall, Penn, 1981 Touchdowns: 4 by Dan Castles, Penn, 2003 TOTAL OFFENSE Plays: 71 by Brian Mann, Dartmouth, 2002 Yards: 447 by Marty Domres, Columbia, 1968

TOTAL OFFENSE Most Plays: 787 in 1981 Most Yards: 4,785 in 2003 Highest Average Gain per Play: 6.35 in 2000, 754 plays, 4,785 yards RUSHING Most Rushes: 541 in 1976 Most Yards Gained: 2,391 in 2000 Highest Average Gain Per Rush: 5.30 in 2000, 451 rushes, 2,391 yards PASSING Most Passes Attempted: 332 in 1987 Most Passes Completed: 203 in 2002 Most Yards Gained: 2,394 in 2000 Most Passes Had Intercepted: 20 in 1954, 1980, 1994 Highest Percentage Completed: .657 in 2002 Most Touchdown Passes: 22 in 2003 INTERCEPTIONS Most Interceptions: 26 in 1987 Most Yards on Interception Returns: 311 in 1951 (16 INTs) PUNT RETURNS Most Punt Returns: 45 in 1968 Most Yards on Punt Returns: 505 in 1968 (45 returns) KICKOFF RETURNS Most Kickoff Returns: 50 in 1990 Most Yards on Kickoff Returns: 1,002 in 1949 (48returns) SCORING (modern - since 1937) Most Points Scored: 334 in 2000 Most Touchdowns Scored: 44 in 2000 Most Extra Points Made by Kicking: 37 in 2000 Most Field Goals Made: 18 in 1985 Most Field Goals Attempted: 23 in 1985 FIRST DOWNS Most First Downs: 229 in 2000 Most First Downs Rushing: 126 in 1981 Most First Downs Passing: 103 in 1992, 2000 Most First Downs by Penalty: 20 in 1989 PUNTING Most Punts: 74 1986 Most Yards: 2,584 2004 (71 Highest Average Per Punt: 38.8 , 2,015 )

)

1999 (51

FUMBLES Most Fumbles: 41 1972 Most Fumbles Lost: 24 1951 PENALTIES Most Penalties: 84 1997 Most Yards Penalized: 747 )

1997 (84

TURNOVERS Most Turnovers: 43 in 1972 (21 fumbles, 22 interceptions)

SCORING Points: 30 by Eugene Rossides, Columbia, 1945 Touchdowns: 5 by Eugene Rossides, Columbia, 1945 Field Goals: 5 by Chris Ingerslev, Brown, 1985 LONG PLAYS Rushing: 92 by Rabih Abdullah, Lehigh, 1994 Passing: 93 by Gary Vura to Karl Hall, Penn, 1981; 93 by Eddie Chamberlain to Elbert Camp, Dartmouth, 1935 Field Goal: 55 by Jim Robertson, Dartmouth, 1919 Field Goal (since 1947): 54 by Charlie Gogolak, Princeton, 1965 Interception Return: 100 on four occasions; Last: Jim Anderson, Princeton, 1984 Punt Return: 85 by Tom Haggerty, Columbia, 1961; 85 by Greg Hoffmeister, Dartmouth, 1991 Kickoff Return: 100 by Ken Hill, Yale, 1978

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

FIRST DOWNS Most First Downs: 31 at Harvard, 10-12-02 (2352); 31 at Dartmouth, 9-18-99 (17-20); 31 vs. Columbia, 11-5-97 (33-22) Most First Downs Rushing: 22 vs. Dartmouth, 10-26-85 (17-20) Most First Downs Passing: 18 vs. Colgate, 9-2797 (38-44, OT); at Columbia, 11-14-92 (30-35); vs. Brown, 10-31-92 (16-6) Most First Downs by Penalty: 5 vs. Dartmouth, 10-4-97 (20-24)

PENALTIES Most Penalties: 16 vs. Colgate, 9-24-88 (17-14) Most Yards Penalized: 132 vs. Colgate, 9-24-88 (17-14)

Season Records

HISTORY

WWW .CORNELL B IG R ED . COM

Yearly Passing Leaders

Year 1946 1947 1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Name Att. Comp. John Burns ...... 99 .. 48 ... Pete Dorset ..... 77 .. 39 ... Pete Dorset ..... 74 .. 28 ... Pete Dorset ..... 111 . 55 ... Rocco Calvo ..... 94 .. 51 ... Rocco Calvo ..... 77 .. 38 ... John Jaeckel ..... 96 .. 33 ... Bill DeGraaf ..... 85 .. 28 ... Bill DeGraaf ..... 94 .. 31 ... Bill DeGraaf ..... 97 .. 44 ... Art Boland ...... 107 . 43 ... Tom Brogan ..... 50 .. 23 ... Tom Skypeck .... 121 . 55 ... Dave McKelvey .. 67 .. 23 ... Scott Brown ..... 85 .. 34 ... Gary Wood ..... 75 .. 28 ... Gary Wood ..... 117 . 60 ... Gary Wood ..... 119 . 48 ... Marty Sponaugle . 55 .. 23 ... Marty Sponaugle . 115 . 45 ... BillAbel ........ 138 . 64 ... BillRobertson .... 175 . 94 ... BillRobertson .... 197 . 81 ... Rick Furbush ..... 37 .. 23 ... Rick Furbush ..... 104 . 57 ... Mark Allen ...... 90 .. 39 ... Mark Allen ...... 181 . 91 ... Mark Allen ...... 272 . 119 .. Kevin Sigler ..... 248 . 143 .. Garland Burns ... 81 .. 21 ... Jim Hofher ...... 139 . 63 ... Jim Hofher ...... 118 . 60 ... Jim Hofher ...... 85 .. 44 ... Mike Tanner ..... 73 .. 41 ... Mike Ryan ...... 109 . 53 ... Chris Metz ...... 77 .. 33 ... Jeff Hammond ... 176 . 89 ... Shawn Maguire .. 205 . 110 .. Shawn Maguire .. 221 . 119 .. Marty Stallone ... 138 . 76 ... Marty Stallone ... 226 . 110 .. Dave Dase ...... 198 . 100 .. Aaron Sumida ... 141 . 69 ... Chris Cochrane .. 236 . 115 .. Chris Cochrane .. 175 . 107 .. BillLazor ....... 217 . 129 .. BillLazor ....... 328 . 169 .. BillLazor ....... 328 . 172 .. Per Larson ...... 154 . 76 ... Steve Joyce ..... 274 . 156 .. ScottCarroll .... 262 . 125 .. ScottCarroll .... 239 . 131 .. Mike Hood ...... 294 . 173 .. Ricky Rahne ..... 388 . 225 .. Ricky Rahne ..... 479 . 252 .. Ricky Rahne ..... 355 . 199 .. Mick Razzano .... 276 . 137 .. D.J.Busch ....... 227 . 118 .. D.J.Busch ....... 234 . 121 ..

RECORDS

Yearly Rushing Leaders

Int. 8 ... 9 ... 3 ... 5 ... 3 ... 4 ... 8 ... 4 ... 9 ... 7 ... 7 ... 6 ... 4 ... 3 ... 5 ... 3 ... 8 ... 7 ... 3 ... 6 ... 8 ... 8 ... 11 .. 4 ... 9 ... 4 ... 12 .. 11 .. 14 .. 9 ... 12 .. 5 ... 5 ... 5 ... 5 ... 4 ... 11 .. 11 .. 11 .. 8 ... 12 .. 15 .. 4 ... 21 .. 5 ... 9 ... 4 ... 13 .. 6 ... 9 ... 13 .. 11 .. 15 .. 13 .. 13 .. 5 ... 7 ... 8 ... 7 ...

Pct. .485 .506 .378 .495 .543 .494 .344 .329 .330 .454 .402 .460 .455 .343 .400 .373 .513 .403 .418 .391 .464 .537 .411 .621 .548 .433 .503 .438 .577 .259 .453 .508 .518 .562 .486 .429 .506 .537 .538 .551 .487 .505 .489 .487 .611 .595 .515 .524 .494 .569 .477 .548 .588 .580 .526 .561 .496 .520 .517

Yards T D . 593 ... 4 . 568 ... 4 . 437 ... 3 . 845 ... 7 . 730 ... 2 . 675 ... 5 . 453 ... 3 . 351 ... 3 . 433 ... 8 . 629 ... 6 . 572 ... 3 . 387 ... 1 . 784 ... 5 . 245 ... 3 . 519 ... 2 . 456 ... 6 . 890 ... 8 . 545 ... 4 . 319 ... 1 . 582 ... 5 . 953 ... 6 . 1,347 .. 12 . 1,156 .. 3 . 294 ... 0 . 876 ... 6 . 496 ... 3 . 1,235 .. 9 . 1,590 .. 10 . 1,648 .. 8 . 285 ... 2 . 740 ... 3 . 745 ... 6 . 487 ... 1 . 595 ... 4 . 786 ... 4 . 507 ... 1 . 1,064 .. 5 . 1,009 .. 2 . 1,112 .. 1 . 817 ... 9 . 1,446 .. 12 . 1,302 .. 9 . 1,132 .. 10 . 1,322 .. 5 . 1,266 .. 5 . 1,461 .. 8 . 2,206 .. 15 . 2,030 .. 11 . 1,092 .. 6 . 2,255 .. 13 . 1,583 .. 9 . 1,378 .. 10 . 1,910 .. 11 . 2,762 .. 25 . 2,944 .. 18 . 1,984 .. 11 . 1,556 .. 7 . 1,320 .. 7 . 1,534 .. 5

SEASON PASSING LEADER PROGRESSION Year Name Att. Comp. Int. 1946 John Burns ...... 99 .. 48 ... 8 ... 1949 Pete Dorset ..... 111 . 55 ... 5 ... 1962 Gary Wood ..... 117 . 60 ... 8 ... 1966 BillAbel ........ 138 . 64 ... 8 ... 1967 BillRobertson .... 175 . 94 ... 8 ... 1973 Mark Allen ...... 272 . 119 .. 11 .. 1974 Kevin Sigler ..... 248 . 143 .. 14 .. 1992 BillLazor ....... 328 . 169 .. 4 ... 1995 Steve Joyce ..... 274 . 156 .. 9 ... 1999 Ricky Rahne ..... 388 . 225 .. 13 .. 2000 Ricky Rahne ..... 479 . 252 .. 13 ..

Pct. .485 .495 .513 .464 .537 .438 .577 .515 .569 .580 .526

Yards T D . 593 ... 4 . 845 ... 7 . 890 ... 8 . 953 ... 6 . 1,347 .. 12 . 1,590 .. 10 . 1,648 .. 8 . 2,206 .. 15 . 2,255 .. 13 . 2,762 .. 25 . 2,944 .. 18

2005 FOOTBALL

AND

Name Att. Yards Walt Kretz .......... 88 ... 594 Norm Dawson ....... 66 ... 293 Frank Miller ......... 98 ... 598 Jeff Fleischmann ..... 106 ... 579 Jeff Fleischmann ..... 146 ... 538 Stu Merz ........... 77 ... 431 Bob Engel ......... 106 ... 364 Guy Bedrossian ..... 111 ... 336 Dick Jackson ......... 76 ... 445 Irv Roberson ......... 83 ... 503 Irv Roberson ........ 106 ... 480 Bob McAniff ........ 140 ... 700 Terry Wilson ........ 121 ... 521 Dan Bidwell ........ 109 ... 474 Pat Pennucci ........ 77 ... 285 Gary Wood ......... 94 ... 449 Gary Wood ........ 173 ... 889 Gary Wood ........ 166 ... 818 BillWilson ......... 189 ... 659 BillWilson ......... 181 ... 848 Pete Larson ........ 206 ... 979 BillHuling .......... 88 ... 369 ChrisRitter ......... 87 ... 341 Ed Marinaro ........ 277 .. 1,409 Ed Marinaro ........ 285 .. 1,425 Ed Marinaro ........ 356 .. 1,881 Dan Malone ........ 196 ... 913 Don Fanelli ......... 99 ... 403 Dan Malone ........ 139 ... 532 Tim LaBeau ........ 106 ... 482 Neal Hall ........... 91 ... 330 Craig Jaeger ....... 103 ... 440 Joe Holland ........ 273 .. 1,396 Tom Weidenkopf .... 118 ... 571 Steve Vago ........ 114 ... 513 Derrick Harmon ..... 173 ... 893 Derrick Harmon ..... 157 ... 905 Derrick Harmon ..... 216 .. 1,276 Tony Baker ......... 165 ... 847 JohnTagliaferri ..... 153 ... 583 JeffJohnson ........ 191 ... 902 Scott Malaga ....... 168 ... 647 Scott Malaga ....... 256 .. 1,097 John McNiff ........ 160 ... 753 John McNiff ........ 176 ... 998 John McNiff ........ 203 ... 806 Scott Oliaro ........ 181 ... 834 PeteFitzpatrick ..... 179 ... 789 Chad Levitt ........ 275 .. 1,319 Chad Levitt ........ 292 .. 1,428 Chad Levitt ........ 267 .. 1,435 Brad Kiesendahl ..... 102 ... 513 Deon Harris ........ 221 ... 757 Deon Harris ........ 149 ... 605 Evan Simmons ...... 145 ... 649 Evan SImmons ...... 123 ... 598 Marcus Blanks ...... 129 ... 598 Joshua Johnston ..... 103 ... 446 Joshua Johnston ..... 156 ... 475

Avg. .... 6.8 .... 4.4 .... 6.1 .... 5.5 .... 3.7 .... 5.6 .... 3.4 .... 3.1 .... 5.9 .... 6.1 .... 4.5 .... 5.0 .... 4.3 .... 4.3 .... 3.7 .... 4.8 .... 5.1 .... 4.9 .... 3.5 .... 4.7 .... 4.8 .... 4.2 .... 3.9 .... 5.1 .... 5.0 .... 5.3 .... 4.7 .... 4.1 .... 3.8 .... 4.5 .... 3.6 .... 4.3 .... 5.1 .... 4.8 .... 4.5 .... 5.2 .... 5.8 .... 5.9 .... 5.1 .... 3.8 .... 4.7 .... 3.9 .... 4.3 .... 4.7 .... 5.7 .... 4.0 .... 4.6 .... 4.4 .... 4.8 .... 4.9 .... 5.4 .... 5.0 .... 3.4 .... 4.1 .... 4.2 .... 4.9 .... 4.4 .... 4.3 .... 3.0

TD .... 5 .... 4 .... 4 ... 10 .... 9 .... 4 .... 0 .... 6 .... 6 .... 4 .... 4 .... 4 .... 5 .... 1 .... 0 .... 3 .... 9 .... 7 .... 5 .... 6 .... 9 .... 3 .... 2 ... 14 ... 12 ... 24 .... 5 .... 5 .... 2 .... 6 .... 2 .... 3 ... 16 .... 6 .... 1 .... 5 .... 9 ... 12 .... 7 .... 7 .... 4 .... 2 ... 12 .... 4 ... 10 .... 8 ... 11 .... 5 ... 12 ... 13 ... 13 ... 10 .... 5 .... 2 .... 7 .... 9 .... 5 .... 4 .... 3

SEASON RUSHING LEADER PROGRESSION Year Name Att. Yards 1946 Walt Kretz .......... 88 ... 594 1948 Frank Miller ......... 98 ... 598 1957 Bob McAniff ........ 140 ... 700 1962 Gary Wood ........ 173 ... 889 1966 Pete Larson ........ 206 ... 979 1969 Ed Marinaro ........ 277 .. 1,409 1970 Ed Marinaro ........ 285 .. 1,425 1971 Ed Marinaro ........ 356 .. 1,881

Avg. .... 6.8 .... 6.1 .... 5.0 .... 5.1 .... 4.8 .... 5.1 .... 5.0 .... 5.3

TD .... 5 .... 4 .... 4 .... 9 .... 9 ... 14 ... 12 ... 24

HISTORY

AND

RECORDS

Yearly Receiving Leaders

Yearly Scoring Leaders

Year 1946 1947 1948

Year 1946 1947

TD .... 2 .... 3 .... 1 .... 1 .... 5 .... 2 .... 1 .... 1 .... 5 .... 2 .... 2 .... 1 .... 1 .... 2 .... 0 .... 1 .... 1 .... 0 .... 3 .... 2 .... 2 .... 1 .... 0 .... 2 .... 4 .... 9 .... 3 .... 1 .... 0 .... 2 .... 3 .... 3 .... 2 .... 0 .... 3 .... 1 .... 0 .... 1 .... 2 .... 0 .... 2 .... 0 .... 0 .... 0 .... 1 .... 0 .... 2 .... 5 .... 0 .... 2 .... 1 .... 6 .... 0 .... 4 .... 3 .... 4 .... 11 .... 6 .... 10 .... 3 .... 2 .... 2 .... 3 .... 3

Yards .... 305 .... 301 .... 106 ..... 89 .... 289 .... 420 .... 351 .... 291 .... 372 .... 226 .... 196 .... 145 .... 116 .... 206 .... 180 .... 301 .... 116 .... 222 .... 159 .... 260 .... 162 .... 191 .... 188 .... 248 .... 559 .... 853 .... 507 .... 113 .... 300 .... 274 .... 564 .... 483 .... 619 .... 185 .... 383 .... 423 .... 200 .... 381 .... 199 .... 182 .... 285 .... 287 .... 270 .... 266 .... 358 .... 246 .... 518 .... 533 .... 230 .... 347 .... 486 .... 794 .... 328 .... 565 .... 695 .... 720 .. 1,042 .... 677 .... 944 .... 630 .... 507 .... 852 .... 582 .... 766

SEASON RECEIVING LEADER PROGRESSION Year Name Rec. Avg. 1946 HillaryChollet ....... 12 .... 25.4 1950 Vic Pujo ............ 24 .... 17.5 1966 Ron Gervase ......... 36 .... 15.5 1967 Bill Murphy ......... 50 .... 17.1 1997 Eric Krawczyk ........ 89 .... 11.7

TD .... 2 .... 2 .... 4 .... 9 .... 11

Yards .... 305 .... 420 .... 559 .... 853 .. 1,042

1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Name TD PAT HillaryChollet ........ 6 ....... 0 Norman Dawson ...... 5 ....... 0 Robert Dean ......... 3 ...... 12 Jeff Fleischmann ....... 9 ....... 0 Jeff Fleischmann ...... 10 ....... 0 Jeff Fleischmann ....... 9 ....... 0 Hal Seidenberg ...... 10 ....... 0 Dick Cliggott ......... 5 ....... 0 Guy Bedrosian ........ 6 ....... 0 Dick Jackson .......... 8 ....... 0 Bill DeGraaf .......... 6 ...... 13 Bo Roberson .......... 4 ....... 0 Tom Skypeck ......... 5 ....... 5 Tom Skypeck ......... 7 ....... 9 PhilipTaylor .......... 4 ....... 0 Marcello Tino ......... 4 ....... 0 George Eckstrom ...... 3 ....... 0 George Telesh ........ 5 ....... 0 Gary Wood .......... 9 ....... 0 Gary Wood .......... 7 ....... 0 BillWilson ........... 7 ....... 0 Martin Sponaugle ..... 6 ....... 1 Pete Larson ......... 11 ....... 1 Bill Murphy .......... 9 ....... 0 ChrisRitter .......... 5 ....... 1 Ed Marinaro ......... 14 ....... 0 Ed Marinaro ......... 14 ....... 1 Ed Marinaro ......... 24 ....... 2 Mark Allen ........... 7 ....... 0 Don Fanelli .......... 5 ....... 0 Don Fanelli ......... 10 ....... 0 Tim LaBeau .......... 7 ....... 1 Thomas Dugdale ...... 0 ...... 11 Craig Jaeger ......... 4 ....... 0 Joe Holland ......... 16 ....... 0 Tom Weidenkopf ...... 6 ....... 0 Ron Rejda ........... 0 ...... 19 Derrick Harmon ....... 7 ....... 1 Derrick Harmon ....... 9 ....... 1 Derrick Harmon ...... 12 ....... 1 Tony Baker ........... 8 ....... 0 JohnTagliaferri ....... 8 ....... 0 Tom Aug ............ 0 ...... 19 Dave Quarles ......... 0 ...... 14 Scott Malaga ........ 12 ....... 0 Todd Nicholson ....... 7 ....... 0 Scott Oliaro ......... 11 ....... 0 John McNiff .......... 9 ....... 0 Scott Oliaro ......... 11 ....... 0 PeteFitzpatrick ....... 6 ....... 1 Chad Levitt ......... 13 ....... 0 Chad Levitt ......... 15 ....... 1 Chad Levitt ......... 14 ....... 1 Eric Krawczyk ........ 11 ....... 0 John McCombs ....... 0 ...... 18 Joe Splendorio ....... 10 ....... 0 Justin Dunleavy ....... 8 ....... 0 Evan SImmons ........ 9 ....... 1 Nathan Archer ........ 7 ....... 0 Joshua Johnston ....... 4 ....... 0 Andre Hardaway ...... 5 ....... 0

FG .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 3 .... 0 .... 0 .... 0 .... 8 .... 0 .... 0 .... 0 .... 0 .... 0 .... 9 .... 12 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 7 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0

Points ..... 36 ..... 30 ..... 30 ..... 54 ..... 60 ..... 54 ..... 60 ..... 30 ..... 36 ..... 48 ..... 49 ..... 24 ..... 35 ..... 51 ..... 24 ..... 24 ..... 18 ..... 30 ..... 54 ..... 42 ..... 42 ..... 38 ..... 68 ..... 54 ..... 32 ..... 84 ..... 86 .... 148 ..... 42 ..... 30 ..... 60 ..... 44 ..... 20 ..... 24 ..... 96 ..... 36 ..... 43 ..... 44 ..... 56 ..... 74 ..... 48 ..... 48 ..... 46 ..... 50 ..... 72 ..... 42 ..... 66 ..... 54 ..... 66 ..... 38 ..... 78 ..... 92 ..... 84 ..... 66 ..... 39 ..... 60 ..... 48 ..... 56 ..... 42 ..... 24 ..... 30

SEASON SCORING LEADER PROGRESSION Year Name TD PAT 1946 HillaryChollet ........ 6 ....... 0 1948 Jeff Fleischmann ....... 9 ....... 0 1949 Jeff Fleischmann ...... 10 ....... 0 1951 Hal Seidenberg ...... 10 ....... 0 1966 Pete Larson ......... 11 ....... 1 1969 Ed Marinaro ......... 14 ....... 0 1970 Ed Marinaro ......... 14 ....... 1 1971 Ed Marinaro ......... 24 ....... 2

FG .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0 .... 0

Points ..... 36 ..... 54 ..... 60 ..... 60 ..... 68 ..... 84 ..... 86 .... 148

1948 1949 1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Name Rec. Avg. HillaryChollet ....... 12 .... 25.4 Bernie Babula ....... 12 .... 25.1 HillaryChollet ........ 8 .... 13.3 Harry Cassel .......... 8 .... 11.1 Walt Bruska ......... 14 .... 20.6 Vic Pujo ............ 24 .... 17.5 Harvey Sampson ..... 24 .... 14.6 Dick Cliggott ........ 14 .... 20.8 Dick Cliggott ........ 25 .... 14.9 Bruce Brenner ....... 14 .... 16.1 Dick Jackson ......... 17 .... 11.5 StanIntihar ......... 12 .... 12.1 Dick Jackson ......... 12 ..... 9.7 Bob McAniff ......... 15 .... 13.7 John Webster ........ 12 .... 15.0 Norm Juvonen ....... 16 .... 18.8 John Sadusky ......... 8 .... 14.5 Pat Pennucci ........ 16 .... 13.9 Ken Hoffman ........ 10 .... 15.9 Ed Burnap .......... 17 .... 15.3 BillPonzer .......... 13 .... 12.5 Pete Larson ......... 13 .... 14.7 Bob Baker .......... 13 .... 14.5 Ron Gervase ......... 19 .... 13.1 Ron Gervase ......... 36 .... 15.5 Bill Murphy ......... 50 .... 17.1 ChrisRitter ......... 30 .... 16.9 Erv Bratcher .......... 8 .... 14.1 Tom Albright ........ 21 .... 14.3 Tom Albright ........ 21 .... 13.0 George Milosevic ..... 37 .... 15.2 Bruce Starks ......... 31 .... 15.6 Bruce Starks ......... 47 .... 13.2 Bruce Starks ......... 14 .... 13.2 Eamon McEneaney .... 35 .... 10.9 Dave Rupert ......... 26 .... 16.3 Brad Decker ......... 17 .... 11.8 Mark Turley ......... 26 .... 14.7 Alva Taylor .......... 13 .... 15.3 Dan Suren .......... 13 .... 14.0 Derrick Harmon ...... 21 .... 13.6 Dan Suren .......... 26 .... 11.0 Derrick Harmon ...... 36 ..... 7.5 JohnTagliaferri ...... 30 ..... 8.9 JohnTagliaferri ...... 61 ..... 5.9 JeffJohnson ......... 29 ..... 8.4 Sam Brickley ........ 56 ..... 9.3 Sam Brickley ........ 29 .... 18.4 Scott Oliaro ......... 30 ..... 7.7 Scott Oliaro ......... 25 .... 13.9 Mike Jamin ......... 35 .... 13.9 Mike Jamin ......... 49 .... 16.2 Ned Burke .......... 40 ..... 8.2 Aaron Berryman ...... 36 .... 15.7 Ron Mateo .......... 47 .... 14.8 Steve Busch ......... 57 .... 12.6 Eric Krawczyk ........ 89 .... 11.7 Joe Splendorio ....... 46 .... 14.7 Joe Splendorio ....... 65 .... 14.5 Joe Splendorio ....... 46 .... 13.7 Keith Ferguson ....... 50 .... 10.1 Keith Ferguson ....... 70 .... 12.2 John Kellner ......... 49 .... 11.9 Brian Romney ........ 60 .... 12.8

HISTORY

WWW .CORNELL B IG R ED . COM

Single-Game Highs

MOST YARDS RUSHING (150 Yards or More) 288, Scott Oliaro at Yale, 1990 281, Ed Marinaro vs. Harvard, 1969 272, Ed Marinaro vs. Columbia, 1971 263, Joe Holland vs. Penn, 1978 260, Ed Marinaro vs. Lehigh, 1970 260, Ed Marinaro vs. Colgate, 1971 247, Tom Weidenkopf at Dartmouth, 1979 246, Ed Marinaro at Rutgers, 1971 245, Ed Marinaro at Rutgers, 1969 244, Joe Holland at Harvard, 1978 241, Chad Levitt vs. Dartmouth, 1996 230, Ed Marinaro at Penn, 1971 230, Ed Marinaro at Yale, 1971 227, Chad Levitt at Harvard, 1994 225, Ed Marinaro at Brown, 1970 222, Derrick Harmon vs. Columbia, 1983 218, Chad Levitt at Yale, 1996 210, Derrick Harmon vs. Yale, 1983 209, Chad Levitt vs. Colgate, 1996 207, Gary Wood at Penn, 1962 190, Ed Marinaro vs. Penn, 1970 189, Joe Holland at Columbia, 1978 189, Derrick Harmon at Princeton, 1983 189, John McNiff at Harvard, 1990 188, Chad Levitt vs. Yale, 1995 187, Chad Levitt at Buffalo, 1996 186, Joe Holland vs. Princeton, 1978 185, Pete Larson at Buffalo, 1966 185, Derrick Harmon at Columbia, 1982 185, Jeff Johnson at Columbia, 1986 181, Bill Wilson at Brown, 1965 181, Ed Marinaro at Penn, 1969 181, John McNiff vs. Columbia, 1991 180, Don Fanelli at Colgate, 1973 180, Rich Russo vs. Columbia, 1973 179, Derrick Harmon vs. Penn, 1982 178, Stu Merz vs. Syracuse, 1951 178, Dan Malone at Columbia, 1974 178, Derrick Harmon vs. Columbia, 1981 178, Chad Levitt vs. Princeton, 1996 176, Ed Marinaro vs. Brown, 1971 173, Brad Kiesendahl vs. Lafayette, 1997 172, Chad Levitt vs. Dartmouth, 1994 170, Chad Levitt at Dartmouth, 1995 170, Chad Levitt vs. Columbia, 1995 170, Evan Simmons vs. Columbia, 2001 169, Gary Wood at Brown, 1962 168, Gary Wood at Yale, 1963 167, Craig Jaeger vs. Harvard, 1977 167,JeffJohnsonvs.Princeton,1986 165, Chad Levitt vs. Holy Cross, 1995 164, Joe Holland vs. Brown, 1978 162, Ed Marinaro vs. Colgate, 1969 162, Dan Malone vs. Rutgers, 1972 161, Gary Wood vs. Dartmouth, 1962 160, John McNiff at Columbia, 1990 160, Chad Levitt vs. Brown, 1996 159, Brian Ulbricht vs. Towson, 2002 157, Tony Baker at Yale, 1984 157, Chad Levitt vs. Penn, 1994 156,JeffFleischmann atSyracuse,1950 156, Bill Scazarro at Columbia, 1950 155, Bill Wilson vs. Columbia, 1965 155, Ed Marinaro vs. Princeton, 1969 152, Neal Hall vs. Colgate, 1975 152, Derrick Harmon at Penn, 1981 151, Bob McAniff vs. Columbia, 1957 151, Ed Marinaro at Colgate, 1970 150, Ed Marinaro vs. Columbia, 1969

2005 FOOTBALL

MOST YARDS PASSING (225 Yards or More) 446, Ricky Rahne at Brown, 2000 443, Ricky Rahne at Brown, 1999 400, Bill Lazor at Columbia, 1992 395, Mark Allen at Penn, 1973 391, Ricky Rahne at Harvard, 2000 344,ScottCarrollatBuffalo,1996 341, Steve Joyce at Brown, 1995 321, Bill Lazor at Brown, 1991 320, Ricky Rahne vs. Columbia, 1999 317,BillLazorvs.Yale,1991 314, Ricky Rahne at Bucknell, 2000 314, Ricky Rahne vs. Harvard, 2001 312, D.J Busch vs. Columbia, 2003 307, Chris Cochrane at Yale, 1989 307, Ricky Rahne at Princeton, 1999 306, Ricky Rahne vs. Penn, 2000 302, Mick Razzano vs. Dartmouth, 2002 297, Ricky Rahne vs. Harvard, 1999 296, Mike Hood vs. Bucknell, 1998 296, Ricky Rahne at Penn, 1999 285, D.J. Busch at Harvard, 2004 283, Bill Lazor vs. Columbia, 1993 279,RickyRahne,vs.Princeton,2000 277, Bill Robertson at Columbia, 1968 276, Ricky Rahne at Dartmouth, 1999 273, Mike Hood vs. Penn, 1998 272,ScottCarrollvs.Colgate,1997 272, D.J. Busch vs. Georgetown, 2003 271, Ricky Rahne at Pennsylvania, 2001 267, Mike Hood at Princeton, 1998 267, Marty Stallone at Princeton, 1985 265,BillLazorvs.Colgate,1993 263, Steve Joyce vs. Holy Cross, 1995 263, Ricky Rahne vs. Dartmouth, 2000 263, Ricky Rahne at Colgate, 2001 262,BillLazoratPrinceton,1993 262,BillLazorvs.Lehigh,1992 261, Steve Joyce at Lehigh, 1995 259, Dave Dase vs. Columbia, 1987 258, Bill Lazor at Dartmouth, 1991 258, Ricky Rahne at Columbia, 2000 254, Bill Robertson at Dartmouth, 1967 254, Ricky Rahne vs. Yale, 1999 253, Mark Allen vs. Princeton, 1973 252, Mark Allen vs. Penn, 1972 252, Dave Dase at Yale, 1987 252, Per Larson at Columbia, 1994 250, Mike Hood vs. Buffalo, 1998 251, Steve Joyce at Dartmouth, 1995 248,BillLazoratYale,1992 248, Dave Dase at Brown, 1987 247,ScottCarrollatLafayette,1996 244,ScottCarrollvs.Penn,1996 242, Mark Allen vs. Dartmouth, 1972 242, Mick Razzano at Brown, 2002 241,BillLazorvs.Penn,1992 240, Rocco Calvo at Yale, 1951 240,BillLazoratLehigh,1993 240, Steve Joyce at Princeton, 1995 240, Steve Joyce vs. Harvard, 1995 239, Ricky Rahne at Lehigh, 2000 237, Per Larson at Yale, 1994 236, Kevin Sigler vs. Colgate, 1974 236, Marty Stallone at Bucknell, 1985 236, Steve Joyce at Penn, 1995 236, Ricky Rahne vs. Colgate, 2000 236, D.J. Busch vs. Brown, 2003 234, D.J. Busch at Towson, 2004 233, Mike Hood at Columbia, 1998 232, Ricky Rahne vs. Fordham, 1999 231, Aaron Sumida at Columbia, 1988 231, Per Larson at Bucknell, 1994 227,BillLazorvs.Brown,1992 226, Kevin Sigler at Brown, 1974 226, Ricky Rahne vs Brown, 2001

AND

RECORDS

MOST RECEIVING YARDS (100 Yards or More) 204, Joe Splendorio at Brown, 1999 177, Keith Ferguson at Brown, 2002 175, Keith Ferguson vs. Dartmouth, 2002 171, Eric Krawczyk vs. Colgate, 1997 164, Mike Jamin vs. Brown, 1992 164, Keith Ferguson vs. Princeton, 2000 163, Bill Murphy vs. Harvard, 1967 161, Mike Jamin vs. Yale, 1991 155, Aaron Berryman at Columbia, 1994 155, Stu Merz at Yale, 1951 154, Keith Ferguson at Harvard, 2002 150, Chris Ritter at Columbia, 1968 148, Eric Krawczyk at Lafayette, 1996 146, Eric Krawczyk at Dartmouth, 1997 144, Steve Busch vs. Princeton, 1996 144, Steve Busch at Buffalo, 1996 142, Chad Nice vs. Princeton, 2004 141, Eric Krawczyk at Fordham, 1997 140, Jack Corrigan vs. Harvard, 1973 139, Scott Oliaro vs. Penn, 1992 139, Keith Ferguson at Brown, 2000 138, George Milosevic vs. Dartmouth, 1972 137, Ron Mateo at Lehigh, 1995 135, Bruce Starks at Harvard, 1974 131, Mike Jamin at Brown, 1991 130,BruceStarksvs.Princeton,1973 130, Joe Splendorio at Dartmouth, 1999 129, Eric Krawczyk at Penn, 1997 127, Bill Murphy at Penn, 1967 126, Joe Splendorio vs. Penn, 1998 126, Joe Splendorio vs. Columbia, 1999 124, Derrick Harmon vs. Bucknell, 1981 124, Chris Hahn vs. Harvard, 1987 123, George Milosevic vs. Penn, 1972 123, Eric Krawczyk vs. Penn, 1996 122, Chad Nice at Harvard, 2004 120, Ron Mateo vs. Harvard, 1995 120, Joe Splendorio at Penn, 1999 119, Chris Ritter at Brown, 1968 118,StuFullertonvs.Princeton,1965 118, Mike Jamin at Harvard, 1992 118, Vic Yanz vs. Brown, 2003 117, Shaun Hawkins vs. Columbia, 1987 117, Eric Krawczyk atBuffalo, 1996 116, Rick Furbush at Princeton, 1968 116,JimPerrelloatPrinceton,1985 116 John Kellner at Colgate, 2001 115, Brian Romney vs. Penn, 2004 114, Eamon McEneaney at Rutgers, 1976 114, Brian Romney vs. Princeton, 2004 113, Ed Burnap vs. Princeton, 1962 113, Erv Bratcher at Colgate, 1970 113, Shaun Hawkins vs. Harvard, 1987 113,JoeSplendoriovs.Bucknell,1998 112, Eamon McEneaney vs.Colgate, 1976 112, Eric Krawczyk vs. Yale, 1997 111, Bruce Starks at Penn, 1973 111, Pat Dutton vs. Colgate, 1997 110, Ned Burke vs. Colgate, 1993 110, Eric Krawczyk at Columbia, 1996 109, Mike Ready at Yale, 1987 109, Steve Busch at Brown, 1995 109, Ron Mateo at Brown, 1995 108, Rick Furbush vs. Dartmouth, 1968 108, Shaun Hawkins at Colgate, 1986 108, Mike Jamin at Columbia, 1992 108, Keith Ferguson vs. Harvard, 2001 106,BillMurphyvs.Princeton,1967 106, Keith Ferguson vs. Brown, 2001 106, Vic Yanz vs. Columbia, 2003 105, Tim Hermann vs. Penn, 2000 103, Steve Busch vs. Holy Cross, 1995 103, Eric Krawczyk vs. Columbia, 1997 102, Joe Splendorio at Brown, 2000 101, Craig Jaeger vs. Colgate, 1977 101,JoeSplendorio vs.Princeton,1999 101, Joe Splendorio vs. Yale, 2000

HISTORY

AND

RECORDS

The Last Time It Happened Rushing Rushed for 300+ yards ............. Never done Rushed for 200+ yards ............. ChadLevitt 218 yards on 39 carries, at Yale (Nov. 9, 1996) Rushed for 100+ yards ......... Andre Hardaway 130 yards on 28 carries at Harvard (Oct. 9, 2004) Rushed for 5 TDs ................. Ed Marinaro at Penn (Nov. 20, 1971) Rushed for 4 TDs .............. Derrick Harmon vs. Columbia (Nov. 12, 1983) Rushed for 3 TDs ............... Evan Simmons at Dartmouth (Nov. 3, 2001) Rushed 40+ times ................. ChadLevitt 40 times, vs. Princeton (Sept. 21, 1996) Rushed 30+ times .............. JoshuaJohnston 30 times, vs. Dartmouth (Nov. 6, 2004) Two players rushed for 100 yards ............. ChadLevitt(188yds)andTerrySmith(148yds)vs.Yale(11-4-1995)

Passing Passed for 400+ yards ............. Ricky Rahne 446 yards on 29-of-62 passing, at Brown (Oct. 21, 2000) Passed for 300+ yards .............. D.J.Busch 312yardson25-of-40passing,vs.Columbia(Nov.15,2003) Passed for 200+ yards .............. Ryan Kuhn 208yardson13-of-27passingvs.Princeton(Oct.30,2004) Threw 5+ touchdown passes ........ Never done Threw 4 touchdown passes ......... Ricky Rahne 4, at Harvard (Oct. 7, 2000) Threw 3 touchdown passes ........ Mick Razzano 3, at Harvard (Oct. 12, 2002) Attempted 60+ passes ............. Ricky Rahne 60, vs. Penn (Nov. 18, 2000) Attempted 50+ passes ............. Ricky Rahne 50 attempts, at Penn (Nov. 17, 2001) Attempted 40+ passes .............. D.J.Busch 42 attempts, at Towson (Oct. 2, 2004) Attempted 30+ passes .............. D.J.Busch 38 attempts at Harvard (Oct. 9, 2004) Completed 30+ passes ............. Ricky Rahne 31, vs. Harvard (Oct. 13, 2001) Completed 20+ passes .............. D.J.Busch 21 completions, at Towson (Oct. 2, 2004) Threw 6 interceptions ........... MartyStallone 6 interceptions, at Princeton (Nov. 23, 1985) Threw 5 interceptions ............. Dave Dase 5 interceptions, at Princeton (Nov. 21, 1987) Threw 4 interceptions .............. Mike Hood 4 interceptions, vs. Dartmouth (Oct. 24, 1998) Threw 3 interceptions .............. D.J.Busch 3 interceptions, at Penn (Nov. 22, 2003)

Receiving

Kicking Kicked 4 field goals ........... Trevor MacMeekin vs.Yale (Sept.25,2004) Kicked 3 field goals ............... PeterIverson vs.Colgate (Oct.14,2000)

Total Offense Gained 300+ total yards ........... Mick Razzano 340yards(302pass,38rush),vs.Dartmouth(Nov.9,2002) Gained 400+ total yards ............ Ricky Rahne 440 yards(446 pass, -6 rush),at Brown (Oct.21,2000) Ran 70+ plays .................... Ricky Rahne 70 plays (60 pass,10 rush),vs. Penn (Nov.18,2000) Ran 60+ plays .................... Ricky Rahne 70 plays (60 pass,10 rush),vs. Penn (Nov.18,2000) Ran 50+ plays ..................... D.J.Busch 58 plays (48 pass,10 rush),vs. Brown (Oct.25,2003) Ran 40+ plays ..................... D.J.Busch 44 plays (38 pass,6 rush),at Harvard (Oct. 9, 2004)

Defense Intercepted 3 passes ............. Doug Knopp vs. Holy Cross (Sept. 23, 1995) Intercepted 2 passes ............. Sean Nassoiy at Columbia (Nov. 13, 2004) Had 20+ tackles ................ NeilMorrissey 24 (7-17) vs. Colgate (Oct. 4, 2003) Had 15+ tackles ................. Joel Sussman 15 (6-9) at Towson (Oct. 2, 2004) Had 10+ tackles ................... Kevin Rex 14 (6-8) at Columbia (Nov. 13, 2004) Had 2+ sacks .......... Ryan Lempa, Patrick Potts 2 vs. Dartmouth (Nov. 6, 2004) Had 3+ tackles for loss Mike McGinty, Jonathan Lucas 4for13yardsand3for12yardsvs.Princeton(Oct.30,2004)

Miscellaneous 100-yard rusher/100-yard receiver, same game A.Hardaway (130)/C.Nice (122)at Harv.(Oct.9,2004) Fumble Return For Touchdown ........ Nate Tarsi 50 yards, vs. Dartmouth (Nov. 6, 2004) Interception Return For Touchdown .. Kevin Rooney 22 yards, vs. Columbia (Nov. 10, 2001) Punt Return For Touchdown ........ VincentBates 73 yards, vs. Harvard (Oct. 9, 1999)

Team Scored 100+ points 110vs.CaseWestern(Oct. 15,1921) Scored 90+ points . 91 vs. Susquehanna (Nov. 8, 1924) Scored 80+ points 80vs.Susquehanna(Sept. 27,1925) Scored 70+ points ... 74 vs. Alfred (Sept. 26, 1936) Scored 60+ points ... 74 vs. Alfred (Sept. 26, 1936) Scored 50+ points ..... 52 at Penn (Sept. 22, 1979) Scored 40+ points . 49 vs. Dartmouth (Nov. 4, 2000) Scored 30+ points .. 32 at Columbia (Nov. 13, 2004) Back-to-back 40+ point games ............... vs. Lafayette (41), at Fordham (45) 1997 Rushed for 500+ yards ............ Never done Rushed for 400+ yards ............... at Penn 414 yards (Sept. 22, 1979) Rushed for 300+ yards ............... vs.Yale 356 yards (Nov. 4, 1995) Rushed for 200+ yards ............. vs. Towson 254 yards (Oct. 5, 2002) Passed for 500+ yards ............ Never done Passed for 400+ yards .............. at Brown 443 yards (Oct. 2, 1999) Passed for 300+ yards ............ vs.Princeton 320 yards (Oct. 30, 2004) Passed for 200+ yards ............... vs. Penn 232 yards (Nov. 20, 2004) Had 700+ yards in Total Offense .... Never done

Blocked Punt ..................... Nate Tarsi at Towson (Oct. 2, 2004) Blocked Field Goal ..... Nate Tarsi and Dan Collins 1 each vs. Penn (Nov. 20, 2004) Blocked Extra Point ............... MattPollock vs. Princeton (Oct. 30, 2004) Blocked Punt Return For Touchdown .. JohnKellner 39 yards, vs. Lehigh (Oct. 6, 2001) Blocked Field Goal Returned For Touchdown .... Kyle Thomas, 48 yards, vs. Yale (Sept. 28, 2002) Kickoff Return For Touchdown ........ JustinBush 87 yards, at Harvard (Oct. 10, 1998)

Long Plays Run of 90+ yards ................. John McNiff 95 yards, at Columbia (Nov. 10, 1990) Run of 80+ yards ................. ChadLevitt 88 yards, vs. Colgate (Oct. 19, 1996) Run of 70+ yards ................. ChadLevitt 72 yards, vs. Dartmouth (Oct. 26, 1996) Run of 60+ yards ................. ChadLevitt 72 yards, vs. Dartmouth (Oct. 26, 1996) Run of 50+ yards .............. JoshuaJohnston 59 yards, vs. Colgate (Oct. 4, 2003) Run of 40+ yards ................. JohnKellner 43 yards, at Dartmouth (Nov. 8, 2003) Pass of 90+ yards ........ Rocco Calvo to Stu Merz 90 yards, at Yale (Oct. 20, 1951) Pass of 80+ yards ...... Steve Joyce to Steve Busch 88 yards, at Brown (Oct. 28, 1995) Pass of 70+ yards ........ D.J. Busch to Chad Nice 79 yards, vs. Princeton (Oct. 30, 2004) Pass of 60+ yards ........ D.J. Busch to Chad Nice 79 yards, vs. Princeton (Oct. 30, 2004) Pass of 50+ yards .... D.J. Busch to Anthony Jackson 50 yards, vs. Penn (Nov. 20, 2004) Pass of 40+ yards .... D.J. Busch to Anthony Jackson 50 yards, vs. Penn (Nov. 20, 2004) Kicked 50+-yard field goal ........... John Rodin 50 yards,vs.Harvard (Oct. 7,1995) Kicked 40+-yard field goal ........ A.J. Weitsman 40 yards,at Brown (Oct. 23,2004) Kicked 80+ yard punt .......... Mike Baumgartel 81 yards, vs. Harvard (Oct. 13,2001) Kicked 70+ yard punt .......... Mike Baumgartel 77 yards, vs. Yale (Sept. 28,2002)

Had 600+ yards in Total Offense ...... at Brown 640 yards (Oct. 28, 1995) Had 500+ yards in Total Offense .... vs. Columbia 583 yards (Nov. 15, 1997) Scored on first offensive play .......... atLehigh 71-yardpassfromSteveJoycetoRonMateo(Oct.21,1995) Recorded a safety ..... vs. Princeton (Nov. 2, 2002) Recorded a defensive TD ........ vs. Dartmouth Nate Tarsi 50-yd. fumble recovery (Nov. 6, 2004) Zero punts in a game ................ vs. Penn Nov. 20, 1982 Zero sacks allowed in a game ........ atBucknell Sept. 18, 2004 Blocked two kicks in a game ........... vs. Penn NateTarsi(fieldgoal);DanCollins(fieldgoal)(Nov.20,2004) Had 25+ first downs in a game ...... vs. Columbia 26, (Nov. 15, 2003) Had 40+ minutes in time of possession .. at Brown 41:40 (Oct. 26, 2002) Recorded a shutout .. 21-0 vs. Yale (Nov. 6, 1993) Held opponent to negative yards rushing ...... -5 (28 carries) at Columbia (Nov. 15, 1986) Played in 3+ overtime game ........ Never done Played in 2-overtime game ........... at Brown W, 10-7 (Oct. 26, 2002) Played in overtime game .......... vs.Princeton L, 25-32 (Nov. 2, 2002)

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Caught 15+ passes .............. JohnTagliaferri 15 receptions, at Princeton (Oct. 23, 1985) Caught 10+ passes ................ JohnKellner 10 receptions, vs. Columbia (Nov. 15, 2003) Caught 8+ passes .................. Chad Nice 8 receptions, at Columbia (Nov. 13, 2004) Had 200+ yards receiving ......... JoeSplendorio 204 yards (11 receptions), at Brown (Oct. 2, 1999) Had 100+ yards receiving ......... Brian Romney 115 yards (7 receptions) vs. Penn (Nov. 20, 2004) Caught 3 TD passes .............. EricKrawczyk 106 yards (8 receptions), vs. Columbia (Nov. 15, 2003) Caught 2 TD passes ............. KeithFerguson at Brown (Oct. 21, 2000) Two 100-yard receivers, same game ........... Nice(142yds)andRomney(114yds)vs.Princeton(Oct.30,2004)

Kicked 2 field goals ........... Trevor MacMeekin 2,vs.Georgetown (Oct. 18, 2003) An extra point was missed ........... PeterZell at Columbia (Nov. 13, 2004) Punted 10+ times ............. Mike Baumgartel 10, vs. Dartmouth (Nov. 6, 2004)

HISTORY

All-Time Scores 1887 (0-2) Coach: No regular coach Captain: J. H. Sheldon Date Opponent .... W/L Score 11/12 UNION ........ L 10 -24 11/24 LEHIGH+ ....... L 10 -38 TOTALS 20 -62 + - game played in Elmira, N.Y. 1888 (4-2) Coach: No regular coach Captain: W. G. Howell Date Opponent .... W/L Score 10/16 PALMYRA ...... W 26 -0 10/27 WILLIAMS ...... W 20 -0 11/3 UNION ........ W 30 -0 11/12 LAFAYETTE ..... L 0 -16 11/19 BUCKNELL ...... W 20 -0 11/29 vs.Lehigh+ ..... L 0 -4 TOTALS 96 -20 + - game played in Elmira, N.Y. 1889 (7-2) Coach: No regular coach Captain: D. Upton Date Opponent .... W/L Score 10/5 BUCKNELL ...... W 66 -0 10/12 LAFAYETTE ..... W 10 -0 10/16 atYale ........ L 6 -60 10/19 ROCHESTER ..... W 124 -0 11/2 STEVENS INST. .. W 38 -4 11/9 YALE .......... L 0 -70 11/16 vs. Michigan+ ... W 66 -0 11/23 at Columbia .... W 20 -0 11/28 vs.Lafayette* ... W 24 -0 TOTALS 354 -130 + - game played in Buffalo, N.Y. * - game played in Syracuse, N.Y.

WWW .CORNELL B IG R ED . COM

1890 (7-4) Coach: No regular coach Captain: E. Yawger Date Opponent .... W/L Score 10/11 ROCHESTER ..... W 98 -0 10/30 at Union ....... W 32 -0 10/31 atWilliams ..... L 8 -18 11/1 at Harvard ..... L 0 -77 11/3 at Amherst ..... L 0 -18 11/4 atTrinity ....... W 26 -0 11/5 at Wesleyan .... L 2 -4 11/8 BUCKNELL ...... W 26 -0 11/15 vs. Michigan+ ... W 20 -5 11/22 COLUMBIA ..... W 36 -0 11/25 at Chicago U. Club W 12 -8 TOTALS 260 -130 + - game played in Detroit, Mich.

1891 (7-3) Coach: No regular coach Captain: C. Johanson Date Opponent .... W/L Score 10/3 SYRACUSE ..... W 68 -0 10/10 BUCKNELL ...... L. 0 -4 10/17 STEVENS INST. .. W 72 -0 10/24 LAFAYETTE ..... W 30 -0 11/7 LEHIGH ........ W 24 -0 11/14 atPrinceton .... L. 0 -6 11/21 vs. Michigan+ ... W 58 -12 11/24 at Detroit A. C. .. W 32 -0 11/26 at Chicago U. Club L. 4 -12 11/28 vs.Michigan* ... W 10 -0 TOTALS 298 -34 + - game played in Detroit, Mich. * - game played in Chicago, Ill. 1892 (10-1) Coach: No regular coach Captain: C. Johanson Date Opponent .... W/L Score 9/24 at Syracuse A. C. W 16 -0 9/28 SYRACUSE ..... W 58 -0 10/1 BUCKNELL ...... W 54 -0 10/8 DICKINSON .... W 58 -0

2005 FOOTBALL

10/22 atLehigh ...... W 76 -0 10/29 vs.Williams+ .... W 24 -12 11/5 vs.Harvard* .... L 14 -20 11/8 MICHIGAN ..... W 44 -0 11/12 MIT .......... W 44 -12 11/18 at Manhattan A. C. W 16 -0 11/24 at Michigan ..... W 30 -10 TOTALS 434 -54 + - game played in Albany, N.Y. * - game played in Springfield, Mass. 1893 (2-5-1) Coach: No regular coach Captain:C.J.Barr Date Opponent .... W/L Score 10/1 GETTYSBURG ... W 16 -0 10/14 UNION ........ W 18 -6 10/21 vs.Princeton* ... L 0 -46 10/28 vs.Williams+ .... T 10 -10 11/4 vs.Harvard* .... L 0 -34 11/8 TUFTS ........ L 0 -6 11/11 LEHIGH ........ L 0 -14 11/18 at Penn ....... L 0 -50 TOTALS 44 -166 + - game played in Albany, N.Y. * - game played in New York, N.Y. 1894 (6-4-1) Coach: Marshall Newell Captain: Glenn (Pop) Warner Date Opponent .... W/L Score 9/26 SYRACUSE ..... W 39 -0 10/6 UNION ........ W 37 -0 10/13 LAFAYETTE ..... W 24 -0 10/20 vs.Princeton+ ... L 4 -12 10/27 vs.Harvard+ .... L 12 -22 11/3 MICHIGAN ..... W 22 -0 11/7 vs. Crescent A. C. W 22 -0 11/10 vs.Williams* .... T 0 -0 11/17 at Penn ....... L 0 -6 11/24 vs. Michigan^ ... L 4 -12 11/29 LEHIGH ........ W 10 -6 TOTALS 174 -58 + - game played in New York, N.Y. * - game played in Albany, N.Y. ^ - game played in Buffalo, N.Y. 1895 (3-4-1) Coach: Marshall Newell Captain:ClintonWyckoff Date Opponent .... W/L Score 9/26 SYRACUSE ..... W 8 -0 10/5 PENN STATE .... T 0 -0 10/12 CASE WESTERN .. W 12 -4 10/19 LAFAYETTE ..... L 0 -6 10/26 at Harvard ..... L 0 -25 11/9 vs.Princeton+ ... L 0 -6 11/16 B R O W N ....... W 6 -4 11/28 at Penn ....... L 2 -46 TOTALS 28 -91 + - game played in Buffalo, N.Y. 1896 (5-3-1) Coach: Joseph Beacham Captain: Joseph Beacham Date Opponent .... W/L Score 9/26 COLGATE ...... W 6 -0 10/3 SYRACUSE ..... W 22 -0 10/10 CASE WESTERN .. W 48 -0 10/17 TUFTS ........ W 18 -0 10/24 HARVARD ...... L 4 -13 10/31 atPrinceton .... L 0 -37 11/7 BUCKNELL ...... W 54 -0 11/14 vs.Williams+ .... T 0 -0 11/28 at Penn ....... L 10 -32 TOTALS 162 -82 + - game played in Buffalo, N.Y. 1897 (5-3-1) Coach: Glenn (Pop) Warner Captain: William McKeever Date Opponent .... W/L Score 9/25 COLGATE ...... W 6 -0

10/2 SYRACUSE ..... W 16 -0 10/9 TUFTS ........ W 15 -0 10/16 atLafayette .... T 4 -4 10/23 PRINCETON .... L 0 -10 10/30 at Harvard ..... L 5 -24 11/6 PENN STATE .... W 45 -0 11/13 vs.Williams+ .... W 42 -0 11/25 at Penn ....... L 0 -4 TOTALS 133 -42 + - game played in Buffalo, N.Y. 1898 (10-2) Coach: Glenn (Pop) Warner Captain:AllenWhiting Date Opponent .... W/L Score 9/21 SYRACUSE ..... W 28 -0 9/24 COLGATE ...... W 29 -5 9/28 HAMILTON ..... W 41 -0 10/1 TRINITY ....... W 47 -0 10/5 atSyracuse ..... W 30 -0 10/8 CARLISLE INDIANS W 23 -6 10/15 BUFFALO ...... W 27 -0 10/22 atPrinceton .... L 0 -6 10/29 OBERLIN ....... W 6 -0 11/5 vs.Williams+ .... W 12 -0 11/12 LAFAYETTE ..... W 47 -0 11/24 at Penn ....... L 6 -12 TOTALS 296 -29 + - game played in Buffalo, N.Y. 1899 (7-3) Coach: Percy Haughton Captain: Raymond Starbuck Date Opponent .... W/L Score 9/23 vs.Colgate+ .... W 42 -0 9/27 SYRACUSE ..... W 17 -0 9/30 HAMILTON ..... W 12 -0 10/7 WILLIAMS ...... W 12 -0 10/14 at Chicago ..... L 6 -17 10/21 LEHIGH ........ W 6 -0 10/28 PRINCETON .... W 5 -0 11/7 at Columbia .... W 29 -0 11/11 LAFAYETTE ..... L 5 -6 11/30 at Penn ....... L 0 -29 TOTALS 134 -52 +-gameplayedinRichfieldSprings,N.Y. 1900 (10-2) Coach: Percy Haughton Captain: Raymond Starbuck Date Opponent .... W/L Score 9/26 COLGATE ...... W 16 -0 9/29 SYRACUSE ..... W 6 -0 10/3 ROCHESTER ..... W 6 -0 10/6 BUCKNELL ...... W 6 -0 10/13 WASH. & JEFF. ... W 16 -5 10/20 UNION ........ W 11 -0 10/27 DARTMOUTH ... W 23 -6 11/3 atPrinceton .... W 12 -0 11/10 OBERLIN ....... W 29 -0 11/17 atLafayette .... L 0 -17 11/24 VERMONT ...... W 42 -0 11/29 at Penn ....... L 0 -27 TOTALS 167 -55 1901 (11-1) Coach: Raymond Starbuck Captain: William Warner Date Opponent .... W/L Score 9/28 COLGATE ...... W 17 -0 10/2 ROCHESTER ..... W 50 -0 10/5 BUCKNELL ...... W 6 -0 10/9 HAMILTON ..... W 39 -0 10/12 UNION ........ W 24 -0 10/19 vs.CarlisleIndians+ W 17 -0 10/26 OBERLIN ....... W 29 -0 11/2 PRINCETON .... L 6 -8 11/9 LEHIGH ........ W 30 -0 11/16 at Columbia .... W 24 -0 11/23 VERMONT ...... W 68 -0 11/28 at Penn ....... W 23 -6 TOTALS 333 -14 + - game played in Buffalo, N.Y.

AND

RECORDS

1902 (8-3) Coach: Raymond Starbuck Captain: William Warner Date Opponent .... W/L Score 9/27 COLGATE ...... W 5 -0 10/1 ROCHESTER ..... W 31 -0 10/4 UNION ........ W 42 -0 10/8 HOBART ....... W 57 -0 10/11 WILLIAMS ...... W 37 -6 10/18 CARLISLE INDIANS L 6 -10 10/25 OBERLIN ....... W 57 -0 11/1 atPrinceton .... L 0 -10 11/8 WASH. & JEFF. ... W 50 -0 11/15 LAFAYETTE ..... W 28 -0 11/27 at Penn ....... L 11 -12 TOTALS 324 -38 1903 (6-3-1) Coach: William Warner Captain: Sanford Hunt Date Opponent .... W/L Score 9/26 HOBART ....... W 12 -0 9/30 ALFRED ........ W 26 -0 10/3 ROCHESTER ..... W 11 -0 10/10 COLGATE ...... W 12 -0 10/17 BUCKNELL ...... W 6 -0 10/24 CASE WESTERN .. W 41 -0 10/31 atPrinceton .... L 0 -44 11/7 LEHIGH ........ T 0 -0 11/14 COLUMBIA ..... L 12 -17 11/26 at Penn ....... L 0 -42 TOTALS 120 -103 1904 (7-3) Coach: Glenn (Pop) Warner Captain: James Lynah Date Opponent .... W/L Score 9/28 COLGATE ...... W 17 -0 10/1 ROCHESTER ..... W 29 -6 10/5 HOBART ....... W 24 -0 10/8 HAMILTON ..... W 34 -0 10/15 BUCKNELL ...... W 24 -12 10/22 FRANKLIN & MARSH. W 36 -5 10/29 PRINCETON .... L 6 -18 11/5 LEHIGH ........ W 50 -5 11/12 at Columbia .... L 6 -12 11/24 at Penn ....... L 0 -34 TOTALS 226 -92 1905 (6-4) Coach: Glenn (Pop) Warner Captain: James Costello Date Opponent .... W/L Score 9/27 HAMILTON ..... W 5 -0 9/30 COLGATE ...... W 12 -11 10/4 HOBART ....... W 28 -0 10/7 BUCKNELL ...... W 24 -0 10/21 PITTSBURGH .... W 30 -0 10/28 HAVERFORD .... W 57 -0 11/4 SWARTHMORE .. L 0 -14 11/11 atPrinceton .... L 6 -16 11/18 COLUMBIA ..... L 6 -12 11/30 Penn ......... L 5 -6 TOTALS 173 -59 1906 (8-1-2) Coach: Glenn (Pop) Warner Captain: George Cook Date Opponent .... W/L Score 9/29 COLGATE ...... T 0 -0 10/3 HAMILTON ..... W 21 -0 10/6 OBERLIN ....... W 25 -5 10/10 NIAGARA ...... W 23 -6 10/13 BUCKNELL ...... W 24 -6 10/20 BOWDOIN ..... W 72 -0 10/27 vs.Princeton+ ... L 5 -14 11/3 PITTSBURGH .... W 23 -0 11/10 HOLY CROSS ... W 16 -6 11/17 SWARTHMORE .. W 28 -0 11/29 at Penn ....... T 0 -0 TOTALS 237 -37 + - game played in New York, N.Y.

HISTORY

AND

RECORDS

1907 (8-2) Coach: Henry Schoellkopf Captain: George Cook Date Opponent .... W/L Score 10/2 HAMILTON ..... W 23 -0 10/5 OBERLIN ....... W 22 -5 10/9 NIAGARA ...... W 47 -0 10/12 COLGATE ...... W 18 -0 10/19 PENN STATE .... L 6 -8 10/26 PRINCETON .... W 6 -5 11/2 PITTSBURGH .... W 18 -5 11/9 at Army ....... W 14 -10 11/16 SWARTHMORE .. W 18 -0 11/28 at Penn ....... L 4 -12 TOTALS 176 -45 1908 (7-1-1) Coach: Henry Schoellkopf Captain: George Walder Date Opponent .... W/L Score 10/3 HAMILTON ..... W 11 -0 10/10 OBERLIN ....... W 23 -10 10/17 COLGATE ...... W 9 -0 10/24 VERMONT ...... W 9 -0 10/31 PENN STATE .... W 10 -4 11/7 AMHERST ...... W 6 -0 11/14 at Chicago ..... T 6 -6 11/21 TRINITY ....... W 18 -6 11/26 at Penn ....... L 4 -17 TOTALS 96 -43 1909 (3-4-1) Coach: George Walder Captain: A. F. Tydeman Date Opponent .... W/L Score 10/2 RENSSELAER .... W 16 -3 10/9 OBERLIN ....... W 16 -6 10/16 FORDHAM ..... L 6 -12 10/23 VERMONT ...... W 16 -0 10/30 WILLIAMS ...... L 0 -3 11/6 at Harvard ..... L 0 -18 11/13 CHICAGO ...... T 6 -6 11/25 at Penn ....... L 6 -17 TOTALS 66 -65 1910 (5-2-1) Coach: Daniel Reed Captain: LeGrand Simson Date Opponent .... W/L Score 9/28 HOBART ....... W 50 -0 10/1 RENSSELAER .... W 24 -0 10/8 OBERLIN ....... T 0 -0 10/15 ST. BONAVENTURE W 47 -0 10/22 VERMONT ...... W 15 -5 11/5 at Harvard ..... L 5 -27 11/12 CHICAGO ...... W 18 -0 11/24 at Penn ....... L 6 -12 TOTALS 165 -44

Date 9/25 9/28 10/5 10/12 10/19 10/26 11/2 11/9

1912 (3-7) Coach: Al Sharpe Captain: E. W. Butler Opponent .... W/L Score WASH. & JEFF. ... W 3 -0 COLGATE ...... L 7 -13 OBERLIN ....... L 0 -13 NEW YORK UNIV. W 14 -6 PENN STATE .... L 6 -29 BUCKNELL ...... W 14 -0 WILLIAMS ...... L 10 -24 DARTMOUTH ... L 0 -24

1913 (5-4-1) Coach: Al Sharpe Captain: John Munns Date Opponent .... W/L Score 9/24 URSINUS ...... W 41 -0 9/27 COLGATE ...... T 0 -0 10/4 OBERLIN ....... W 37 -12 10/11 CARLISLE INDIANS L 0 -7 10/18 BUCKNELL ...... W 10 -7 10/25 PITTSBURGH .... L 7 -20 11/1 at Harvard ..... L 6 -23 11/8 MICHIGAN ..... L 0 -17 11/15 LAFAYETTE ..... W 10 -3 11/27 at Penn ....... W 21 -0 TOTALS 132 -89 1914 (8-2) Coach: Al Sharpe Captain: John O’Hearn Date Opponent .... W/L Score 9/23 URSINUS ...... W 28 -0 9/26 PITTSBURGH .... L 3 -9 10/3 COLGATE ...... L 3 -7 10/10 CARLISLE INDIANS W 21 -0 10/17 BUCKNELL ...... W 48 -0 10/24 vs. Brown+ ..... W 28 -7 10/31 HOLY CROSS ... W 48 -3 11/7 FRANKLIN & MARSH W 26 -3 11/14 at Michigan ..... W 28 -13 11/26 at Penn ....... W 24 -12 TOTALS 257 -54 + - game played in New York, N.Y. 1915 (9-0) National Champions* Games first played at Schoellkopf Coach: Al Sharpe Captain:CharlesBarrett Date Opponent .... W/L Score 9/28 GETTYSBURG ... W 13 -0 10/2 OBERLIN ....... W 34 -7 10/9 WILLIAMS ...... W 46 -6 10/16 BUCKNELL ...... W 41 -0 10/23 at Harvard ..... W 10 -0 10/30 VIRGINIA TECH .. W 45 -0 11/6 at Michigan ..... W 34 -7 11/13 WASH. & LEE ... W 40 -21 11/25 at Penn ....... W 24 -9 TOTALS 287 -50 1916 (6-2) Coach: Al Sharpe Captain: L. W. Mueller Date Opponent .... W/L Score 10/9 GETTYSBURG ... W 26 -0 10/14 WILLIAMS ...... W 42 -0 10/21 BUCKNELL ...... W 19 -0 10/28 at Harvard ..... L 0 -23 11/4 CARNEGIE TECH . W 15 -7 11/11 MICHIGAN ..... W 23 -20 11/18 MASS. STATE ... W 37 -0 11/30 at Penn ....... L 3 -23 TOTALS 165 -73 1917 (3-6) Coach: Al Sharpe Captain: Arthur Hoffman Date Opponent .... W/L Score 10/6 OBERLIN ....... W 22 -0 10/13 WILLIAMS ...... L 10 -14 10/16 47TH INFANTRY . L 0 -6 10/20 COLGATE ...... L 0 -20 10/27 BUCKNELL ...... W 20 -0 11/3 CARNEGIE TECH . W 20 -0 11/10 at Michigan ..... L 0 -42 11/17 FORDHAM ..... L 6 -27 11/29 at Penn ....... L 0 -37 TOTALS 78 -146

1918 NO TEAM 1919 (3-5) Coach: John Rush Captain:Francis(Fritz)Shiverick Date Opponent .... W/L Score 10/4 OBERLIN ....... W 9 -0 10/11 WILLIAMS ...... W 3 -0 10/18 COLGATE ...... L 0 -21 10/25 vs. Dartmouth+ .. L 0 -9 11/1 LAFAYETTE ..... L 2 -21 11/8 CARNEGIE TECH . W 20 -0 11/15 PENN STATE .... L 0 -20 11/27 at Penn ....... L 0 -24 TOTALS 34 -95 + - game played at the Polo Grounds (New York, N.Y.) 1920 (6-2) Coach: Gil Dobie Captain: Clyde Mayer Date Opponent .... W/L Score 10/2 ROCHESTER ..... W 13 -6 10/9 ST. BONAVENTURE W 55 -7 10/16 UNION ........ W 60 -0 10/23 COLGATE ...... W 42 -6 10/30 RUTGERS ...... W 24 -0 11/6 vs. Dartmouth+ .. L 3 -14 11/13 COLUMBIA ..... W 34 -7 11/25 at Penn ....... L 0 -28 TOTALS 231 -68 + - game played at the Polo Grounds (New York, N.Y.) 1921 (8-0) National Champions** Coach: Gil Dobie Captain: Wilson Dodge Date Opponent .... W/L Score 10/1 ST. BONAVENTURE W 41 -0 10/8 ROCHESTER ..... W 55 -0 10/15 CASE WESTERN .. W 110 -0 10/22 COLGATE ...... W 31 -7 10/29 vs. Dartmouth^ .. W 59 -7 11/5 vs. Columbia+ ... W 41 -7 11/12 SPRINGFIELD .... W 14 -0 11/24 at Penn ....... W 41 -0 TOTALS 392 -21 + - game played at Polo Grounds (New York, N.Y.) ^ - game played in Troy, N.Y. 1922 (8-0) National Champions*** Coach: Gil Dobie Captain: Eddie Kaw Date Opponent .... W/L Score 9/30 ST. BONAVENTURE W 55 -6 10/7 NIAGARA ...... W 66 -0 10/14 NEW HAMPSHIRE . W 68 -7 10/21 COLGATE ...... W 14 -0 11/4 COLUMBIA ..... W 56 -0 11/11 vs. Dartmouth+ .. W 23 -0 11/18 ALBRIGHT ...... W 48 -14 11/30 at Penn ....... W 9 -0 TOTALS 339 -27 + - game played at Polo Grounds (New York, N.Y.) 1923 (8-0) National Champions**** Coach: Gil Dobie Captain: George Pfann Date Opponent .... W/L Score 9/29 ST. BONAVENTURE W 41 -6 10/6 SUSQUEHANNA . W 84 -0 10/13 WILLIAMS ...... W 28 -6 10/20 COLGATE ...... W 34 -7 11/3 at Dartmouth ... W 32 -7 11/10 at Columbia .... W 35 -0 11/17 JOHNS HOPKINS . W 52 -0 11/29 at Penn ....... W 14 -7 TOTALS 320 -33

1924 (4-4) Coach: Gil Dobie Captain: Frank Henderson Date Opponent .... W/L Score 9/27 ST. BONAVENTURE W 56 -0 10/4 NIAGARA ...... W 27 -0 10/11 WILLIAMS ...... L 7 -14 10/18 RUTGERS ...... L 0 -10 11/1 COLUMBIA ..... W 14 -0 11/8 SUSQUEHANNA . W 91 -0 11/15 vs. Dartmouth+ .. L 14 -27 11/27 at Penn ....... L 0 -20 TOTALS 209 -71 + - game played at the Polo Grounds (New York, N.Y.) 1925 (6-2) Coach: Gil Dobie Captain: Frank Kearney Date Opponent .... W/L Score 9/27 SUSQUEHANNA . W 80 -0 10/3 NIAGARA ...... W 26 -0 10/10 WILLIAMS ...... W 48 -0 10/17 RUTGERS ...... W 41 -0 10/31 vs. Columbia+ ... W 17 -14 11/7 at Dartmouth ... L 13 -62 11/14 CANISIUS ...... W 33 -0 11/26 at Penn ....... L 0 -7 TOTALS 258 -83 + - game played at Polo Grounds (New York, N.Y.) 1926 (6-1-1) Coach: Gil Dobie Captain: Emerson Carey Date Opponent .... W/L Score 9/25 GENEVA ....... W 6 -0 10/2 NIAGARA ...... W 28 -0 10/9 WILLIAMS ...... W 49 -0 10/16 MICHIGAN STATE W 24 -14 10/30 at Columbia .... L 9 -17 11/6 ST. BONAVENTURE W 41 -0 11/13 DARTMOUTH ... W 24 -23 11/25 at Penn ....... T 10 -10 TOTALS 191 -64 1927 (3-3-2) Coach: Gil Dobie Captain: Harold Hoekelman Date Opponent .... W/L Score 9/24 CLARKSON ..... W 41 -0 10/1 NIAGARA ...... W 19 -6 10/8 RICHMOND .... W 53 -0 10/22 PRINCETON .... L 10 -21 10/29 COLUMBIA ..... T 0 -0 11/5 ST. BONAVENTURE T 6 -6 11/12 at Dartmouth ... L 7 -53 11/19 at Penn ....... L 0 -35 TOTALS 136 -121 1928 (3-3-2) Coach: Gil Dobie Captain: Dudley Schoales Date Opponent .... W/L Score 9/29 CLARKSON ..... W 20 -0 10/6 NIAGARA ...... W 34 -0 10/13 HAMPDEN-SYDNEY W 18 -6 10/27 atPrinceton .... L 0 -3 11/3 at Columbia .... T 0 -0 11/10 ST. BONAVENTURE T 0 -0 11/17 DARTMOUTH ... L 0 -28 11/29 at Penn ....... L 0 -49 TOTALS 72 -86 1929 (6-2) Coach: Gil Dobie Captain: Sam Wakeman Date Opponent .... W/L Score 9/28 CLARKSON ..... W 60 -0 10/5 NIAGARA ...... W 22 -6 10/12 HAMPDEN-SYDNEY W 40 -6 10/19 PRINCETON .... W 13 -7 11/2 COLUMBIA ..... W 12 -6 11/9 CASE WESTERN .. W 36 -0 11/16 at Dartmouth ... L 14 -18 11/28 at Penn ....... L 7 -17 TOTALS 204 -60

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

1911 (7-3) Coach: Daniel Reed Captain: William Munk Date Opponent .... W/L Score 9/27 ALLEGHENY ..... W 35 -0 9/30 COLGATE ...... W 6 -0 10/7 OBERLIN ....... W 15 -3 10/14 PENN STATE .... L 0 -5 10/21 WASH. & JEFF. ... W 6 -0 10/28 PITTSBURGH .... W 9 -3 11/4 WILLIAMS ...... W 15 -14 11/11 MICHIGAN ..... W 6 -0 11/18 at Chicago ..... L 0 -6 11/30 at Penn ....... L 9 -21 TOTALS 101 -52

11/16 at Michigan ..... L 7 -20 11/28 at Penn ....... L 2 -7 TOTALS 63 -136

HISTORY 1930 (6-2) Coach: Gil Dobie Captain: Paul Hunt Date Opponent .... W/L Score 9/27 CLARKSON ..... W 66 -0 10/4 NIAGARA ...... W 61 -14 10/11 HAMPDEN-SYDNEY W 47 -6 10/18 atPrinceton .... W 12 -7 11/1 at Columbia .... L 7 -10 11/8 HOBART ....... W 54 -0 11/15 DARTMOUTH ... L 13 -19 11/27 at Penn ....... W 13 -7 TOTALS 273 -63

1936 (3-5) Coach: Carl Snavely Captain: John Batten Date Opponent .... W/L Score 9/26 ALFRED ........ W 74 -0 10/3 atYale ........ L 0 -23 10/17 SYRACUSE ..... W 20 -7 10/24 PENN STATE .... W 13 -7 10/31 at Columbia .... L 13 -20 11/7 atPrinceton .... L 13 -41 11/14 DARTMOUTH ... L 6 -20 11/26 at Penn ....... L 6 -14 TOTALS 145 -132

1931 (7-1) Coach: Gil Dobie Captain:CristobalMartinez-Zorrilla Date Opponent .... W/L Score 9/26 CLARKSON ..... W 68 -0 10/3 NIAGARA ...... W 37 -6 10/10 RICHMOND .... W 27 -0 10/17 PRINCETON .... W 33 -0 10/31 COLUMBIA ..... W 13 -0 11/7 ALFRED ........ W 54 -0 11/14 at Dartmouth ... L 0 -14 11/26 at Penn ....... W 7 -0 TOTALS 239 -20

1937 (5-2-1) Coach: Carl Snavely Captain: Edward (Ted) Hughes Date Opponent .... W/L Score 9/25 PENN STATE .... W 26 -19 10/2 COLGATE ...... W 40 -7 10/9 atPrinceton .... W 20 -7 10/16 SYRACUSE ..... L 6 -14 10/23 atYale ........ L 0 -9 10/30 COLUMBIA ..... W 14 -0 11/13 at Dartmouth ... T 6 -6 11/25 at Penn ....... W 34 -20 TOTALS 146 -82

1932 (5-2-1) Coach: Gil Dobie Captain:BartViviano Date Opponent .... W/L Score 9/24 BUFFALO ...... W 72 -0 10/1 NIAGARA ...... W 7 -0 10/8 RICHMOND .... W 27 -0 10/15 atPrinceton .... T 0 -0 10/22 at Columbia .... L 0 -6 11/5 ALBRIGHT ...... W 40 -14 11/12 DARTMOUTH ... W 21 -6 11/24 at Penn ....... L 7 -13 TOTALS 174 -39

1938 (5-1-1) Coach: Carl Snavely Captain: Al Van Ranst Date Opponent .... W/L Score 10/1 COLGATE ...... W 15 -6 10/8 at Harvard ..... W 20 -0 10/15 atSyracuse ..... L 17 -19 10/22 PENN STATE .... W 21 -6 10/29 at Columbia .... W 23 -7 11/12 DARTMOUTH ... W 14 -7 11/24 at Penn ....... T 0 -0 TOTALS 110 -45

1933 (4-3) Coach: Gil Dobie Captain:JohnFerraro Date Opponent .... W/L Score 9/30 ST. LAWRENCE .. W 48 -7 10/7 RICHMOND .... W 28 -7 10/14 at Michigan ..... L 0 -40 10/21 SYRACUSE ..... L 7 -14 11/4 COLUMBIA ..... L 6 -9 11/18 at Dartmouth ... W 7 -0 11/30 at Penn ....... W 20 -12 TOTALS 116 -89

WWW .CORNELL B IG R ED . COM

1934 (2-5) Coach: Gil Dobie Captain: Walt Switzer Date Opponent .... W/L Score 9/29 ST. LAWRENCE .. W 14 -0 10/6 RICHMOND .... L 0 -6 10/13 SYRACUSE ..... L 7 -20 10/27 atPrinceton .... L 0 -45 11/3 at Columbia .... L 0 -14 11/17 DARTMOUTH ... W 21 -6 11/29 at Penn ....... L 13 -23 TOTALS 55 -114

1935 (0-6-1) Coach: Gil Dobie Captain: H. S. Wilson Date Opponent .... W/L Score 9/28 ST. LAWRENCE .. L 6 -12 10/5 CASE WESTERN .. L 19 -33 10/12 atSyracuse ..... L 14 -21 10/26 PRINCETON .... L 0 -54 11/2 COLUMBIA ..... T 7 -7 11/16 at Dartmouth ... L 6 -41 11/28 at Penn ....... L 7 -33 TOTALS 59 -201

2005 FOOTBALL

1939 (8-0) National Champions***** Coach: Carl Snavely Captains:VincentEichler, Malvern Baker, Ken Brown Date Opponent .... W/L Score 10/7 SYRACUSE ..... W 19 -6 10/14 atPrinceton .... W 20 -7 10/21 PENN STATE .... W 47 -0 10/28 at Ohio State ... W 23 -14 11/4 COLUMBIA ..... W 13 -7 11/11 COLGATE ...... W 14 -12 11/18 at Dartmouth ... W 35 -6 11/25 at Penn ....... W 26 -0 TOTALS 197 -52 1940 (6-2) Coach: Carl Snavely Captain: Walt Matuszak Date Opponent .... W/L Score 10/5 COLGATE ...... W 34 -0 10/12 at Army ....... W 45 -0 10/19 SYRACUSE ..... W 33 -6 10/26 OHIO STATE .... W 21 -7 11/2 COLUMBIA ..... W 27 -0 11/9 atYale ........ W 21 -0 11/16 at Dartmouth ... L 0 -3 11/23 at Penn ....... L 20 -22 TOTALS 201 -38 1941 (5-3) Coach: Carl Snavely Captain:PeterWolff Date Opponent .... W/L Score 10/4 SYRACUSE ..... W 6 -0 10/11 at Harvard ..... W 7 -0 10/18 vs. Navy+ ...... L 0 -14 10/25 COLGATE ...... W 21 -2 11/1 at Columbia .... L 0 -7 11/8 YALE .......... W 21 -7 11/15 DARMOUTH .... W 33 -19 11/22 at Penn ....... L 0 -16 TOTALS 88 -65 + - game played at Municipal Stadium (Baltimore,Md.)

1942 (3-5-1) Coach: Carl Snavely Captain: Roy Johnson Date Opponent .... W/L Score 9/26 LAFAYETTE ..... W 20 -16 10/3 COLGATE ...... L 6 -18 10/10 at Army ....... L 8 -28 10/17 PENN STATE .... T 0 -0 10/24 atSyracuse ..... L 7 -12 10/31 at Columbia .... L 13 -14 11/7 atYale ........ W 13 -7 11/14 vs. Dartmouth+ .. W 21 -19 11/26 at Penn ....... L 7 -34 TOTALS 95 -148 + - game played in Buffalo, N.Y. 1943 (6-4) Coach: Carl Snavely Captain: Meredith (Bud) Cushing Date Opponent .... W/L Score 9/18 BUCKNELL ...... W 7 -6 9/25 SAMPSON N.T.S. W 27 -13 10/2 vs. Navy+ ...... L 7 -46 10/9 atPrinceton .... W 30 -0 10/16 HOLY CROSS ... W 20 -7 10/23 vs.Colgate* .... L 7 -20 10/30 COLUMBIA ..... W 33 -6 11/6 PENN STATE .... W 13 -0 11/13 vs. Dartmouth^ .. L 0 -20 11/25 at Penn ....... L 14 -20 TOTALS 158 -138 + - game played at Municipal Stadium (Baltimore,Md.) * - game played in Syracuse, N.Y. ^ - game played at Fenway Park (Boston,Mass.) 1944 (5-4) Coach: Carl Snavely Captains:FrankAccorsi,GrantEllis Date Opponent .... W/L Score 9/23 atSyracuse ..... W 39 -6 9/30 BUCKNELL ...... W 26 -0 10/7 atYale ........ L 7 -16 10/14 COLGATE ...... L 7 -14 10/21 SAMPSON N.T.S. W 13 -6 11/4 at Columbia .... W 25 -7 11/11 vs. Navy+ ...... L 0 -48 11/18 DARTMOUTH ... W 14 -13 11/25 at Penn ....... L 0 -20 TOTALS 131 -130 + - game played at Municipal Stadium (Baltimore,Md.) 1945 (5-4) Coach: Ed McKeever Captain: Allen Dekdebrun Date Opponent .... W/L Score 9/22 atSyracuse ..... W 26 -14 9/29 BUCKNELL ...... W 19 -8 10/6 U.S. SUB BASE .. W 39 -0 10/13 PRINCETON .... L 6 -14 10/27 atYale ........ L 7 -18 11/3 at Columbia .... L 26 -34 11/10 COLGATE ...... W 20 -6 11/17 at Dartmouth ... W 20 -13 11/24 at Penn ....... L 6 -59 TOTALS 169 -166 1946 (5-3-1) Coach: Ed McKeever Captain:JoeMartin Date Opponent .... W/L Score 9/28 BUCKNELL ...... W 21 -0 10/5 at Army ....... L 21 -46 10/12 COLGATE ...... W 13 -9 10/19 YALE .......... T 6 -6 10/26 atPrinceton .... W 14 -7 11/2 at Columbia .... W 12 -0 11/9 SYRACUSE ..... L 7 -14 11/16 DARTMOUTH ... W 21 -7 11/28 at Penn ....... L 20 -26 TOTALS 135 -115

AND

RECORDS

1947 (4-5) Coach: George (Lefty) James Captain:WaltKretz Date Opponent .... W/L Score 9/27 LEHIGH ........ W 27 -0 10/4 atYale ........ L 0 -14 10/11 at Colgate ..... W 27 -18 10/18 NAVY ......... L 19 -38 10/25 atPrinceton .... W 28 -21 11/1 COLUMBIA ..... L 0 -22 11/8 SYRACUSE ..... W 12 -6 11/15 at Dartmouth ... L 13 -21 11/27 at Penn ....... L 0 -21 TOTALS 126 -161 1948 (8-1) Coach: George (Lefty) James Captain: Joe Quinn Date Opponent .... W/L Score 9/25 NEW YORK UNIV. W 47 -6 10/2 vs. Navy+ ...... W 13 -7 10/9 HARVARD ...... W 40 -6 10/16 atSyracuse ..... W 34 -7 10/23 ARMY ......... L 6 -27 10/30 at Columbia .... W 20 -13 11/6 COLGATE ...... W 14 -6 11/13 DARTMOUTH ... W 27 -26 11/25 at Penn ....... W 23 -14 TOTALS 224 -112 + - game played at Municipal Stadium (Baltimore,Md.) 1949 (8-1) Coach: George (Lefty) James Captain: Paul Girolamo Date Opponent .... W/L Score 9/24 NIAGARA ...... W 27 -0 10/1 COLGATE ...... W 39 -27 10/8 at Harvard ..... W 33 -14 10/15 atYale ........ W 48 -14 10/22 PRINCETON .... W 14 -12 10/29 COLUMBIA ..... W 54 -0 11/5 SYRACUSE ..... W 33 -7 11/12 at Dartmouth ... L 7 -16 11/24 at Penn ....... W 29 -21 TOTALS 284 -111 1950 (7-2) Coach: George (Lefty) James Captains:CharlesTaylor,JohnPierik Date Opponent .... W/L Score 9/30 LAFAYETTE ..... W 27 -0 10/7 atSyracuse ..... W 26 -7 10/14 at Harvard ..... W 28 -7 10/21 YALE .......... W 7 -0 10/28 atPrinceton .... L 0 -27 11/4 at Columbia .... L 19 -20 11/11 COLGATE ...... W 26 -18 11/18 DARTMOUTH ... W 24 -0 11/25 at Penn ....... W 13 -6 TOTALS 170 -85 1951 (6-3) Coach: George (Lefty) James Captain:VicPujo Date Opponent .... W/L Score 9/29 SYRACUSE ..... W 21 -14 10/6 at Colgate ..... W 41 -18 10/13 HARVARD ...... W 42 -6 10/20 atYale ........ W 27 -0 10/27 atPrinceton .... L 15 -53 11/3 COLUMBIA ..... L 20 -21 11/10 MICHIGAN ..... W 20 -7 11/17 at Dartmouth ... W 21 -13 11/24 at Penn ....... L 0 -7 TOTALS 207 -139 1952 (2-7) Coach: George (Lefty) James Captain:BillWhelan Date Opponent .... W/L Score 9/27 COLGATE ...... L 7 -14 10/4 NAVY ......... L 7 -31 10/11 atSyracuse ..... L 6 -26 10/18 atYale ........ L 0 -13 10/25 PRINCETON .... L 0 -27 11/1 at Columbia .... W 21 -14

HISTORY

AND

RECORDS

11/8 at Michigan ..... L 7 -49 11/15 DARTMOUTH ... W 13 -7 11/27 at Penn ....... L 7 -14 TOTALS 68 -195 1953 (4-3-2) Coach: George (Lefty) James Captain:BillGeorge Date Opponent .... W/L Score 9/26 COLGATE ...... W 27 -7 10/3 RICE .......... L 7 -28 10/10 vs. Navy+ ...... L 6 -26 10/17 YALE .......... T 0 -0 10/24 atPrinceton .... W 26 -19 10/31 COLUMBIA ..... W 27 -13 11/7 SYRACUSE ..... L 0 -26 11/14 at Dartmouth ... W 28 -26 11/26 at Penn ....... T 7 -7 TOTALS 128 -152 + - game played at Municipal Stadium (Baltimore,Md.) 1954 (5-4) Coach: George (Lefty) James Captain: Guy Bedrossian Date Opponent .... W/L Score 9/25 COLGATE ...... L 14 -19 10/2 atRice ........ L 20 -41 10/9 HARVARD ...... L 12 -13 10/16 atYale ........ L 21 -47 10/23 atPrinceton .... W 27 -0 10/30 at Columbia .... W 26 -0 11/6 SYRACUSE ..... W 14 -6 11/13 DARTMOUTH ... W 40 -21 11/25 at Penn ....... W 20 -6 TOTALS 194 -153 1955 (5-4) Coach: George (Lefty) James Captain:DickJackson Date Opponent .... W/L Score 9/24 LEHIGH ........ W 14 -6 10/1 COLGATE ...... L 6 -21 10/8 at Harvard ..... W 20 -7 10/15 atYale ........ L 6 -34 10/22 PRINCETON .... L 20 -26 10/29 COLUMBIA ..... W 34 -19 11/5 at Brown ...... W 20 -7 11/12 at Dartmouth ... L 0 -7 11/24 at Penn ....... W 39 -7 TOTALS 159 -134 1956 (1-8; 1-6 Ivy, 8th) Coach: George (Lefty) James Captain: Art Boland Date Opponent .... W/L Score 9/29 at Colgate ..... L 6 -34 10/6 NAVY ......... L 0 -14 10/13 HARVARD ...... L 7 -32 10/20 atYale ........ L 7 -25 10/27 PRINCETON .... L 21 -32 11/3 at Columbia .... L 19 -25 11/10 at Brown ...... L 6 -13 11/17 DARTMOUTH ... L 14 -27 11/22 at Penn ....... W 20 -7 TOTALS 100 -209

1959 (5-4; 3-4 Ivy, T-5th) Coach: George (Lefty) James Captain: Dave Feeney Date Opponent .... W/L Score 9/26 at Colgate ..... W 20 -15 10/3 LEHIGH ........ W 13 -6 10/10 at Harvard ..... W 20 -16 10/17 YALE .......... L 0 -23 10/24 atPrinceton .... L 0 -20 10/31 COLUMBIA ..... W 13 -7 11/7 B R O W N ....... W 19 -0 11/14 at Dartmouth ... L 12 -21 11/26 at Penn ....... L 13 -28 TOTALS 110 -136 1960 (2-7; 1-6 Ivy, T-7th) Coach: George (Lefty) James Captain: Warren Sundstrom Date Opponent .... W/L Score 9/24 COLGATE ...... L 8 -28 10/1 BUCKNELL ...... W 15 -7 10/8 HARVARD ...... W 12 -0 10/15 atYale ........ L 6 -22 10/22 PRINCETON .... L 18 -21 10/29 Columbia ...... L 6 -44 11/5 at Brown ...... L 6 -7 11/12 DARTMOUTH ... L 0 -20 11/24 at Penn ....... L 7 -18 TOTALS 78 -167 1961 (3-6; 2-5 Ivy, 6th) Coach: Tom Harp Captains: George Telesh, Dave McKelvey Date Opponent .... W/L Score 9/30 COLGATE ...... W 34 -0 10/7 at Harvard ..... L 0 -14 10/14 NAVY ......... L 7 -31 10/21 YALE .......... L 0 -12 10/28 atPrinceton .... L 25 -30 11/4 COLUMBIA ..... L 7 -35 11/11 B R O W N ....... W 25 -0 11/18 at Dartmouth ... L 14 -15 11/25 at Penn ....... W 31 -0 TOTALS 143 -137 1962 (4-5; 4-3 Ivy, T-3rd) Coach: Tom Harp Captain: Tony Turel Date Opponent .... W/L Score 9/29 COLGATE ...... L 12 -23 10/6 HARVARD ...... W 14 -12 10/13 at Navy ....... L 0 -41 10/20 atYale ........ L 8 -26 10/27 PRINCETON .... W 35 -34 11/3 at Columbia .... L 21 -25 11/10 at Brown ...... W 28 -26 11/17 DARTMOUTH ... L 21 -28 11/24 at Penn ....... W 29 -22 TOTALS 168 -237 1963 (5-4; 4-3 Ivy, T-4th) Coach: Tom Harp Captain: Gary Wood Date Opponent .... W/L Score 9/28 COLGATE ...... L 17 -21 10/5 LEHIGH ........ W 24 -0 10/12 at Harvard ..... L 14 -21 10/19 YALE .......... W 13 -10 10/26 atPrinceton .... L 14 -51 11/2 COLUMBIA ..... W 18 -17 11/9 B R O W N ....... W 28 -25

11/16 at Dartmouth ... L 7 -12 11/28 at Penn ....... W 17 -8 TOTALS 152 -165 1964 (3-5-1; 3-4 Ivy, T-5th) Coach: Tom Harp Captain:ClarenceJentes Date Opponent .... W/L Score 9/26 BUFFALO ...... T 9 -9 10/3 at Colgate ..... L 3 -8 10/10 PENN ......... W 33 -0 10/17 at Harvard ..... L 0 -16 10/24 YALE .......... L 21 -23 10/31 at Columbia .... W 57 -20 11/7 at Brown ...... L 28 -31 11/14 DARTMOUTH ... W 33 -15 11/21 atPrinceton .... L 12 -17 TOTALS 196 -139 1965 (4-3-2; 3-3-1 Ivy, 4th) Coach: Tom Harp Captain:PhilRatner Date Opponent .... W/L Score 9/25 COLGATE ...... T 0 -0 10/2 atLehigh ...... W 49 -13 10/9 PRINCETON .... L 27 -36 10/16 HARVARD ...... T 3 -3 10/23 atYale ........ L 14 -24 10/30 COLUMBIA ..... W 20 -6 11/6 B R O W N ....... W 41 -21 11/13 at Dartmouth ... L 0 -20 11/25 at Penn ....... W 38 -14 TOTALS 192 -137 1966 (6-3; 4-3 Ivy, 4th) Coach: Jack Musick Captain:FredDevlin Date Opponent .... W/L Score 9/24 atBuffalo ...... W 28 -21 10/1 COLGATE ...... W 15 -14 10/8 PENN ......... W 45 -28 10/15 at Harvard ..... L 0 -21 10/22 YALE .......... W 16 -14 10/29 at Columbia .... W 31 -6 11/5 at Brown ...... W 23 -14 11/12 DARTMOUTH ... L 23 -32 11/19 atPrinceton .... L 0 -7 TOTALS 181 -157 1967 (6-2-1; 4-2-1 Ivy, 3rd) Coach: Jack Musick Captain:RonKopicki Date Opponent .... W/L Score 9/30 BUCKNELL ...... W 23 -7 10/7 at Colgate ..... W 23 -7 10/14 PRINCETON .... W 47 -13 10/21 HARVARD ...... L 12 -14 10/28 atYale ........ L 7 -41 11/4 COLUMBIA ..... W 27 -14 11/11 B R O W N ....... T 14 -14 11/18 at Dartmouth ... W 24 -21 11/25 at Penn ....... W 33 -14 TOTALS 210 -145 1968 (3-6; 1-6 Ivy, 7th) Coach: Jack Musick Captain: Doug Kleiber Date Opponent .... W/L Score 9/28 COLGATE ...... W 17 -0 10/5 RUTGERS ...... W 17 -16 10/12 PENN ......... L 8 -10 10/19 at Harvard ..... L 0 -10 10/26 YALE .......... L 13 -25 11/2 at Columbia .... L 25 -34 11/9 at Brown ...... W 31 -0 11/16 DARTMOUTH ... L 6 -27 11/23 atPrinceton .... L 13 -41 TOTALS 130 -163 1969 (4-5; 4-3 Ivy, 4th) Coach: Jack Musick Captains: Theo Jacobs, Dennis Huff Date Opponent .... W/L Score 9/27 COLGATE ...... L 24 -28 10/4 atRutgers ...... L 7 -21 10/11 PRINCETON .... L 17 -24 10/18 HARVARD ...... W 41 -24

10/25 atYale ........ 11/1 COLUMBIA ..... 11/8 B R O W N ....... 11/15 at Dartmouth ... 11/22 at Penn ....... TOTALS

L 0 -17 W 10 -3 W 14 -7 L 7 -24 W 28 -14 148 -162

1970 (6-3; 4-3 Ivy, 4th) Coach: Jack Musick Captain: Dennis Lubozynski Date Opponent .... W/L Score 9/26 at Colgate ..... W 17 -7 10/3 LEHIGH ........ W 41 -14 10/10 PENN ......... W 32 -31 10/17 at Harvard ..... L 24 -27 10/24 YALE .......... L 7 -38 10/31 at Columbia .... W 31 -20 11/7 at Brown ...... W 35 -21 11/14 DARTMOUTH ... L 0 -24 11/21 atPrinceton .... W 6 -3 TOTALS 193 -185 1971 (8-1; 6-1 Ivy, T-1st) Coach: Jack Musick Captains:TomAlbright,BillEllis Date Opponent .... W/L Score 9/25 COLGATE ...... W 38 -20 10/2 atRutgers ...... W 31 -17 10/9 PRINCETON .... W 19 -8 10/16 HARVARD ...... W 21 -16 10/23 atYale ........ W 31 -10 10/30 COLUMBIA ..... W 24 -21 11/6 B R O W N ....... W 21 -7 11/13 at Dartmouth ... L 14 -24 11/20 at Penn ....... W 41 -13 TOTALS 240 -136 1972 (6-3; 4-3 Ivy, T-3rd) Coach: Jack Musick Captain: Bob Joehl Date Opponent .... W/L Score 9/30 COLGATE ...... W 37 -7 10/7 RUTGERS ...... W 36 -22 10/14 PENN ......... W 24 -20 10/21 at Harvard ..... L 15 -33 10/28 YALE .......... W 24 -13 11/4 at Columbia .... L 0 -14 11/11 at Brown ...... W 48 -28 11/18 DARTMOUTH ... L 22 -31 11/25 atPrinceton .... W 22 -15 TOTALS 238 -183 1973 (3-5-1; 2-5 Ivy, 6th) Coach: Jack Musick Captain:BobLally Date Opponent .... W/L Score 9/29 at Colgate ..... W 35 -21 10/6 LEHIGH ........ T 7 -7 10/13 PRINCETON .... W 37 -6 10/20 HARVARD ...... L 15 -21 10/27 atYale ........ L 3 -20 11/3 COLUMBIA ..... W 44 -14 11/10 B R O W N ....... L 7 -17 11/17 at Dartmouth ... L 0 -17 11/24 at Penn ....... L 22 -31 TOTALS 170 -154 1974 (3-5-1; 1-5-1 Ivy, 7th) Coach: Jack Musick Captains: Rick Johnson, Dan Malone Date Opponent .... W/L Score 9/28 COLGATE ...... W 40 -21 10/5 BUCKNELL ...... W 24 -0 10/12 PENN ......... T 28 -28 10/19 at Harvard ..... L 27 -39 10/26 YALE .......... L 3 -27 11/2 at Columbia .... W 24 -0 11/9 at Brown ...... L 8 -16 11/16 DARTMOUTH ... L 9 -21 11/23 atPrinceton .... L 20 -41 TOTALS 183 -193

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

1957 (3-6; 3-4 Ivy, T-4th) Coach: George (Lefty) James Captain: Gerald Knapp Date Opponent .... W/L Score 9/28 COLGATE ...... L 13 -14 10/5 at Harvard ..... W 20 -6 10/12 SYRACUSE ..... L 0 -34 10/19 YALE .......... L 7 -18 10/26 atPrinceton .... L 14 -47 11/2 COLUMBIA ..... W 8 -0 11/9 B R O W N ....... W 13 -6 11/16 at Dartmouth ... L 19 -20 11/28 at Penn ....... L 6 -14 TOTALS 100 -159

1958 (6-3; 5-2 Ivy, T-2nd) Coach: George (Lefty) James Captain: Bob Hazzard Date Opponent .... W/L Score 9/27 COLGATE ...... W 13 -0 10/4 HARVARD ...... W 21 -14 10/11 atSyracuse ..... L 0 -55 10/18 atYale ........ W 12 -7 10/25 PRINCETON .... W 34 -8 11/1 at Columbia .... W 25 -0 11/8 at Brown ...... L 8 -12 11/15 DARTMOUTH ... L 15 -32 11/27 at Penn ....... W 19 -7 TOTALS 147 135

HISTORY 1975 (1-8; 0-7 Ivy, 8th) Coach: George Seifert Captains: Don Fanelli, Steve Horrigan Date Opponent .... W/L Score 9/27 COLGATE ...... L 22 -24 10/4 atBucknell ..... W 21 -6 10/11 PRINCETON .... L 8 -16 10/18 HARVARD ...... L 13 -34 10/25 atYale ........ L 14 -20 11/1 COLUMBIA ..... L 19 -42 11/8 B R O W N ....... L 23 -45 11/15 at Dartmouth ... L 10 -33 11/22 at Penn ....... L 21 -27 TOTALS 151 -247 1976 (2-7; 2-5 Ivy, T-5th) Coach: George Seifert Game Captains Date Opponent .... W/L Score 9/18 PRINCETON .... L 0 -3 9/25 COLGATE ...... L 20 -25 10/2 atRutgers ...... L 14 -21 10/9 at Harvard ..... W 9 -3 10/16 B R O W N ....... L 12 -28 10/23 DARTMOUTH ... L 0 -35 10/30 atYale ........ L 6 -14 11/6 at Columbia .... L 17 -35 11/13 at Penn ....... W 31 -13 TOTALS 109 -177 1977 (1-8; 1-6 Ivy, T-7th) Coach: Bob Blackman Captains: Tony Anzalone, Terry Lee Date Opponent .... W/L Score 9/17 at Penn ....... L 7 -17 9/24 COLGATE ...... L 22 -28 10/1 RUTGERS ...... L 14 -30 10/8 HARVARD ...... L 7 -17 10/15 at Brown ...... L 3 -21 10/22 at Dartmouth ... L 13 -17 10/29 YALE .......... L 0 -28 11/5 COLUMBIA ..... W 20 -7 11/12 atPrinceton .... L 0 -34 TOTALS 86 -199

WWW .CORNELL B IG R ED . COM

1978 (5-3-1; 3-3-1 Ivy, 4th) Coach: Bob Blackman Captains: Mike Donahue, Dave Kintigh Date Opponent .... W/L Score 9/23 PRINCETON .... T 14 -14 9/30 at Colgate ..... W 21 -12 10/7 BUCKNELL ...... W 24 -0 10/14 at Harvard ..... W 25 -20 10/21 B R O W N ....... L 13 -21 10/28 DARTMOUTH ... L 7 -14 11/4 atYale ........ L 14 -42 11/11 at Columbia .... W 35 -14 11/18 PENN ......... W 35 -17 TOTALS 188 -154

1979 (5-4; 4-3 Ivy, T-4th) Coach: Bob Blackman Captains: Brad Decker, Jim DeStefano Date Opponent .... W/L Score 9/22 at Penn ....... W 52 -13 9/29 COLGATE ...... W 36 -21 10/6 BUCKNELL ...... L 0 -10 10/13 HARVARD ...... W 41 -14 10/20 at Brown ...... L 7 -28 10/27 at Dartmouth ... W 21 -10 11/3 YALE .......... L 20 -23 11/10 COLUMBIA ..... W 24 -7 11/17 atPrinceton .... L 14 -26 TOTALS 215 -152 1980 (5-5; 5-2 Ivy, 2nd) Coach: Bob Blackman Captains: Tom Rohlfing, Dan Scully Date Opponent .... W/L Score 9/20 PRINCETON .... W 17 -7 9/27 at Colgate ..... L 20 -38 10/4 RUTGERS ...... L 3 -44 10/11 at Harvard ..... L 12 -20 10/18 B R O W N ....... L 25 -32 10/25 DARTMOUTH ... W 7 -3 11/1 atBucknell ..... L 16 -33 11/8 atYale ........ W 24 -6

2005 FOOTBALL

11/15 at Columbia .... W 24 -0 11/22 PENN ......... W 31 -9 TOTALS 179 -192 1981 (3-7; 2-5 Ivy, T-5th) Coach: Bob Blackman Captains: Dave Kimichik, Steve Ross Date Opponent .... W/L Score 9/19 at Penn ....... L 22 -29 9/26 COLGATE ...... L 10 -34 10/3 atRutgers ...... L 17 -31 10/10 HARVARD ...... L 10 -27 10/17 at Brown ...... W 14 -9 10/24 at Dartmouth ... L 7 -42 10/31 BUCKNELL ...... W 22 -15 11/7 YALE .......... L 17 -23 11/14 COLUMBIA ..... W 15 -9 11/21 atPrinceton .... L 14 -37 TOTALS 148 -256 1982 (4-6; 3-4 Ivy, T-4th) Coach: Bob Blackman Captains: Steve Duca, Dan Suren Date Opponent .... W/L Score 9/18 PRINCETON .... L 36 -41 9/25 COLGATE ...... L 6 -21 10/2 BOSTON UNIVERSITY L 6 -17 10/9 at Harvard ..... L 13 -25 10/16 B R O W N ....... L 19 -38 10/23 DARTMOUTH ... L 13 -14 10/30 MERCHANT MARINE W 34 -0 11/5 atYale ........ W 26 -20 11/12 at Columbia .... W 35 -26 11/19 PENN ......... W 23 -0 TOTALS 211 -202 1983 (3-6-1; 3-3-1 Ivy, 5th) Coach: Maxie Baughan Captains:FrankFarace,MarkMiller, MikeScully Date Opponent .... W/L Score 9/17 at Penn ....... L 7 -28 9/24 COLGATE ...... L 7 -60 10/1 atCincinnati .... L 20 -48 10/8 HARVARD ...... T 3 -3 10/15 at Brown ...... L 3 -14 10/22 at Dartmouth ... L 17 -31 10/29 atBostonUniversity L 0 -41 11/5 YALE .......... W 41 -7 11/12 COLUMBIA ..... W 31 -6 11/19 atPrinceton .... W 32 -30 TOTALS 161 268 1984 (2-7; 2-5 Ivy, T-6th) Coach: Maxie Baughan Captains: Mark Miller, Scott Sidman, SteveGarrison,JohnTagliaferri Date Opponent .... W/L Score 9/22 PRINCETON .... L 9 -17 9/29 COLGATE ...... L 7 -35 10/6 atBucknell ..... L 7 -10 10/13 at Harvard ..... L 18 -24 10/20 B R O W N ....... L 9 -13 10/27 DARTMOUTH ... W 13 -10 11/3 atYale ........ L 14 -21 11/10 at Columbia .... W 19 -7 11/17 PENN ......... L 0 -24 TOTALS 96 -161 1985 (3-7; 2-5 Ivy, 7th) Coach: Maxie Baughan Captains:StuartMitchell,John Tagliaferri, Dave Van Metre Date Opponent .... W/L Score 9/21 at Penn ....... L 6 -10 9/28 COLGATE ...... L 20 -21 10/5 LAFAYETTE ..... L 3 -17 10/12 HARVARD ...... L 17 -20 10/19 at Brown ...... L 0 -22 10/26 DARTMOUTH ... L 17 -20 11/2 atBucknell ..... W 26 -13 11/9 atYale ........ W 20 -14 11/16 COLUMBIA ..... W 21 -8 11/23 atPrinceton .... L 27 -33 TOTALS 157 -178

AND

RECORDS

1986 (8-2; 6-1 Ivy, 2nd) Coach: Maxie Baughan Captains: Tom Bernardo, Ken Johnson, ErikBernstein Date Opponent .... W/L Score 9/20 PRINCETON .... W 39 -8 9/27 at Colgate ..... W 21 -12 10/4 atLafayette .... L 22 -33 10/11 Harvard ....... W 3 -0 10/18 B R O W N ....... W 27 -9 10/25 at Dartmouth ... W 10 -7 11/1 BUCKNELL ...... W 16 -3 11/8 YALE .......... W 15 -0 11/15 at Columbia .... W 28 -0 11/22 PENN ......... L 21 -31 TOTALS 202 -103

1991 (5-5; 4-3 Ivy, T-4th) Coach: Jim Hofher Captains: Mark Broderick, Greg Finnegan,ScottOliaro Date Opponent .... W/L Score 9/21 atPrinceton .... L 0 -18 9/28 COLGATE ...... L 13 -31 10/5 atBucknell ..... W 23 -7 10/12 atStanford ..... L 6 -56 10/19 HARVARD ...... W 22 -17 10/26 at Dartmouth ... L 25 -31 11/2 at Brown ...... W 20 -17 11/9 YALE .......... W 31 -6 11/16 COLUMBIA ..... W 28 -21 11/23 at Penn ....... L 13 -14 TOTALS 181 -218

1987 (5-5; 4-3 Ivy, T-4th) Coach: Maxie Baughan Captains: Lee Reherman, Gary Rinkus, Dave Quarles Date Opponent .... W/L Score 9/19 at Penn ....... W 17 -13 9/26 COLGATE ...... L 3 -27 10/3 LAFAYETTE ..... W 17 -12 10/10 HARVARD ...... W 29 -17 10/17 at Brown ...... L 15 -23 10/24 DARTMOUTH ... W 21 -14 10/31 BUCKNELL ...... L 6 -20 11/7 atYale ........ L 9 -28 11/14 COLUMBIA ..... W 31 -20 11/21 atPrinceton .... L 6 -23 TOTALS 154 -197

1992 (7-3; 4-3 Ivy, 4th) Coach: Jim Hofher Captains: John Massy, Scott Oliaro, JeffWoodring Date Opponent .... W/L Score 9/19 PRINCETON .... L 20 -22 9/26 LEHIGH ........ W 29 -23 10/3 LAFAYETTE ..... W 44 -33 10/10 at Harvard ..... W 31 -13 10/17 at Colgate ..... W 25 -7 10/24 DARTMOUTH ... W 26 -16 10/31 B R O W N ....... W 16 -6 11/7 atYale ........ W 35 -14 11/14 at Columbia .... L 30 -35 11/21 PENN ......... L 7 -14 TOTALS 263 -183

1988 (7-2-1; 6-1 Ivy, T-1st) Coach: Maxie Baughan Captains: Doug Langan, Scott Malaga, Mike McGrann Date Opponent .... W/L Score 9/17 PRINCETON .... L 17 -26 9/24 COLGATE ...... W 17 -14 10/1 atLehigh ...... L 14 -27 10/8 at Harvard ..... W 19 -17 10/15 B R O W N ....... W 35 -0 10/22 at Dartmouth ... W 24 -7 10/29 atLafayette .... T 21 -21 11/5 YALE .......... W 26 -0 11/12 at Columbia .... W 42 -19 11/19 PENN ......... W 19 -6 TOTALS 234 -137

1993 (4-6; 3-4 Ivy, T-4th) Coach: Jim Hofher Captains:BillLazor,ChrisZingo Date Opponent .... W/L Score 9 / 1 8 at .................. 1 2 18 9/25 ....................... 6 22 1 0 / 2 at ........................ 1 3 35 10/9 ...................... 27 0 10/16 .................... 48 6 1 0 / 2 3 at .............. 2 7 28 1 0 / 3 0 at ........................ 21 3 11/6 .................................. 21 0 11/13 .................... 24 29 1 1 / 2 0 at ............................ 1 4 17 2 1 3 158

1989 (4-6; 2-5 Ivy, T-5th) Coach: Jack Fouts Captains: Drew Fraser, Mitch Lee Date Opponent .... W/L Score 9/23 atBucknell ..... W 20 -9 9/30 NORTHEASTERN . L 0 -20 10/7 LAFAYETTE ..... W 24 -23 10/14 HARVARD ...... W 28 -0 10/21 at Brown ...... L 7 -28 10/28 DARTMOUTH ... L 14 -28 11/4 atYale ........ L 19 -34 11/11 COLUMBIA ..... L 19 -25 11/18 atPrinceton .... L 7 -21 11/23 at Penn ....... W 20 -6 TOTALS 158 -194

1994 (6-4; 3-4 Ivy, T-4th) Coach: Jim Hofher Captains: Dick Emmet, Terry Golden, Mike McKean, John Vitullo Date Opponent .... W/L Score 9/17 PRINCETON .... W 31 -16 9/24 at Fordham ..... W 13 -6 10/1 LEHIGH ........ W 21 -17 10/8 at Harvard ..... W 18 -13 10/15 atBucknell ..... W 29 -28 10/22 DARTMOUTH ... W 17 -14 10/29 B R O W N ....... L 3 -16 11/5 atYale ........ L 14 -24 11/12 at Columbia .... L 33 -38 11/19 PENN ......... L 14 -18 TOTALS 193 -190

1990 (7-3; 6-1 Ivy, T-1st) Coach: Jim Hofher Captains: Chris Cochrane, Rob Ryder, PaulTully Date Opponent .... W/L Score 9/15 PRINCETON .... W 17 -14 9/22 at Colgate ..... L 24 -59 9/29 BUCKNELL ...... L 21 -42 10/6 at Harvard ..... W 20 -17 10/13 atLafayette .... W 38 -16 10/20 DARTMOUTH ... L 6 -11 10/27 B R O W N ....... W 34 -7 11/3 atYale ........ W 41 -31 11/10 at Columbia .... W 41 -0 11/17 PENN ......... W 21 -15 TOTALS 263 -212

1995 (6-4; 5-2 Ivy, T-2nd) Coach: Jim Hofher Captains: Greg Bloedorn, Doug Knopp,JohnVitullo Date Opponent .... W/L Score 9/16 atPrinceton .... L 22 -24 9/23 HOLY CROSS ... W 28 -19 9/30 at Dartmouth ... W 24 -19 10/7 HARVARD ...... W 28 -27 10/14 BUCKNELL ...... L 7 -10 10/21 atLehigh ...... L 23 -34 10/28 at Brown ...... W 38 -28 11/4 YALE .......... W 38 -10 11/11 COLUMBIA ..... W 35 -14 11/18 at Penn ....... L 18 -37 TOTALS 261 -222

HISTORY

AND

RECORDS

1996 (4-6; 4-3 Ivy, T-3rd) Coach: Jim Hofher Captains: Steve Busch, Chad Levitt, Seth Payne, Brian Weidel Date Opponent .... W/L Score 9/21 PRINCETON (2OT) W 33 -27 9/28 atLafayette .... L 19 -30 10/5 atBuffalo ...... L 24 -41 10/12 at Harvard ..... W 20 -13 10/19 COLGATE ...... L 21 -31 10/26 DARTMOUTH ... L 21 -38 11/2 B R O W N ....... L 21 -35 11/9 atYale ........ W 28 -20 11/16 at Columbia .... L 10 -24 11/23 PENN ......... W 24 -21 TOTALS 221 -280 1997 (6-4; 4-3 Ivy, T-3rd) Coach: Jim Hofher Captains:ChrisAllen,JustinBird,Scott Carroll,EricKrawczyk,RichSheerin Date Opponent .... W/L Score 9/20 PRINCETON .... W 14 -10 9/27 COLGATE (OT) .. L 38 -44 10/4 at Dartmouth ... L 20 -24 10/11 HARVARD ...... L 9 -34 10/18 LAFAYETTE (2OT) . W 41 -34 10/25 at Fordham ..... W 45 -13 11/1 at Brown ...... L 12 -37 11/8 YALE .......... W 37 -10 11/15 COLUMBIA ..... W 33 -22 11/22 at Penn ...... W + 20 -33 TOTALS 269 -261 +Penn forfeited game due to use of an ineligibleplayer 1998 (4-6; 1-6 Ivy, T-7th) Coach: Pete Mangurian Captains: John Hanson, Mike Hood Date Opponent .... W/L Score 9/19 atPrinceton .... L 0 -6 9/26 at Holy Cross ... W 17 -9

10/3 BUFFALO ...... 10/10 at Harvard ..... 10/17 BUCKNELL ...... 10/24 DARTMOUTH ... 10/31 B R O W N ....... 11/7 atYale ........ 11/14 at Columbia .... 11/21 PENN ......... TOTALS

W L W W L L L L

34 -31 12 -19 23 -19 14 -11 7 -20 21 -28 10 -22 21 -35 159 -200

1999 (7-3; 5-2 Ivy, 3rd) Coach: Pete Mangurian Captains: Nate Fischer, Deon Harris Date Opponent .... W/L Score 9/18 atPrinceton .... W 20 -3 9/25 FORDHAM ..... W 42 -14 10/2 at Brown ...... W 33 -28 10/9 HARVARD ...... W 24 -23 10/16 at Colgate ..... L 16 -55 10/23 at Dartmouth ... L 17 -20 10/30 WAGNER ...... W 31 -14 11/6 atYale ........ L 20 -37 11/13 COLUMBIA ..... W 31 -29 11/20 at Penn ....... W 20 -12 TOTALS 254 -235 2000 (5-5, 5-2 Ivy, 2nd) Coach: Pete Mangurian Captains: JoeSplendorio,DanWeyandt Date Opponent .... W/L Score 9/16 atBucknell ..... L 15 -38 9/23 YALE .......... W 24 -23 9/30 atLehigh ...... L 16 -35 10/7 at Harvard ..... W 29 -28 10/14 COLGATE ...... L 16 -23 10/21 at Brown ...... L 40 -56 10/28 PRINCETON .... W 25 -24 11/4 DARTMOUTH ... W 49 -31 11/11 at Columbia .... W 35 -31 11/18 PENN ......... L 15 -45 TOTALS 264 -334

2001 (2-7, 2-5 Ivy, 6th) Coach: Tim Pendergast Captains: JustinDunleavy,Ricky Rahne, Nate Spitler Date Opponent .... W/L Score 9/15 Bucknell(cancelled) 9/22 atYale ........ L 13 -40 9/29 at Colgate ..... L 32 -35 10/6 LEHIGH ........ L 35 -38 10/13 HARVARD ...... L 6 -26 10/20 B R O W N ....... L 21 -49 10/27 at Princeton .... W 10 -7 11/3 at Dartmouth ... W 28 -24 11/10 COLUMBIA ..... L 28 -35 11/17 at Penn ....... L 14 -38 TOTALS 187 -292 * Bucknell game cancelled due to the attack on America on Sept. 11 2002 (4-6; 3-4 Ivy, 5th) Coach: Tim Pendergast Captains: Nate Spitler, Nathan Archer Date Opponent .... W/L Score 9/21 atBucknell ..... L 3 -14 9/28 YALE .......... L 23 -50 10/5 TOWSON (2OT) . W 34 -31 10/12 at Harvard ..... L 23 -52 10/19 COLGATE ...... L 13 -42 10/26 at Brown (2OT) .. W 10 -7 11/2 PRINCETON (OT) . L 25 -32 11/9 DARTMOUTH ... W 21 -19 11/16 at Columbia .... W 17 -14 11/23 PENN ......... L 0 -31 TOTALS 169 -292 2003 (1-9, 0-7 Ivy, 8th) Coach: Tim Pendergast Captains: Mick Razzano, Kevin Rooney Date Opponent .... W/L Score 9/20 BUCKNELL ...... W 21 -19 9/27 atYale ........ L 7 -21 10/4 COLGATE ...... L 24 -27

10/11 HARVARD ...... 10/18 GEORGETOWN .. 10/25 B R O W N ....... 11/1 atPrinceton .... 11/8 at Dartmouth ... 11/15 COLUMBIA ..... 11/22 at Penn ....... TOTALS

L 0 -27 L 20 -42 L 7 -21 L 6 -28 L 17 -26 L 21 -34 L 7 -59 130 -304

2004 (4-6, 4-3 Ivy, 3rd) Coach: Jim Knowles Captains: Dave Archer, Brad Kitlowski, Ryan Lempa Date Opponent .... W/L Score 9/18 atBucknell ..... L 9 -15 9/25 YALE .......... W 19 -7 10/2 at Towson ..... L 11 -21 10/9 at Harvard ..... L 24 -34 10/16 COLGATE ...... L 6 -10 10/23 at Brown ...... L 17 -21 10/30 PRINCETON .... W 21 -20 11/6 DARTMOUTH ... W 14 -7 11/13 at Columbia .... W 32 -26 11/20 PENN ......... L 14 -20 TOTALS 167 -181 National Champions Key * — according to Helms Athletic Foundation, Houlgate System, National Championship Foundation and Parke Davis. ** — according to Helms Athletic Foundation, Houlgate System, National Championship Foundation and Parke Davis. *** — according to Helms Athletic Foundation and Parke Davis. **** — according to Sagarin. ***** — according to Sagarin and Litkenhous.

Cornell Head Coaches • 1894-2004 Coach

Seasons

Years

W -L -T -19 -8 -3 -13 -5 -4 -3 -3 -4 -5 -21 -5 -36 -26 -7 -58 -23 -33 -15 -33 -29 -6 -35 -14 -22 -6

-1 ..... -2 ..... -1 ..... -3 ..... -0 ..... -0 ..... -1 ..... -1 ..... -1 ..... -1 ..... -1 ..... -0 ..... -7 ..... -3 ..... -1 ..... -2 ..... -3 ..... -3 ..... -0 ..... -1 ..... -2 ..... -0 ..... -0 ..... -0 ..... -0 ..... -0 .....

Pct. .658 .473 .555 .721 .772 .826 .600 .789 .375 .666 .607 .375 .650 .613 .555 .544 .422 .555 .167 .412 .492 .400 .563 .533 .241 .400

TOTALS .............. 1887-present ..... 118 .. 594 -436-34 ... .574 Note: During the first seven years of Cornell football, the teams were coached informally by players and volunteers.

By Seasons 1. Gil Dobie (1920-35) ................... 16 2. Lefty James (1947-60) .................. 14 3. Jack Musick (1966-74) ................... 9 By Games 1. Lefty James (1947-60) ................. 126 2. Gil Dobie (1920-35) .................. 125 3. Jack Musick (1966-74) .................. 81 By Wins 1. Gil Dobie (1920-35) ................... 82 2. Lefty James (1947-60) .................. 66 3. Carl Snavely (1936-44) ................. 46 By Losses 1. Lefty James (1947-60) .................. 58 2. Gil Dobie (1920-35) ................... 36 3. Jim Hofher (1990-97) .................. 35 By Winning Percentage 1. Raymond Starbuck (1901-02) ........... .826 2. Henry Schoellkopf (1907-08) ............ .789 3. Percy Haughton (1899-1900) ............ .772 By Ivy League Wins 1. Jim Hofher (1990-97) .................. 33 2. Jack Musick (1966-74) .................. 30 3. Maxie Baughan (1983-88) ............... 23 By Ivy League Winning Percentage 1. Jim Hofher (1990-97) (33-23) ........... .589 2. Maxie Baughan (1983-88) (23-18-1) ...... .560 3. Pete Mangurian (1998-00) (11-10) ....... .523

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

No Coach ............. 1887-1893 ........ 7 .... 37 Marshall Newell ........ 1894-95 .......... 2 ..... 9 Joseph Beacham ........ 1896 ............ 1 ..... 5 Glenn (Pop) Warner ..... 1897-98, 1904-06 ... 5 .... 36 Percy Haughton ........ 1899-1900 ........ 2 .... 17 Raymond Starbuck ...... 1901-02 .......... 2 .... 19 William Warner ........ 1903 ............ 1 ..... 6 Henry Schoellkopf ....... 1907-08 .......... 2 .... 15 George Walder ........ 1909 ............ 1 ..... 3 Daniel Reed ........... 1910-11 .......... 2 .... 12 Al Sharpe ............. 1912-17 .......... 6 .... 34 John Rush ............. 1919 ............ 1 ..... 3 Gil Dobie ............. 1920-35 ......... 16 .... 82 Carl Snavely ........... 1936-44 .......... 9 .... 46 Ed McKeever .......... 1945-46 .......... 2 .... 10 George (Lefty) James .... 1947-60 ......... 14 .... 66 Tom Harp ............ 1961-65 .......... 5 .... 19 Jack Musick ............ 1966-74 .......... 9 .... 45 George Seifert ......... 1975-76 .......... 2 ..... 3 Bob Blackman .......... 1977-82 .......... 6 .... 23 Maxie Baughan ........ 1983-88 .......... 6 .... 28 JackFouts ............. 1989 ............ 1 ..... 4 Jim Hofher ............ 1990-97 .......... 8 .... 45 Pete Mangurian ........ 1998-2000 ........ 3 .... 16 Tim Pendergast ........ 2001-2003 ........ 3 ..... 7 Jim Knowles ........... 2004-present ...... 1 ..... 4

HISTORY

AND

RECORDS

All-America Selections (First-Team selections in bold) Year 1895 1900 1901 1902 1906 1908 1914 1915 1921 1922 1923 1932 1936 1937 1938

1939

1940

Player,Pos. ....... Team Clint Wyckoff, QB .... 1st Ray Starbuck, FB ..... 1st Bill Warner, G ....... 1st Sanford Hunt, G ..... 1st Bill Warner, G ....... 1st Elmer Thompson, G ... 1st Bill Newman, C ...... 1st Bernie O’Rourke, G ... 1st John O’Hearn, E ...... 1st Charles Barrett, QB ... 1st Charles Barrett, QB ... 1st Murray Shelton, E .... 1st Eddie Kaw, HB ....... 1st Eddie Kaw, FB ....... 1st George Pfann, QB .... 1st Frank Sundstrom, T ... 1st JoseMartinez-Zorrilla,E 1st George Peck, B ...... H M Brud Holland, E ...... 1st Al VanRanst, T ...... H M Brud Holland, E ...... 1st Bill McKeever, T ..... 1st Sid Roth, G ......... 1st George Peck, B ...... H M Carl Spang, E ....... H M Nick Drahos, T ...... 1st Frank Finneran, C .... 3rd KirkHershey,E ...... H M Mort Landsberg, B ... H M Nick Drahos, T ...... 1st KirkHershey,E ...... H M AlvaKelley,E ....... H M

Year 1941

1942 1943 1944 1946

1947 1948

1949

1951

Player,Pos. ....... Team Mort Landsberg, B ... H M Lou Bufalino, B ...... H M Bud Cushing, C ..... H M Roy Johnson, E ...... H M Joe Martin, B ....... H M Ken Stofer, B ....... H M WalterKretz,B ...... H M Howard Blose, B ..... H M Cleo Calcagni, T ..... H M Bill Maceyko, B ...... H M Allen Dekdebrun, B ... H M Paul Robeson Jr., E ... H M Frank Wydo, OT ..... 3rd HillaryChollet,DB .... H M Lou Daukas, C ...... H M JoeDiStasio,E ....... H M WalterKretz,B ...... H M Joe Martin, B ....... H M Pete Pascavage, OG .. H M Norm Dawson, B .... H M HillaryChollet,DB .... H M Dick Clark, T ........ H M Jeff Fleishmann, FB ... H M Paul Girolamo, B ..... H M Joe Quinn, G ....... H M HillaryChollet,DB .... 2nd Dick Clark, T ........ H M Pete Dorset, QB ..... H M Jeff Fleishmann, FB ... H M Jack Jaso, OG ....... H M Dick Loynd, E ....... H M Rocco Calvo, B ...... H M

Year

1954 1955 1957 1958 1959 1960 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972

Player,Pos. ....... Team Jim Jerome, T ....... H M Todd Kolb, E ....... H M Charles Metzler, T .... H M Hal Seidenberg, B .... H M Bill Whelan, HB ...... H M Len Oniskey, T ...... H M Bill DeGraaf, QB ..... H M StanIntihar,E ....... H M Bob McAniff, HB ..... H M Norm Juvonen, E .... H M Ed Savitsky, G ....... H M Dave Feeney, G ..... H M Warren Sundstrom, G . H M Warren Sundstrom, G . H M Gary Wood, QB ..... H M Gary Wood, QB ..... H M Bob Baker, HB ...... H M Duke Grkovic, T ..... H M PhilRatner,DT ...... H M PhilRatner,DT ...... H M BillWilson,FB ....... H M Pete Larson, HB ..... H M Keith Cummins, DB .. H M Bill Murphy, E ....... H M John Sponheimer, DT . H M Doug Kleiber, LB ..... H M John Sponheimer, DT . H M Ed Marinaro, TB ..... 3rd Ed Marinaro, TB ..... 1st Ed Marinaro, TB ..... 1st Bob Lally, LB ....... H M Bob Lally, LB ....... H M

Asa S. Bushnell Cup Winners Ivy League Player of the Year

1970

1971 1983

Ed Marinaro, TB (1970, 71)

Derrick Harmon, TB (1983)

1996

Year 1973 1975 1978 1980 1982 1983 1984 1985 1986

1987 1988 1989 1992 1993 1995 1996 1998 2000

Player,Pos. ....... Team Bob Lally, LB ....... H M Steve Horrigan, MG ... H M Joe Holland, TB ..... 3rd Jim DeStefano, LB .... H M Todd Florey, DB ..... H M John Kilcoyne, C ..... H M Dan Suren, TE ....... 1st Derrick Harmon, TB .. 2nd Mike Scully, LB ...... H M Tony Baker, TB ...... H M Ken Johnson, OG .... H M Tom McHale, DE ..... 1st ErikBernstein,P ..... H M Ken Johnson, OG .... H M Mike Raich, DB ...... H M Sam Brickley, WR .... H M Mike Raich, DB ...... H M Mitch Lee, LB ....... 3rd Sam Brickley, WR .... H M Scott Malaga, RB .... H M Mitch Lee, LB ....... 3rd Chris Zingo, LB ...... 1st Chris Zingo, LB ...... 1st Greg Bloedorn, OC ... 2nd Chad Levitt, RB ...... 2nd Chad Levitt, RB ...... 1st John Hanson, LB ..... 1st Tom Nunes, SS ..... 2nd Ricky Rahne, QB ..... H M

First-teamselectionsinbold

Ivy League Rookie of the Year Year 1981 1989

Player, Pos. Derrick Harmon, TB John McNiff, RB

Chad Levitt, TB (1996)

All-Ivy First-Team Selections Year 1955

WWW .CORNELL B IG R ED . COM

1956 1957 1958

1959 1962 1963 1964

1965 1966

1967 1968 1969

Player,Pos. StanIntihar,E Bill DeGraaf, QB Art Boland, HB Bob McAniff, HB Ed Savitsky, G Norm Juvonen, E Dave Feeney, G Gary Wood, HB Gary Wood, HB Clarence Jentes, DG PhilRatner,DT George Norman, DE Bob Baker, HB Joe Ryan, C George Arangio, OG Dick Williams, OE PhilRatner,DT BillWilson,FB Pete Larson, HB George McWeeney, OG Reeve Vanneman, OT Ron Gervase, OE Bill Murphy, OE John Sponheimer, DT John Sponheimer, DT BillArthur,P Paul Marcucci, OT Dennis Huff, OG Theo Jacobs, DG Ed Marinaro, HB

2005 FOOTBALL

Year 1970 1971

1972 1973 1974 1975 1977 1978 1979 1980 1981 1982

1983

Player,Pos. Ed Marinaro, HB Ed Marinaro, HB Craig Lambert, OT Don Jean, DB Bob Lally, LB Bob Lally, LB Bob Joehl, FB MikePhillips,LB Mike Phillips, MG Bob Lally, LB BruceStarks,SE Bob Hall, DT Steve Horrigan, MG Terry Lee, LB Joe Holland, TB VirgilCotton,DB Brad Decker, TE Tom Donnelly, OG Mike Cobb, DB John Kilcoyne, C Jim DeStefano, LB Todd Florey, DB Phil Loyd, DS Dan Suren, TE Derrick Harmon, TB Steve Duca, DT Scott Walter, DB Derrick Harmon, TB Ralph Scholz, DT Mike Scully, LB

Year 1984 1985 1986

1987

1988

1989 1990

Player,Pos. Rick Dailey, DB Tony Baker, TB Keith Bakowski, LB Ken Johnson, OG Mike Wagner, C Tom Aug, PK ErikBernstein,P Jim Frontero, DB Jeff Johnson, FB Ken Johnson, OG Ward Johnson, LB Tom McHale, DE Mike Raich, DB Gary Rinkus, DT Sam Brickley, WR JeffDeLamielleure,DB Lee Reherman, OT Mike Raich, DB Gary Rinkus, DT Sam Brickley, WR Scott Malaga, RB Mitch Lee, LB Mike McGrann, LB Evan Parke, DB Jay Bloedorn, OT Mitch Lee, MLB Jay Bloedorn, OT Chris Field, OG Greg Finnegan, C John McNiff, TB

Year 1991 1992

1993 1994 1995

1996 1997 1998 1999 2002 2003 2004

Player,Pos. Tim Cronin, DT Kevin Marcus, DT Ramon Watkins, DB Troy Thompson, C Jeff Woodring, DE Chris Zingo, LB Steve Haggerty, FS Geoff Cochrane, P Chris Zingo, LB Aaron Berryman, WR Chris Hanson, DB Chad Levitt, RB Greg Bloedorn, OC Nick Bombach, DB Chad Levitt, RB Ron Mateo, WR JimmySeifert,TE Chad Levitt, RB Seth Payne, DE Brian Weidel, OT Eric Krawczyk, WR John Hanson, LB Joe Splendorio, WR Nathan Archer, FB Pete Combe, DL Kevin Boothe, OL Kevin Boothe, OL

HISTORY

AND

RECORDS

All-Ivy Second-Team Selections Year 1956 1958 1959 1960 1961 1962 1964 1965 1969 1970 1972 1973 1974 1975 1976

Player,Pos. Gerry Knapp, E Irv Roberson, B Tom Skypeck, QB John Sadusky, E Warren Sundstrom, G George Telesh, B Dave Thomas, G Ed Burnap, E Gerald Page, G Edward Slisky, T Clarence Jentes, G George Norman, E PhilRatner,T PhilRatner,T BillArthur,B Keith Cummins, DB JohnKillian,PK Rick Furbush, B Don Jean, DB JohnKillian,PK Mark Allen, QB Peter Knight, DB George Milosevic, E Mark Allen, B Jon Tracosas, LB Mark Kamon, OL Don Papich, LB Terry Lee, LB Eamon McEneaney, WR

Year 1978

1979 1980 1981 1982 1983 1984 1985

1986

1987 1988

Player,Pos. Joe Meaney, OL Mike Donahue, OL Tom Donnelly, OL Tom Roth, DL Frank Santamaria, OL Paul DeJesus, OL Tom Rohlfing, OL Dave Chalk, DL Ben Tenuta, RB Steve Ross, OL Kurt Walterhouse, LB Paul Michalewicz, OL Mike Scully, LB Gene Edwards, OL Doug Pratt, OL Bob DeSantis, DL Frank Farace, DB JimPerrello,WR Mike Raich, DB JohnTagliaferri,RB Dave Van Metre, DL Tom Bernardo, LB Chris Hahn, WR Jim Knowles, DL Lee Reherman, OL Shaun Hawkins, WR Mike McGrann, LB Howie Capek, OL Mike Haseltine, OL

Year

1989 1990

1991

1992

1993

1994

Player,Pos. Doug Langan, OL Ardrell Mannings, DL Len Tokish, LB Corky Webb, DB DerrickWillmott,DL BrianFiles,DL Rob Ryder, DL Paul Tully, DB Mark Broderick, LB ScottOliaro,RB Paul Tully, DB GerryWillinger,DB Mike Jamin, WR Jason Jenkins, OL Scott Reade, OL Jeff Woodring, DL Chris Zingo, LB Mike Cochrane, PK Mike Jamin, WR ScottOliaro,RB Scott Reade, OL PeteFitzpatrick,RB Bob Garvey, DL Rich George, OL Terry Golden, DB Bryan Draga, LB Dick Emmet, DL JeffGilkinson,OL Mike McKean, OL

Year 1995

1996 1997

1998 1999 2001 2002

2004

Player,Pos. Seth Payne, DL Steve Gettins, OL Brian Gormley, OL Steve Joyce, QB Seth Payne, DL JohnVitullo,LB Steve Busch, WR John Hanson, LB Eric Krawczyk, WR Tom Bickett, OL ChristianDiPaola,OL Matthew DiPaola, OL John Hanson, LB Brad Kiesendahl, RB Deon Harris, RB Tom Nunes, SS Joe Splendorio, WR David Caputo, SS David Pitman, LB GeorgeParaskevopoulos,DL Kevin Boothe, OL Keith Ferguson, WR Trevor MacMeekin, PK NateSpitler,LB Joel Sussman, LB Ryan Lempa, DL Kevin Rex, S

All-Ivy Honorable Mention Selections Year 1956 1957 1958

1959

1960 1963 1964 1965

1966

1967

Year 1968

1969 1970 1971 1972 1973 1974

1975 1976 1978 1979

1980

1981

Player,Pos. Keith Cummins, DB Doug Kleiber, LB Bob Pegan, E ChrisRitter,B Ken Snyder, C Jack Cushing, OT BillEllis,DE Tom Albright, B Mark Allen, B Tom Rakowski, DL Paul Hanly, OL JimPopielinski,OL John Egan, P Steve Horrigan, DL Dave Johnson, DB Rick Johnson, DL Dan Malone, B KevinSigler,B Don Wierbinski, TE Joe Meaney, OL Dave Johnson, DB Jim DeStefano, LB Mike Johnson, DE Ron Rejda, PK Dan Scully, LB Mike Staun, LB Tom Weidenkopf, SB Mark Chenevey, OG Dave Kimichik, DB Ron Rejda, PK Tom Rohlfing, OC Steve Duca, DT Derrick Harmon, RB John Lewis, OG

Year

1982 1983 1984 1985

1986 1989 1990

1991

1992

1993 1994

Player,Pos. Ken Rubenstein, PK Mike Scully, LB Dan Suren, TE Tony Baker, SB Kevin McCarthy, DE BillMorrissey,OT Steve Garrison, TE Mike Wagner, OL John Passalacqua, DL ErikBernstein,P Rick George, OL Lyndon Gross, DB Ward Johnson, LB Shaun Hawkins, WR Marty Stallone, QB Greg Finnegan, OL John McNiff, RB Chris Cochrane, QB Matt Hepfer, PK Ardell Mannings, DL Don Printy, LB Rob Ryder, DL Mark Broderick, LB Mike Cochrane, PK Greg Knopp, DB John McNiff, RB Jack Dankert, DL BillLazor,QB Ethan Levitas, DB RonVitullo,LB Aaron Berryman, WR Ryan Blattenberger, DB Mike McKean, OL Greg Bloedorn, OL

Year

1995

1997 1998 1999 2000

2001 2002 2003

2004

Player,Pos. GarrettGardi,DB Doug Knopp, DB JohnVitullo,LB Dave Weinstein, OL David Woods, DL Steve Bus, DL John Hanson, LB Doug Knopp, DB Mahingus Silver, DL Mark Dittman, TE Rich Sheerin, DL Charles Watson, P Nate Fischer, LB Chris Morosetti, OL Ricky Rahne, QB Justin Dunleavy, RB Scott Fithen, OL Ricky Rahne, QB Joe Splendorio, WR Dan Weyandt, LB JamieMoriarty,S Evan Simmons, RB NateSpitler,LB Marcus Blanks, RB BradKitlowski,LB Mike Baumgartel, P BradKitlowski,LB Ryan Lempa, DL John Megaro, OL NeilMorrissey,S Sean Nassoiy, DB Brian Romney, WR

Academic All-America Hall of Fame Player, Pos. Year Inducted Joseph Holland â&#x20AC;&#x2DC;78 ............... 1991

Academic All-America Selections Year 1977 1978 1982 1983

Player, Pos. Team Joe Holland, TB ............ 1st Joe Holland, TB ............ 1st Derrick Harmon, RB ........ 1st Mike Cahill ............... 2nd

Year 1983 1984 1985 1991

Player, Pos. Team Derrick Harmon, RB ........ 1st Dave Van Metre, DL ........ 2nd Dave Van Metre, DL ........ 1st Ramon Watkins, DB ......... 2nd

Year 1995 2003

Player, Pos. Team Ron Mateo, WR ............ 2nd Kevin Rooney, DL .......... 1st

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Player,Pos. Roger Garrett, T Thomas Itin, G AlSuter,G Bob Czub, G Roger Garrett, T Norm Juvonen, E Dave Feeney, G John Hanly, G Tom Revak, T John Sandusky, E PhilTaylor,B John Webster, B Terrance Wilson, B John Hanly, T Tom Revak, T Warren Sundstrom, G PhilTaylor,B George Telesh, B John Hanly, T RichardLipinski,C Clarence Jentes, DG Gene Kunit, G Jim Docherty, B Pete Larson, HB Marty Sponaugle, B Doug Zirkle, E Fred Devlin, LB Joe Homicz, G CharlesRoll,C John Wallace, T John Zankowski, B Pete Zogby, PK Doug Kleiber, LB Dick Musmanno, G

HISTORY

AND

RECORDS

National Football Hall of Fame Cornellians in National Football Hall of Fame Name Eddie Kaw George Pfann CharlesBarrett Jerome “Brud” Holland Clinton Wyckoff William Warner John O’Hearn Murray Shelton Frank Sundstrom Nick Drahos Ed Marinaro

Position Halfback Quarterback Quarterback End Quarterback Guard End End Tackle Tackle Tailback

Years Played 1920-1922 1921-1923 1913-1915 1936-1938 1893-1895 1899-1902 1912-1914 1913-1915 1921-1923 1938-1940 1969-1971

Date of Election 1954 1957 1958 1965 1970 1971 1972 1973 1978 1981 1991

Eddie Kaw

Cornell Coaches In National Football Hall of Fame Name Percy Haughton Glenn S. (Pop) Warner Gil Dobie Marshall Newell CarlSnavely Bob Blackman Maxie Baughan

Years Coached 1899-1900 1897-1898, 1904-1906 1920-1935 1894-1895 1936-1944 1977-1982 1983-1988

Date of Election 1951 1951 1954 1957 1965 1987 1988

Glenn (Pop) Warner

Cornell Athletic Hall of Fame

WWW .CORNELL B IG R ED . COM

Started in 1978, the Cornell Athletic Hall of Fame now has 463 members. The Big Red football program has 131 former players and coaches in the Hall. The following people, in alphabetical order, represent the football program. Charter members are indicated with an asterisk.

Name, Yr. Year Inducted Mark Allen ’74 ......... 1988 John Anderson ’29 ....... 1978 Allan Balch 1889 ........ 1987 *Charles Barrett ’16 ..... 1978 ErikBernstein‘87 ....... 1999 Art Boland ’57 ......... 1980 Frank Bradley ’50 ....... 2001 George Brayman ’22 ..... 1984 Walt Bruska ’50 ......... 1994 Rocco Calvo ’52 ........ 1997 Emerson Carey ’27 ...... 1994 Charles Cassidy ’24 ..... 1984 *HillaryChollet’50 ...... 1978 Dick Clark ’51 .......... 1983 Carlton Collins ’16 ...... 1982 Lou Conti ’41 .......... 1983 Gib Cool ’16 ........... 1981 Meredith (Bud) Cushing ’44 . 1998 Lou Daukas ’44 ......... 1994 Norm Dawson ’46 ...... 1987 Bob Dean ’49 .......... 1986 *Bill DeGraaf ’56 ....... 1978 Allen Dekdebrun ’47 ..... 1982 Jim DeStefano ‘81 ....... 2003 Gil Dobie, Coach ....... 1980 Pete Dorset ’50 ......... 1981 Nick Drahos ’41 ........ 1979 Howard Dunbar ’41 ..... 1983 Dave Dunlop ’59 ....... 1991 Tom Fennell 1896 ....... 1987 Tom Fennell II ’26 ....... 1989 *John Ferraro ’34 ....... 1978 Bud Finneran ’41 ....... 1981

2005 FOOTBALL

Name, Yr. Year Inducted Jeff Fleischmann ’51 ..... 1980 John Furman ’39 ........ 1993 Abe George ’33 ........ 1988 Henry Godshall ’36 ...... 1987 Pete Gogolak ’64 ....... 1981 Jake Goldbas ’34 ....... 1996 Rip Haley ’51 .......... 1981 Neal Hall ’78 .......... 1984 Swede Hanson ’23 ...... 1980 Derrick Harmon ’84 ..... 1989 Frank Henderson ’25 ..... 1983 Bob Henrickson ’78 ...... 1985 *Brud Holland ’39 ....... 1978 Joe Holland ’78 ......... 1990 Dick Jackson ’56 ........ 1981 Craig Jaeger ’78 ........ 1996 Lefty James, Coach ...... 1981 John(Jack)JasoJr.’49 .... 2004 Dave Johnson ’77 ....... 1988 *Eddie Kaw ’23 ........ 1978 Alva Kelley ’41 ......... 1980 Walt Kretz ‘48 ......... 2000 Bob Lally ’74 ........... 1982 Mort Landsberg Jr. ‘41 ... 2004 Pete Larson ’67 ......... 1984 Mitch Lee ’90 .......... 2001 Dick Loynd ’50 ......... 1983 Charles Lueder ’02 ...... 1987 *James Lynah ’05 ....... 1978 *Tom MacLeod ’70 ...... 1978 Scott Malaga ‘89 ....... 1999 *Ed Marinaro ’72 ....... 1978 Bill Marino ’76 ......... 1990

Name, Yr. Year Inducted CristobalMartinez-Zorrilla’31 1984 Jose Martinez-Zorrilla ’33 . 1981 Walt Matuszak ’41 ...... 1979 Hal McCullough ’41 ..... 1980 Eamon McEneaney ’77 ... 1982 Tom McHale ’87 ........ 1993 *Bill McKeever ’39 ...... 1978 *John McKeown ’73 ..... 1978 Dick Meade ’56 ........ 1979 Frank Miller ’51 ........ 1985 Peter Paul Miller ’18 ..... 1987 Jack Morris ’55 ......... 1989 Bill Murphy ’68 ......... 1988 Bill Murray ’74 ......... 1988 Jack Musick, Coach ...... 2002 *William Newman ’07 ... 1978 *John O’Hearn ’15 ...... 1978 Len Oniskey ’55 ........ 1998 Bruce Pattison ’69 ....... 1983 George Peck ’39 ........ 1984 Pat Pennucci ’62 ........ 2002 *George Pfann ’24 ...... 1978 Mike Phillips ’74 ........ 1984 JohnPierik’51 .......... 1982 Joe Quinn ’49 .......... 1992 Dick Ramin ‘51 ......... 2000 Floyd Ramsey ’24 ....... 1985 Phil Ratner ’66 ......... 1997 Daniel Reed 1898 ....... 1983 *Irvin (Bo) Roberson ’58 .. 1978 Paul Robeson Jr. ’48 ..... 1998 Jack Rogers ’45 ......... 1988 Sid Roth ’39 ........... 1980

Name, Yr. Year Inducted Harvey Sampson ‘51 ..... 1999 Ed Savitsky ’59 ......... 1990 Dudley Schoales ’29 ..... 1983 *Henry Schoellkopf ’02 ... 1978 Walt Scholl ’41 ......... 1979 Mike Scully ’84 ......... 2002 Dr. Albert Sharpe, Coach . 1984 *Murray Shelton ’16 ..... 1978 FrancisShiverick’18 ..... 1987 John Skawski ’48 ........ 1991 Bob Smith ’68 .......... 1993 Carl Snavely, Coach ..... 1979 Carl Spang ’39 ......... 1986 John Sponheimer ‘69 .... 2005 Ray Starbuck 1900 ...... 1987 *Frank Sundstrom ’24 .... 1978 Dave Thomas ‘62 ....... 2005 Ted Thoren, Asst. Coach .. 1992 Ray Van Orman ’08 ..... 1982 Al Van Ranst ’39 ........ 1987 Reeve Vanneman ‘67 .... 2003 *Bart Viviano ’33 ....... 1978 Sam Wakeman ’30 ...... 1982 Glenn (Pop) Warner 1894 . 1979 *William Warner ’03 ..... 1978 Fred West ’41 .......... 1985 Bill Whelan ’53 ......... 1983 George Witherbee 1894 .. 1997 Gary Wood ’64 ......... 1979 *Clinton Wyckoff 1896 ... 1978 Tar Young 1899 ........ 1980 Chris Zingo ’94 ......... 2004

HISTORY

AND

RECORDS

Team Awards Pop Warner Most Valuable Player Award

Victor Grohmann Scholar-Athlete Award

Robert Fenton Patterson Award

Mansour Jewelers Award

Recipient shall be, in the words of the late Glenn S. (Pop) Warner ‘94 who played and coached at Cornell, “the senior who during hisfootballcareeratCornellhas shownthegreatestplayingability, leadership,inspirationalqualities and sportsmanship.”

Given for academic and football proficiency inhonorofthelate Mr. Grohmann

Presented by the Class of 1925, the recipient of this award shall be, like halfback Patterson in 1923 and 1924, the player who has shown the most improvement in the face of physical or other handicaps

Formerly Cornell Club of Ithaca Award; given to the player who has shown the most improvement on offense and on defense

1950 1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976

1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Reeve Vanneman, OT Ron Kopicki, DG LarryRafalski,DB Tom MacLeod, DB VicLivingston,LB Tom Albright, HB Paul Hanly, C Sam Costa, FB Kevin Sigler, QB Don Fanelli, FB Cal Washington, MG Joe Holland, TB John Curran, DS Mike Staun, LB Dave Chalk, DT Ken Rubenstein, PK Derrick Harmon, TB Derrick Harmon, TB Dave Van Metre, DT Dave Van Metre, DT Tom Aug, PK Mal Humphrey, DT Brent Felitto, DS Joe Pych, WR Rick Hindman, OT JeffDiehl,DE Jack Dankert, DE Charlie Beard, FS Tony Villella, WR Pat Paquette, OG Tim McDermott, P Ron Mateo, WR Cody Crawford, OG Christian DiPaola, OT Matthew DiPaola, OT Kip Melstrom, DT Joe Splendorio, WR Derek Kingrey, LB Phil Rigueur, OLB Luke Hanset, FB Kevin Rooney, DL Brad Kitlowski, LB

1951 1952 1953 1954 1955 1956 1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Reginald Marchant, DS Art Harre, LB Al Sebald, C John Morris, E Frank Vadney, T Tom Itin, C DickEales,E John Webster, HB Howard Picking, E John Beeby, FB Tony Pascal, FB Tony Turel, C Don McCarthy, E Gabe Durishin, HB Jim Docherty, DS George McWeeney, OG Bill Huling, HB Tim Battaglia, DE Jeff Ruby, DT Dennis Lubozynski, LB Tony Orel, OG Mike Fleming, OG-OT Lamont Garnett, DB Kevin Sigler, QB Dan Dwyer, DT Charlie Payne, DE Tip Macdonald, OG Bob Weggler, DE Mike Tanner, QB Todd Florey, DB Kurt Walterhouse, LB Scott Walter, DB Rick Dailey, DS Tom Cifrino, OT Jim Perrello, WR JeffJohnson,FB Tom Bernardo, LB Sam Brickley, WR Brent Felitto, DS Frank Monago, WR Gerry Willinger, SS Mark Broderick, LB Pete Case, FB Scott Reade, OG Ryan Blattenberger, SS Garrett Gardi, SS Nick Bombach, FS Chad Hunter, FB Chris Harrison, DT J.B. Moresco, WR Kevin Farese, WR Nathan Archer, RB Jason Stadnik, OL Ryan Lempa, DL Mike Stone, DL Sean Nassoiy, DB

1957 1958 1959 1960 1961 1962 1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Bob Czub, G Tom Skypeck, QB Dan Bidwell, HB LarryFraser,T Bernie McHugh, T Jake Page, G Joe Robinson, FB George Norman, E Ted Sprinkle, DE Fred Devlin, LB Bob Horn, SE Bob Pegan, DE Brooks Scholl, SE Rick Furbush, QB Craig Lambert, OT George Milosevic, OE Jon Tracosas, LB Wes Hicks, DT Bob Hall, DT Jeff Brown, C Jeff Kaplan, OT BillZittel,FB Kevin McCarthy, DE Art Keith, DE Tom Cifrino, OT Steve Pozzobon, DE Mark Collins, OT Jim Frontero, DB Dave Quarles, PK Costa Harbilas, DT BrianFiles,DE Blu Whipple, DE Greg Knopp, FS Troy Thompson, OC Geoff Cochrane, P PeteFitzpatrick,TB Bryan Draga, LB Brian Gormley, OG Seth Payne, DE Brad Kiesendahl, RB Tom Richards, DT Chris Morosetti, C Bryan Sacco, DE Tim Hermann, WR George Paraskevopoulos, DL Vic Yanz, WR Kevin Rooney, DL Kevin Boothe, OL David Blanks, CB D.J. Busch, QB Sean Nassoiy, CB Tim Doherty, OL Nate Tarsi, S

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993

John Pierik, C Jeff Fleischmann, FB Frank Vitale, G Bill Whelan, HB Poe Fratt, T Len Oniskey, T Jim Van Buren, G Bill DeGraaf, QB Art Boland, QB Bob McAniff, HB Ed Savitsky, T Dave Feeney, G John Hanly, T George Telesh, HB Dave Thomas, G Ed Burnap, E Gary Wood, QB Bob Baker, HB BillWilson,FB Pete Larson, HB Bill Murphy, SE Doug Kleiber, LB Paul Marcucci, OT Rick Furbush, QB Ed Marinaro, TB Bob Joehl, FB Mark Allen, QB Rick Johnson, DE Dan Malone, HB Steve Horrigan, DG Joe Meaney, OT Don Papich, LB Terry Lee, LB Joe Holland, TB Brad Decker, TE Jim DeStefano, LB Phil Loyd, DS Dan Suren, TE Derrick Harmon, TB Tony Baker, TB John Tagliaferri, HB ErikBernstein,P Lee Reherman, OT Scott Malaga, RB Mitch Lee, MLB Chris Cochrane, QB John McNiff, TB Scott Oliaro, TB Bill Lazor, QB Chris Zingo, LB Aaron Berryman, WR JohnVitullo,LB Chad Levitt, TB Eric Krawczyk, WR John Hanson, LB Ricky Rahne, QB Joe Splendorio, WR Ricky Rahne, QB Ricky Rahne, QB Keith Ferguson, WR Neil Morrissey, DB Ryan Lempa, DL

1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992

HISTORY Cornell Football Coaches Award

Charles Colucci Award

Offensive Red Helmet Award

Totheoffensiveanddefensive players making the “big play”

Mostvaluableplayer fortheseason

Recipientshallbeanon-senior who contributed most to the successoftheteam.Colucci, who died in 1973, was an avid Cornellfan

Totheoutstandingvarsity playeronoffense

1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Marty Stallone, QB Jim Frontero, CB Shaun Hawkins, WR Jeff DeLamielleure, DS Steve Lutz, HB Corky Webb, WS Chris Cochrane, QB Paul Tully, CB John McNiff, TB Tim Cronin, DT Mike Jamin, WR Kevin Marcus, DT Bill Lazor, QB Chris Zingo, LB PeteFitzpatrick,TB Bob Garvey, DE Chad Levitt, TB Chris Hanson, FS Chad Levitt, TB Doug Knopp, CB Chad Levitt, TB Seth Payne, DE Eric Krawczyk, WR Chris Allen, FS Joe Splendorio, WR Nate Fischer, LB Joe Spendorio, WR David Caputo, SS Keith Ferguson, WR Derek Kingrey, LB John Kellner, WR Jamie Moriarty, DB Nate Archer, FB Pete Combe, DL John Kellner, WR Kyle Thomas, DB Chad Nice, WR Kevin Rex, S

Mike Texido Award Totheseniorplayerofgreat promise whose career was unfortunately ended due to injury 1988 1989 1990 1991 1992

WWW .CORNELL B IG R ED . COM

RECORDS

Stone Travel “Big Play” Men of the Year Award

1986

AND

1994 1997 1998 1999

Dave Dase, QB Mike Strigel, OLB Doug Gamble, CB Greg Finnegan, OC Matt Speicher, TB JeffTaylor,LB Ned Burke, FB Terry Golden, FS JeffEland,DE Jorge Alvarez, LB Mike Buray, FB

2005 FOOTBALL

1963 1964 1965 1966 1967 1968 1969 1970 1971 1972 1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997

Mike Strick, HB Clarence Jentes, G Phil Ratner, DT Joe Homicz, DG Rich Musmanno, OG Jim Heeps, HB Keith Cummins, DB Dick Storto, FB Don Jean, DB Keith Daub, OE Mike Phillips, DG Rick Johnson, DE Don Wierbinski, OE Jim Lorditch, DT Terry Lee, LB Virgil Cotton, DB Tom Donnelly, OG Tom Rohlfing, C Alva Taylor, SB Paul Michalewicz, C Mike Scully, LB Frank Farace, DB Steve Garrison, TE Lyndon Gross, DS Mike Wagner, C Ken Johnson, OG Chris Hahn, WR Mike Raich, DB Sam Brickley, WR Mike McGrann, LB Mitch Lee, MLB Todd Nicholson, FB PaulTully,FS Jay Bloedorn, OT Mike Grant, WR Ramon Watkins, CB Steve Haggerty, FS Mike Jamin, WR Bill Lazor, QB Chris Zingo, LB JeffGilkinson,OT Dick Emmet, DE Steve Joyce, QB Steve Busch, WR John Rodin, PK Rich Sheerin, DT Tom Bickett, C

Harvey Sampson Award To the player with the most consistencythroughouthis career 1998 1999 2000 2001 2002 2003 2004

Charles Watson, P John McCombs, PK Tom Crone, DL Tim Hermann, WR Nate Spitler, LB Vic Yanz, WR Brad Kitlowski, LB

1973 1974 1975 1976 1977 1978 1979 1980 1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Glen Dempsey, OE Bruce Starks, OE Don Papich, LB Terry Lee, LB Virgil Cotton, DB Jim DeStefano, LB Tom Rohlfing, C Dave Kimichik, DB Derrick Harmon, TB Mike Scully, LB Frank Farace, DB JohnTagliaferri,FB Mike Raich, DB Chris Hahn, WR Mike McGrann, LB Scott Malaga, FB Mitch Lee, LB John McNiff, FB Mark Broderick, LB Scott Oliaro, TB Bill Lazor, QB Chris Zingo, LB Bill Lazor, QB Chris Zingo, LB Terry Golden, FS Chad Levitt, TB Chad Levitt, TB John Hanson, LB Eric Krawczyk, WR Mike Hood, QB Justin Bush, HB Dan Weyandt, LB Vincent Bates, DB Keith Ferguson, WR Joel Sussman, LB Brad Kitlowski, OLB Matt Pollock, DL

Most Valuable Back Award To the player who contributes mostoutofhisoffensive/ defensivebackfieldposition 1998 1999 2000 2001 2002 2003 2004

Deon Harris, HB Justin Dunleavy, FB Evan Simmons, RB Nate Spitler, LB Mick Razzano, QB Josh Johnston, TB Dan Collins, LB

1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Pete Case, FB John Massy, TE George Wood, OT Aaron Berryman, WR Ned Burke, FB Rich George, OC Erik Bjerke, WR Doug Ingham, FB Mike McKean, OG Greg Bloedorn, OC Doug Ingham, FB Jimmy Seifert, TE Eric Krawczyk, WR Chad Levitt, TB Brian Weidel, OT Eric Krawczyk, WR Matthew DiPaola, OT Mark Dittman, TE Joe Splendorio, WR Ricky Rahne, QB Joe Splendorio, WR Evan Simmons, RB Trevor MacMeekin, PK Kevin Boothe, OL Brian Romney, WR

Defensive Red Helmet Award Totheoutstandingvarsity playerondefense 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Bob Garvey, DE Terry Golden, FS Chris Zingo, LB Garrett Gardi, SS JohnVitullo,LB David Woods, DT JohnVitullo,LB Nick Bombach, FS Steve Bus, DE JustinBird,R John Hanson, LB Seth Payne, DE Chris Allen, FS Jorge Alvarez, LB Tom Nunes, SS David Pitman, LB Dan Weyandt, LB George Paraskevopoulos, DT Brad Kitlowski, LB Ryan Lempa, DL Mike McGinty, DT

HISTORY

AND

RECORDS

Jeff Stenstrom Special Teams Player Award Fortheplayer(non-kickerprior to 2004) who contributes the most to the performance of specialteams 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

1977 1978 1979 1980 1981 1982 1983

Bernie Olin Award

1985

Marty Stallone, QB Stuart Mitchell, TE Donnell Johnson, DB Aaron Sumida, QB Eugene Dallas, WS Pat Fagan, CB Pete Reynolds, WR Ethan Levitas, CB Mike Cochrane, PK Tim Simpson, DT Jon Kuhman, TE Kevin Maney, LB Dave Rickell, DE Mahingus Silver, DT Scott Carroll, QB JustinBird,SS Mark Donley, DT John Algeo, WS Charles Mitchell, OL Tom Kaplun, OL Cory Ziskind, OLB Dominic Garguile, OL Jim Hilliard, OLB D.J. Busch, QB

Dick Schaap Award

2002 2003 2004

Brad Kitlowski, OLB Mike Baumgartel, P John Nelson, LB Jonathan Lucas, DL Colin Nash, WR

1984

1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Craig Jaeger, TB Dave Kintigh, LB Mark Selsmeyer, OG Mike Johnson, DE Paul Mullenhoff, DT Dave Menapace, FB Rick Dailey, DS Mike Scully, LB Tony Baker, TB Scott Sidman, DS Mark Miller, FB Shawn Maguire, QB John Tagliaferri, HB Dave Van Metre, DT Ken Johnson, OG Jim Knowles, DE Steve Lipic, OG Dan Miller, LB Len Tokish, LB Rob Buccini, HB Mark Rooks, HB Jim Monken, FB Rob Ryder, DE John Massy, TE Scott Oliaro, TB John Massy, TE Steve Haggerty, FS Ryan Blattenberger, SS Doug Knopp, CB Mike McKean, OT Dick Emmet, DE Per Larson, QB Nick Bombach, FS Terry Smith, TB John Hanson, LB Rich Sheerin, DT Rich Sherrin, DT Mark Dittman, TE Nate Fischer, LB Tim Hermann, WR Matt Holleran, C Mike Baumgartel, P Kevin Boothe, OL Mick Razzano, QB Sean Nassoiy, DB Chad Nice, WR

Jaime

McManamon Award

Award for the senior who through diligence and hard work in the strength and conditioning program was able tosignificantlyimprovehis performanceonthefieldofplay. 2004

David Archer, OL

Sid Roth Award

Enzo Montemurro Award

To the down lineman who, throughhisattitudeandplay, has contributed the most to the success of the team

Given in honor of the late Enzo Montemurroforspiritand leadership

1981 1982 1983 1984 1985 1986 1987 1988

1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Steve Ross, OT Steve Duca, DT Gene Edwards, C John Passalacqua, DT Rick George, OT Tom McHale, DE Gary Rinkus, DT Howie Capek, C Doug Langan, OG Mark Burden, OG Mike Haseltine, OG John Sieger, OT Marc Warrington, TE Rob Ryder, DE Greg Finnegan, C Tim Cronin, DT Chris Field, OG Kevin Marcus, DT Jason Jenkins, OG George Wood, OT Jeff Woodring, DE Bob Garvey, DE Rich George, OC Greg Bloedorn, OC David Woods, DT Greg Bloedorn, OC Seth Payne, DT Seth Payne, DE Brian Weidel, OT Christian DiPaola, OT John Hanson, LB Tom Crone, DE Jay Bolton, DT Jay Bolton, DT George Paraskevopoulos, DT John Megaro, OL Kevin Boothe, OL Kevin Boothe, OL

Paul N. Hunt Citizenship Award To the senior who has unselfishlycontributedhistime and energy to help others beyondtheplayingfield 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Mike Farley, LB Len Tokish, LB Steve Hettrich, TE Phil Mahoney, CB Dan Branon, TE Andy Hite, QB Bill Lazor, QB Gerry Lajoie, OG Ron Mateo, WR Ian Wilson, WR Eric Krawczyk, WR Mike Hood, QB JustinBush,RB Jesse Rodriguez, DL Rich Zacek, DL Jarad Madea, LB John Megaro, C Trevor MacMeekin, PK

1981 1982 1983 1984 1985 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Frank Farace, DS PeteGriffin,SE Jim Frontero, CB Brent Felitto, DB Brandon Roth, DB Evan Parke, DB Pat Leahy, C Jason Shaffer, OT-DE Anthony Tabasso, OL Pat Paquette, OL Bryan Draga, LB JeffCortez,LB Brian Weidel, TE Rich Sheerin, DT JustinByrd,LB David Caputo, CB Dru Vaughn, DL Mike Hood, QB David Pitman, LB Justin Dunleavy, RB Justin Dunleavy, RB Jesse Rodriguez, DL Kevin Rooney, DL David Archer, OL

Daniel N. Bondareff Freshman ScholarAthlete Award Given to the freshman player foracademicandfootball proficiency 1986 1987 1988 1989 1990 1991 1992 1993 1994 1995 1996 1997 1998 1999 2000 2001 2002 2003 2004

Tom Kobin, QB David Marshall, OL Jeff Diehl, OLB Charlie Beard, DB Kevin Koehler, RB Per Larson, QB David Rickell, TE-DE Steve Bus, DE Mahingus Silver, DT Pat Oâ&#x20AC;&#x2122;Shaughnessy, LB Kip Melstrom, DT Tom Richards, DT Matt Crowe, LB Derek Kingrey, LB Ryan Burhorn, TE Eric Jones, DB Luke Hanset, FB Cameron Marchant, LB Todd Rusinkovich, DL Michael Boyd, S

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

To the freshman who contributed the most to the varsity 2001

Formerly Trainers Tough Guy Award;giventothevarsity playerwhogiveshisall throughouttheseason, distinguishinginjuryfrompain

Dave Ahouse, LB Chris Allen, FS John Hanson, LB David Pitman, LB Frank Giglio, SS Mike Parris, TE Tony Vitullo, LB Joel Sussman, DB Vince Bates, CB Marshall Berkes, WR Mike Baumgartel, P

To the player who, although an underdog, showed determination andgritandin the end persevered 1985 1986 1987 1988 1989 1990 1991 1992

Doc Kavanagh Training Room Athlete of the Year Award

HISTORY

AND

RECORDS

WWW .CORNELL B IG R ED . COM

Cornellians in Pro Football

100

Draftees (Cl., Pos.) Howard Blose ‘44 (HB) Hillary Chollet ’50 (HB) Chick Davidson ’45 (B) Chick Davidson ’45 (B) Bob Dean ’49 (B/P/PK) Bill DeGraaf ’56 (QB) Al Dekdebrun ’47 (QB) Nick Drahos ’41 (T) Vince Eichler ’41 (B) Jeff Fleischmann ’51 (FB) John Gerdes ’54 (T) Pete Gogolak ’64 (PK) Derrick Harmon ’84 (RB) Kirk Hershey ’41 (E) Stan Intihar ’57 (E) Walt Kretz ’48 (B) Bob Lally ’74 (LB) Mort Landsberg ’41 (FB) Pete Larson ’67 (HB) Chad Levitt ’97 (RB) Ed Marinaro ’72 (RB) Andy Martin ’92 (WR) Walt Matuszczak ’41 (B) Bill McKeever ’39 (T) Len Oniskey ’55 (T) Seth Payne ’97 (DT) Mike Phillips ’74 (MG/LB) Sid Roth ’39 (G) John Sponheimer ’69 (DT) Gary Wood ’64 (QB) Frank Wydo ’50 (T)

Year 1944 1949 1945 1946 1949 1956 1946 1941 1940 1951 1954 1964 1984 1941 1956 1945 1974 1941 1967 1997 1972 1992 1941 1939 1955 1997 1974 1939 1969 1964 1947

Players(Cl.,Pos.) Greg Bloedorn ’96 (C) Chris Cochrane ’91 Al Dekdebrun ’47 (B) Jim DeStefano ’81 (LB) Joe DiStasio ’48 (B) Nick Drahos ’41 (T) Hal Ebersole ’23 (G) Furlong Flynn ’24 (G) FredGillies’18(T) Pete Gogolak ’64 (PK) Derrick Harmon ’84 (RB) Kirk Hershey ’41 (E) Reno Jones ’22 (G) Eddie Kaw ’23 (HB) Bob Lally ’74 (LB) Mort Landsberg ’41 (FB) Pete Larson ’67 (RB) Chad Levitt ’97 (RB) Ed Marinaro ’72 (RB) Andy Martin ’92 (WR) Hal McCullough ’41 (B) Tom McHale ’87 (DE) Ignacio Molinet ’27 (B) Bob Morris ’25 (G) Bill Murphy ’68 (E) Bob Nash ’15 (T) John O’Hearn ’15 (E) Len Oniskey ’55 (T) Seth Payne ’97 (DE) Irvin (Bo) Roberson ’58 (B) Ralph Scholz ’84 (DL) Harry Shaub ’34 (G) Murray Shelton ’16 (E) Ken Stofer ’46 (B) John Tagliaferri ’86 (HB) Ken Talton ’79 (FB) Jim Wilson ’21 (E) Gary Wood ’64 (QB) Frank Wydo ’49 (T) Chris Zingo ’94 (LB)

Team, Year(s) Seattle, 1996-01 Ohio (CFL), 1992; Frankfurt (NFL-Europe), 1992 Boston, 1948; Toronto (CFL), 1949-54 Cincinnati, 1981 New York Giants, 1948 New York Americans (New AFL), 1941 Cleveland, 1923 Hartford, 1926 Greg Finnegan ‘91 Chicago, 1920-26, ‘28 Asst. Strength & Conditioning Buffalo, 1964-65; New York Giants, 1966-75 Coach with Jacksonville Jaguars San Francisco, 1984-86 Cleveland, 1941 Bill Lazor ’94 Toledo, 1922 Buffalo, 1924 Offensive assistant coach for the Green Bay, 1976 Washington Redskins, 2004; Philadelphia, 1941 Offensive Quality Control Washington, 1967-69 Coach, Atlanta Falcons, 2003 Oakland, 1997 Minnesota, 1972-75; New York Jets, 1976 Winnipeg (CFL), 1992-99 Brooklyn, 1942 Tampa Bay, 1987-92; Philadelphia, 1993-94; Miami, 1995 Frankford, 1927 Brooklyn, 1926 Boston, 1968 Akron, 1920; Buffalo, 1921-23; Rochester, 1924; New York Giants, 1925 Cleveland, 1920; Buffalo, 1921 Washington and New York Giants, 1955 Jacksonville, 1997-2001; Houston Texans, 2002-present San Diego, 1961; Oakland, 1962-65; Buffalo 1965; Miami, 1966 Hamilton (CFL), 1984-90 Philadelphia, 1935-38 Buffalo, 1920 Buffalo, 1946 Miami, 1987 New England, 1979; Kansas City, 1980-81; Birmingham (USFL), 1983-84 Buffalo, 1922 New York Giants, 1964-66, 1968-69; New Orleans, 1967; Ottawa (CFL), 1970 Pittsburgh, 1947-51; Philadelphia, 1952-57 Seth Payne Shreveport (CFL), 1995

2005 FOOTBALL

Team Brooklyn Los Angeles Rams Washington Green Bay Philadelphia Pittsburgh Boston Cleveland Green Bay Chicago Cardinals Philadelphia Buffalo(AFL) San Francisco Cleveland Green Bay Boston Miami Pittsburgh Washington Oakland Minnesota Winnipeg (CFL) New York Giants Philadelphia Washington Jacksonville Cincinnati Cleveland Kansas City New York Giants Pittsburgh

Round 30 18 22 25 8 28 9 11 21 26 28 12 9 17 18 22 9 22 9 4 2 4 10 10 13 4 14 11 10 8 5

Pick 309 177 226 236 81 327 72 94 194 307 333 92 248 154 212 223 234 204 222 123 50 — 87 84 48 114 360 93 257 109 29

Ed Marinaro

Behind the Scenes . . . Mike Huyghue ’84 (SE) Attorney, NFL Management Council, 1987-90; General Manager, Birmingham Fire, 1990-91, Vice President of Administration and General Counsel, World League, 199193; Vice President of Administration and General Counsel, Detroit Lions, 1993-95; General Manager and Vice President of Football Operations, Jacksonville Jaguars, 1995-2002; Owner, Axcess Entertainment (manager for pro athletes), 2002-present

HISTORY

AND

RECORDS

All-Time Letter Winners AAA Abel, William G. – 1964, 65, 66 Accorsi, Frank J. – 1943, 44 Ackerknect, Clarence F. – 1917 Affeld, Frank O. – 1923, 24, 25 Ahouse, David J. – 1994, 95, 96, 97 Ainslie, Robert H. – 1977, 78 Aird, Alexander N. – 1925 Akins, Thomas A. – 1955, 57 Albanese, Damiano S. – 1984, 85 Albright, Thomas E. – 1970, 71 Alexander, Edward R. – 1898, 99, 1900 Alexander, Robert E. – 1927, 29 Alexy, R. J. – 1961 Algeo, John P. – 1998, 99, 2000 Alleavitch, Doug – 1981 Allen, Amos G., Jr. – 1929, 31 Allen, Christopher M. – 1994, 95, 96, 97 Allen, John H., Jr. – 1914 Allen, Mark R. – 1971, 72, 73 Altomare, Matthew – 2003 Alvarez, Jorge – 1996, 97, 98 Anderluh, John R. – 1955 Anderson, Donald E. – 1932 Anderson, Edward E. – 1914, 15, 16 Anderson, Edward L. – 1925 Anderson, John F. – 1926, 27, 28 Anderson, Robert H. – 1941, 42 Andrus, Walton R. – 1942 Annunziata, Mark L. – 1982, 83 Anzalone, Anthony – 1975, 76, 77 Apfel, Richard C. – 1973, 75 Appling, William E. – 1991, 92 Aragona, Alfred A. – 1961, 62 Arangio, George A. – 1962, 63, 64 Archer, David J. – 2002, 03, 04 Archer, Nathan – 2000, 01, 02 Arin, Larry – 1985 Armbruster, George W. – 1942 Arthur, William M. – 1967, 68, 69 Artymovich, Charles D. – 1982 Aug, Thomas R. – 1985, 86 Avery, Patrick M. – 1977

BBB

Bradley, Frank L., Jr. – 1946, 47, 48, 49 Bradshaw, Horace L. – 1972, 73, 74 Bragg, Everett C. – 1934, 35 Branon, Daniel M. – 1989, 90, 91 Braun, John D. – 1954 Brayman, George I. – 1921 Brayton, Charles L. – 1920, 21 Brenner, Bruce V. – 1953 Brereton, Thomas G. – 1968, 69, 70 Brewster, Alfred A., Jr. – 1900, 01, 02, 03 Brezinsky, Allen E. – 1954 Brickley, Samuel D., II – 1986, 87, 88 Brinton, Charles C. – 1906, 07 Bristol, Earl G. – 1927, 28 Britton, Thomas - 2003 Brock, Jerome – 1932, 33 Broderick, Mark J. – 1989, 90, 91 Brogan, Thomas M. – 1957 Brooke, John A. – 1956 Brooks, Michael A. – 1984 Brown, Ernest H. – 1888, 89 Brown, Jeffrey – 1974, 75, 76 Brown, John S. – 1933 Brown, Kenneth G. – 1937, 38, 39 Brown, Michael J. – 1987, 88, 89 Brown, R. S. – 1960 Brown, Sam – 1977, 78, 79 Brown, Wiser – 1916 Brozina, Joseph – 1944, 45 Bruska, Walter G. – 1948, 49 Bryant, Arthur P. – 1899 Buccini, Robert E. – 1987, 88, 89 Buck, Brian L. – 1979, 80 Buckley, Elias F. – 1922, 23 Buell, Burton C. – 1934 Bufalino, Louis C. – 1939, 40, 41 Bugni, Joseph A. – 1997, 98, 99 Bullis, Gary W. – 1981, 82 Buray, Michael A. – 1998, 99 Burden, Mark M. – 1987, 88 Burke, Alexander – 1939 Burke, Edmund M. – 1992, 93, 94 Burnap, Edward G. – 1960, 61, 62 Burnap, John K. – 1970 Burns, Edward , Jr. – 1902 Burns, Garland – 1975, 76, 77 Burns, John D. – 1946 Bus, Randall W. – 1967, 68 Bus, Stephen G. – 1993, 94, 95 Busch, Daniel J. - 2003, 04 Busch, Stephen T. – 1994, 95, 96 Busch, William H. – 1946, 47 Bush, Harold M. – 1889, 90 Bush, Justin J. – 1997, 98, 99 Butler, Edmund W. – 1910, 11, 12 Butterfield, Victor L. – 1925, 26 Byrne, James G. – 1998

CCC Cahill, Michael – 1981, 82, 83 Calaguire, Jordan - 2003 Calcagni, Ralph C. – 1943 Caldwell, Robert K. – 1907, 08 Caldwell, William A. – 1896, 98, 99 Calhoun, Richard J. – 1986, 87 Calvo, Rocco J. – 1950, 51 Canfield, A. H. – 1895 Capek, Howard G. – 1987, 88 Capra, Edward A. – 1959, 60 Caputi, Stephen – 1976 Caputo, David A. – 1997, 98, 99 Carey, Emerson , Jr. – 1924, 25, 26 Carey, William D.P. – 1920 Carl, David A. – 1956, 57 Carlson, David R. – 1969 Carolan, Edgar A. – 1889, 90 Carpenter, Albert G. – 1925 Carpenter, Selleck J. – 1949 Carr, Bryan – 1991 Carrington, James H. – 1943

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Babcock, Langdon – 1905, 06 Babula, Bernard S. – 1947, 48, 49 Baccile, Peter E. – 1982, 83 Bacon, George W. – 1890, 91 Bacon, Kevin K. – 1986 Bailey, Andre P. – 1995 Bailey, Clarence W. – 1914, 15 Bainbridge, David F. – 1991 Baker, Anthony J. – 1982, 83, 84 Baker, Donald W. – 1921 Baker, Douglas V. – 1984, 85 Baker, George R. – 1891 Baker, Malvern W. – 1937, 38, 39 Baker, Richard A. – 1936 Baker, Robert E. – 1962, 63, 64 Bakowski, Christopher L. – 1979, 80, 81 Bakowski, Keith E. – 1982, 83, 84 Balch, Allan C. – 1887 Balderston, Eugene P., Jr. – 1926, 27 Baldwin, Arthur J. – 1889, 90 Ballas, Frank W. – 1977 Balough, Andrew – 2000, 01 Bancoff, Carl – 1957, 58, 59 Banik, Steven J. – 1970 Barbato, Dennis J. – 1973 Barber, Thomas K. – 1996, 97, 98 Bard, George P. – 1916 Barnhisel, Arthur H. – 1893 Barone, Michael J. – 1987, 88 Barr, Charles J. – 1890, 91, 92, 93 Barr, Daniel C. – 1983 Barr, Dean S. – 1981, 82 Barrett, Charles C. – 1913, 14, 15 Bassell, Jeffrey J. – 1982, 83, 84 Bassford, Abram , Jr. – 1896

Bates, Edward S. – 1910 Bates, Vincent – 1999, 2000, 01, 02 Battaglia, Timothy J. – 1966, 67, 68 Batten, John M. – 1934, 35, 36 Baudendistel, Michael J. – 1990 Baughan, C. Mark – 1985, 86, 87 Baumann, Andy – 2002 Baumgartel, Michael E. – 2001, 02, 03, 04 Bayer, Edward I. – 1908 Beacham, Joseph W., Jr. – 1893, 94, 95, 96 Beadle, Zachary – 2002, 03, 04 Beall, William C. – 1931 Beard, Charles S. – 1992 Beck, Sidney D. – 1926, 27, 28 Bednar, Andrew F. – 1988, 89 Bedrossian, Guy H. – 1952, 53, 54 Beebee, Alexander M. – 1943, 44 Beeby, John E. – 1959, 60 Beekman, Michael D. – 1981, 83 Beggs, Lyman M. – 1959, 60 Bell, Floyd W. – 1908 Bell, Richard N. – 1944, 45 Benedict, Herschel A. – 1888, 89 Benedict, Horace G. – 1916 Benjamin, Brien R. – 1995 Bennett, Edwin H., Jr. – 1887 Bennett, Frank E. – 1967, 69 Bennett, Kevin L. – 1992, 93, 94 Bennett, Wendell H. – 1912 Benson, Cyrus , Jr. – 1954, 55, 56 Berean, John H. – 1923 Berkes, Marschall – 2002, 03 Berlacher, Robert A. – 1973 Bernardo, Thomas P. – 1984, 85, 86 Bernstein, Erik M. – 1984, 85, 86 Berryman, Aaron R. – 1992, 93, 94 Beyer, Richard H. – 1930, 31, 32 Bickett, Thomas C. – 1995, 96, 97 Bidwell, Daniel L. – 1958, 59 Bievenour, Michael J. – 1979 Bird, Edward J. – 1904 Bird, Justin E. – 1995, 96, 97 Bird, Michael K. – 1996 Bishop, James D. – 1979 Bjerke, Erik M. – 1993, 94 Black, Thomas H. – 1967 Blackburn, Thomas A. – 1943 Blake, Robert E. – 1955, 56 Blakemore, Patrick – 2004 Blanks, David – 2001, 02, 03, 04 Blanks, Marcus – 2002, 03, 04 Blasko, Paul J. – 1939, 40 Blattenberger, Ryan A. – 1991, 92, 93 Bloedorn, Gregory S. – 1992, 94, 95 Bloedorn, John D. – 1989, 90 Blose, Howard W. – 1943 Boddie, Thurman M. – 1949 Boehlert, Carl J. – 1989, 90 Bogar, George W., III – 1958 Boguski, Paul K. – 1955, 56 Bohenick, John – 1980, 81 Bohn, F. V. – 1889 Boland, Arthur L. – 1954, 55, 56 Bolger, Matthew J., Jr. – 1946, 47 Bolton, Michael J. (Jay) – 1998, 99, 2000 Bombach, Nicolas A. – 1993, 94, 95 Boochever, Robert – 1937 Bool, Herbert J. – 1951, 52, 53 Boothe, Kevin – 2002, 03, 04 Borden, William A. – 1982, 83, 84 Borger, William H. – 1933, 34, 35 Borges, Victor M. – 1994 Borhman, John W., Jr. – 1939, 40 Borland, Thomas C. – 1932, 33, 34 Borroff, Robert C. – 1984, 85 Boruch, John N. – 1961, 62, 63 Bottini, Thomas J. – 1978, 79, 80 Boyle, James R., Jr. – 1997 Bozich, Bruce M. – 1971, 72, 73 Bozich, John M. – 1970, 71, 72 Bracken, Matthew C. – 1990

101

WWW .CORNELL B IG R ED . COM

HISTORY

102

Carroll, Scott C. – 1996, 97 Carry, Charles W. – 1917, 19 Carry, Joseph C. – 1916 Carvolth, Trent - 2003, 04 Carter, James – 1943 Case, Peter A. – 1989, 90, 92 Casey, David A. – 1990 Casey, James B. – 1948 Cassel, Harry E. – 1947, 48, 49 Cassidy, Charles E. – 1921, 22, 23 Cerand, Gerard A. – 1958 Cervasio, Joseph R. – 1967, 68 Chalk, David E. – 1978, 79, 80 Chamberlin, Richard A. – 1949 Champaign, Donald K. – 1910, 11, 12 Champaign, Leigh M. – 1903 Champion, Phillips K. – 1928 Chapman, George M. – 1904 Chenevey, Mark F. – 1978, 79, 80 Chipouras, Strati – 1949 Chollet, Hillary A. – 1945, 46, 48, 49 Christensen, Norman L. – 1940, 41 Church-Smith, Henry A. – 1967 Cifrino, Thomas R. – 1983, 84 Claggett, Samuel O. – 1929, 30 Claggett, Strabo V., Jr. – 1942 Clark, Richard G. – 1947, 48, 49 Clark, Richard W. – 1962 Clasby, Richard J., Jr. – 1978, 79, 80 Cliggott, Richard T. – 1950, 51, 52 Cloyd, Jason C. – 2004 Clymer, Paul K. – 1949, 50 Cobb, Edmund A. – 1928 Cobb, Michael A. – 1978, 79 Cochran, Philip C. – 1969, 70 Cochrane, Christopher P. – 1989, 90 Cochrane, Geoff M. – 1992, 93 Cochrane, Michael – 1991, 92 Coffin, Albert R. – 1900, 01, 02, 03 Cohen, Irving – 1927 Cohn, Jerome H. – 1939, 40 Cokins, Gary M. – 1968, 69 Colaruotolo, Charles F., Jr. – 1986 Colbeck, William R. – 1962, 63 Collins, Carlton P. – 1914, 15 Collins, Daniel – 2001, 02, 03, 04 Collins, James L. – 1911 Collins, Mark C. – 1985, 86 Collins, Scott E. – 1996 Collyer, William C. – 1913, 14 Colnon, Aaron J. – 1889, 90, 91, 94 Coltrin, D. G., Jr. – 1983, 84 Colvin, William H., Jr. – 1917, 19 Combe, Peter – 1999, 2000, 01, 02 Condon, Timothy – 2002, 03, 04 Condon, William – 1934 Constantino, John N. – 1981, 83 Conti, Frank W. – 1952 Conti, Louis J. – 1939, 40 Cook, George T. – 1905, 06, 07 Cool, Frank W. – 1895 Cool, Willard C. – 1913, 14, 15 Cooper, H. R. – 1900 Coren, Bruce R. – 1977 Corrigan, John J. – 1971, 72, 73 Cortez, Jeffrey B. – 1993, 94, 95 Cosgrove, James J. – 1907, 08 Costa, Samuel R. – 1971, 72, 73 Costello, James H. – 1902, 03, 04, 05 Costlow, Donald L. – 1984 Cotter, James V. – 1945 Cotton, William Virgil – 1976, 77, 78 Courtright, David S. – 1925 Coutts, Steven E. – 1986 Craig, John W. – 1919 Craven, Kent A. – 1979 Crawford, Cody B. – 1996 Creahan, John W., Jr. – 1978, 79, 80 Crocco, Walter C., Jr. – 1950 Croker, Michael H. – 1992, 93 Crone, Thomas E. – 1998, 99, 2000 Cronin, George F. – 1946 Cronin, Timothy C. – 1988, 89, 90 Crosby, Edwin S. – 1908, 09 Cross, Charles W. – 1898, 99, 1900

2005 FOOTBALL

Cross, George E. – 1917 Crum, Blair R. – 1961 Cullen, John N. – 1944 Cummins, William Keith – 1967, 68, 69 Curran, John J. – 1976, 77, 78 Curtis, Greeley S., Jr. – 1892 Cushing, Donald S. – 1943 Cushing, John P., Jr. – 1969, 70, 71 Cushing, Meredith R. – 1941, 42, 43 Czub, Robert J. – 1957

DDD D’Agostino, Anthony – 1951, 52, 53 D’Onofrio, Nicholas A. – 1942, 46, 1947 Dailey, Brian – 2001 Dailey, Richard R. – 1981, 82, 83 Dale, Paul A. – 1978, 79, 80 Daley, W. B. – 1893 Dallas, Eugene A. – 1988, 89 Dameron, Wilbur R. – 1944 Dankert, John H. – 1991, 92 Dann, Alexander W. – 1906 Dase, David H. – 1987, 88 Daub, Keith W. – 1970, 71, 72 Daukas, Louis J. – 1941, 42, 46 Davall, Harold J. – 1898, 99 Davidson, Charles L. – 1921 Davidson, Charles R. – 1944 Davidson, John K. – 1944 Davies, Horace F. – 1919 Davies, William R. – 1967, 68 Davis, Bruce D. – 1946, 47 Davis, Douglas B. – 1987 Davis, Henry E. – 1904 Davis, Kenneth R., Jr. – 1942 Davis, Lonnie D. – 1993, 94 Davis, Theron D. – 1890 Davis, Vincent J. – 1983 Davitt, John W. – 1900, 02, 03 Dawson, Norman , Jr. – 1943, 46, 47 Dean, Robert T. – 1946, 47, 48 Decker, Brad E. – 1977, 78, 79 DeCou, James M. – 1982 DeGraaf, William – 1953, 54, 55 Degulis, Simon T. – 1944, 45 DeJesus, Paul A. – 1977, 78, 79 Dekdebrun, Allen E. – 1943, 44, 45 Del Signore, James R. – 1945 DeLamielleure, Jeffrey D. – 1985, 86, 87 Delaney, John L. – 1987, 88 Delano, Curtis – 1910 DeLaTorre, Anthony – 2000 DeMaurice, G. – 1900 Deming, P. H. – 1893 Dempsey, Glen M. – 1972, 73 Dempsey, John J. – 1896, 97 Dentes, John M. – 1965, 66, 67 DeSantis, Robert M. – 1983, 84 DeStefano, James T. – 1978, 79, 80 DeStefano, Ralph T. – 1953, 54 Deuel, Michael M. – 1958 Devine, Daniel K. – 1985 Devine, Gregory E. – 1992 Devlin, Frederick M. – 1964, 65, 66 Devold, Harold – 1945 Devoy, J. – 1888 DeVries, Shon G. – 1989 Dewey, George S. – 1904 Deyhle, Patrick – 2001, 02, 03 Dickinson, William H. – 1968, 69, 70 Dicks, Jeffrey – 2004 Diehl, George P. – 1893 Diehl, Jeffrey T. – 1989, 90, 91 Diehl, Thomas M. – 1966, 67 Dietrich, Richard R. – 1928 DiGiacomo, Carmine W. – 1960, 61 DiGrande, Vincent – 1948, 49, 50 Dilatush, Robert M. – 1952 DiNunzio, Marc J. – 1980, 81 DiPaola, Christian P. – 1996, 97 DiPaola, Matthew J. – 1996, 97 DiSalvo, Samuel A. – 1967, 68 Dishaw, J. David – 1984, 85 DiStasio, Joseph R. – 1944, 45, 46, 47

AND

RECORDS

DiTondo, Mark – 1981 Dittman, Mark M. – 1996, 97, 98 Docherty, James B. – 1963, 64, 65 Dodge, Wilson S. – 1920, 21 Doe, Whitney C. – 1941, 42 Doherty, Patrick F. – 1996 Doherty, Timothy - 2003, 04 Dohr, Michael R. – 1977 Dolan, Timothy J. – 1981, 82 Dollar, William M. – 1887 Donahoe, Timothy M. – 1983 Donahue, Michael R. – 1977, 78 Donley, Mark E. – 1997, 98 Donnan, George S. – 1909 Donnelly, Thomas R. – 1977, 78, 79 Dorius, Noah E. – 1938 Dorner, William F. – 1898, 1900 Dorrance, John G. – 1949, 50, 51 Dorset, Lynn P. – 1947, 48, 49 Dow, James P. – 1990 Dowdell, Scott J. – 1980, 81 Downes, Charles L. – 1904, 05 Dowtin, Dwayne G. – 1977, 79 Draga, Bryan P. – 1993, 94 Dragon, Henry S. – 1941 Drahos, Nicholas – 1938, 39, 40 Drogin, Alexander – 1944 Drost, Henry C. – 1948, 49 DuBois, Mark A. – 1973, 74, 75 Duca, Steven A. – 1980, 81, 82 Duff, Thomas O. – 1951 Dugal, James J. – 1973 Dugdale, Thomas W. – 1976 Dunbar, Howard S. – 1939, 40 Dunklin, Marvin L. – 1985, 87 Dunleavy, Justin M. – 1998, 99, 2000, 01 Dunlop, David R. – 1957, 58 Dunn, Ernest C. – 1965, 66, 67 Dunn, Thomas C. – 1887, 89 Dunston, Robert E. – 1948 Duren, Matthew L. – 1997, 98 Durishin, Gabriel M. – 1964 Dutchyshyn, Thomas P. – 1990, 91 Dutton, Patrick T. – 1997 Dwyer, Daniel F. – 1973, 74, 75 Dwyer, Joseph C. – 1949 Dyar, William O. – 1980, 81 Dyer, George P. – 1893, 94

EEE Eales, V. Richard – 1956, 57 Earl, Kevin D. – 1973 Earle, Edwin , Jr. – 1905, 06, 07 Easterly, David G. – 1990 Ebersole, Harold L. – 1920, 22 Eckley, Paul W. – 1915, 16 Eckstein, Christopher - 2003, 04 Eddy, Winslow – 1925 Edwards, Eugene T. – 1981, 82, 83 Egan, John A. – 1974 Ehle, Louis C. – 1888, 89 Ehman, Kenneth H. – 1952 Eichler, Edmund V. – 1937, 38, 40 Eisenbrandt, Frederick H. – 1917 Ekstrom, George A. – 1959, 60 Eland, Jeffrey A. – 1996, 97 Elliott, Robert R. – 1997 Ellis, Grant R. – 1943, 44 Ellis, Robert C. – 1948, 49 Ellis, William C. – 1969, 70, 71 Emmet, Richard S. – 1992, 93, 94 Engel, Robert G. – 1950, 51, 52 Engle, John H. – 1962, 63, 64 Eramo, Mark A. – 1982, 83, 84 Ervick, Gary D. – 1968, 69, 70 Evans, Samuel S., Jr. – 1924, 25, 26 Eyrich, Harold R. – 1910, 11, 12

FFF Fagan, Patrick E., Jr. – 1989, 90 Fahey, James H. – 1993 Faist, Charles J. – 1968 Fanelli, Donald A. – 1973, 75

HISTORY

AND

RECORDS GGG Gabel, John H., Jr. – 1983, 1984 Gaige, Robert J. – 1948, 1949, 1950 Galbreath, Louis H. – 1888, 1889, 1890, 1891 Galeazzi, Thomas E. – 1996, 1997, 1998 Gallogly, Edward J. – 1914, 1915 Gamble, Douglas R. – 1990 Gannon, George Craig – 1965, 1966 Garcia, Edward - 2003 Garcia, Stephen P. – 1973 Gardi, Garrett M. – 1992, 1993, 1994 Gardner, Fred E. – 1907, 1908 Gargan, Thomas V., Jr. – 1948, 1949 Garguile, Dominic – 2000, 01, 02, 03 Garman, Harry S. – 1965, 1966 Garnett, Lamont W. – 1971, 1972, 1973 Garnsey, John K. – 1888 Garrett, Roger L. – 1955, 56, 57 Garrison, Stephen M. – 1982, 83, 84 Garvey, Robert V. – 1992, 93 Gasparello, Ralph N. – 1945 Gassner, Harold – 1925, 26 Gavin, Daniel J. – 1985, 86 Geib, Jay R., Jr. – 1941, 42 Geiser, Douglas W. – 1989 Gellert, George G. – 1959 Geoffrion, Homer R. – 1932 George, Abraham – 1930, 32 George, Michael J. – 1998 George, Richard E. – 1984, 85 George, Richard T. – 1992, 93 George, Stephan – 1975 George, William I. – 1951, 52, 53 Gerdes, John H. – 1952, 53 Gerken, Richard R. – 1965, 66 Gervase, Ronald M. – 1965, 66 Gettins, Steven M. – 1995 Giarrusso, Vincent P. – 1951, 52 Gibson, Edwin T. – 1904, 05, 06 Gibson, Robert J. – 1986 Giglio, Francis M. – 1997, 98 Gilkinson, Jeffrey M. – 1992, 93, 94 Gillies, Fred M. – 1915, 16 Gilman, William E. – 1934 Ginder, Jason – 1985 Girolamo, Paul C. – 1948, 49 Godshall, Henry S., Jr. – 35 Goetz, William P. – 1920 Gogolak, Peter K. – 1961, 62, 63 Goldbas, Jacob I. – 1932, 33 Golden, Richard M. – 1944 Golden, Terence L. – 1992, 93, 94 Goldy, William J. – 1982, 83, 84 Goodberlet, Paul – 1978, 79, 80 Goodrich, Bill – 2000, 01, 02 Gordon, Arthur – 1903 Gormley, Brian S. – 1994, 95 Gouinlock, Edward V. – 1920, 21, 22 Grace, Kenneth A. – 1970 Grady, Patrick M. – 1994 Graham, James C. – 1997 Grant, Matthew – 2004 Grant, Michael J. – 1989, 90, 91 Grant, Robert S. – 1932, 33 Grasso, Robert M. – 1973, 75 Green, Richard R. – 1991 Greene, Fred D. – 1977 Greene, Gregory P. – 1991 Griffin, Lawrence J. – 1987 Griffin, Peter J. – 1985 Griffith, E. A. – 1890, 91, 92 Grimshaw, Frederick G. – 1898 Grkovic, Wilson Duke – 1963, 64 Gross, Frederick H. – 1962 Gross, Lyndon B. – 1984, 85 Groszewski, Edward G. – 1991, 92 Gruendyke, Rod – 1978 Gryska, Richard E. – 1946, 47 Guba, Thomas K. – 1969, 70, 71 Gugino, Frank – 1966 Guise, Thomas J. – 1964, 65 Gunsch, Leonard P. – 1936 Guyer, Edward R. – 1912, 13

HHH Hackett, Charles F. – 1897 Hackstaff, Bruce W. – 1929, 30 Hackstaff, Frederick W. – 1903, 04 Hadley, Jon P. – 1966 Hagenauer, Richard G. – 1949, 50, 51 Haggerty, Steve F. – 1990, 91, 92 Hahn, Christopher A. – 1985, 86, 87 Hahn, Jeffrey - 2003, 04 Hale, Stephen C. – 1910 Haley, Robert J. – 1948, 49, 50 Hall, Neal E. – 1975, 76, 77 Hall, Robert P. – 1974, 75 Hall, Ronald L. – 1959, 60 Hall, Thomas – 1893, 94, 95 Halliday, Morris S. – 1903, 04, 05 Hammond, Jeffrey S. – 1981, 82 Hanaka, Martin E. – 1970 Handleman, Lester M. – 1929, 30, 31 Hanley, Andrew F. – 1952 Hanlon, David P. – 1964, 65 Hanly, John K. – 1958, 59, 60 Hanly, Paul J., Jr. – 1970, 71, 72 Hansen, Harry A. – 1983 Hansen, Patrick W. – 1976, 77, 78 Hanset, Lucian – 2002 Hanson, B. – 1891 Hanson, Christopher M. – 1993, 94 Hanson, John W. – 1995, 96, 97, 98 Hanson, Leonard C. – 1921, 22 Hapanowicz, Taddaus – 1946 Harbilas, Costa – 1987, 88 Hardaway, Andre – 2002, 03, 04 Hardie, Charles G. – 1900 Hargrave, Harold H. – 1946 Harmon, Carl E. – 1977, 78 Harmon, Derrick T. – 1981, 82, 83 Harre, Arthur F. – 1951, 52 Harris, Benjamin M. – 1889 Harris, Deon M. – 1995, 96, 98, 99 Harris, Francis L. – 1917 Harris, Sherwood L. – 1968 Harris, William – 1907 Harrison, Chris J. – 1996, 97 Harrison, T. Daniel – 1994 Harvey, George R. – 1891 Harvey, Henry L., Jr. – 1957 Hase, Jordan – 1999, 2000, 01, 02 Haseltine, Michael P. – 1987, 88 Hatton, Christian P. – 1955, 56, 57 Haucke, Frank – 1916 Hawkins, Robert W. – 1973, 74 Hawkins, Shaun C. – 1985, 86, 87 Hayden, Samuel L. – 1962 Haydon, Paul – 1974, 75, 76 Hazzard, Robert D. – 1956, 57, 58 Heath, Richard L. – 1967, 68 Hedden, Raymon R. – 1931, 32 Heeps, James W. – 1966, 67, 68 Heinith, William W., Jr. – 1942, 45, 46 Helmick, Louis G., Jr. – 1941, 42 Hemingway, John C. – 1936, 37, 38 Henderson, Frank L. – 1922, 23, 24 Henderson, Gary A. – 1971 Hendry, Clifford D. – 1971 Henrickson, Robert L. – 1975, 76, 77 Henry, Edward U. – 1893 Henry, James – 1975 Hepfer, Mathew W. – 1990, 91 Hermann, Timothy – 1999, 2000, 01 Hernandez, R. – 1890 Herriman, Morris W. – 1917 Herron, Douglas A. – 1971 Hershey, Kirk – 1938, 39, 40 Heskett, Richard M. – 1952 Hettrich, Steven T. – 1989 Hicks, David N. – 1981 Hicks, George C. – 1888 Hicks, Wesley L. – 1972, 73, 74 Hilbush, Donald F. – 1944 Hild, Michael C. – 1995 Hill, Carlos – 2002, 03 Hill, David E. – 1973, 74 Hill, David S. – 1925

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Farace, Franklyn J. – 1982, 83, 84 Farese, Kevin E. – 1998, 99, 2000 Farley, Michael P. – 1986, 87 Farrell, James R. – 1947 Farrington, Thomas H. – 1909 Fauntleroy, Clarence G. – 1951, 52 Faville, Mark R. – 1897 Feagles, Prentiss E. – 1970 Feeney, David W. – 1957, 58, 59 Feiler, Howard R. – 1984, 85 Felitto, Brent W. – 1985, 86, 88 Fennell, Thomas F. – 1894, 95, 96 Fennell, Thomas F., II – 1925 Fenton, John J. – 1959, 60 Ferguson, Keith – 1999, 2000, 01, 02 Ferraro, John J. – 1931, 32, 33 Ferraro, Louis C. – 1963, 64 Ferree, E. H. – 1888 Fetzer, Morrison – 1903 Field, Christopher W. – 1989, 90 Files, Brian E. – 1988, 89 Finley, Brent – 1979, 80 Finley, Mark A. – 1988 Finn, Christopher J. – 1987, 88, 89 Finn, Thomas D., Jr. – 1919, 20 Finnegan, Gregory S. – 1989, 90, 91 Finneran, Frank K. – 1939, 40 Finucane, Thomas R. – 1900 Fischer, Nathan D. – 1997, 98, 99 Fischler, Kenneth J. – 1951 Fitch, Edward H., Jr. – 1895, 96 Fitch, Warren P. – 1973, 74 Fithen, Scott – 1999, 2000, 01 Fitzpatrick, Peter G. – 1991, 92, 93 Fitzsimmons, Clayton - 2003, 04 Flack, John E. – 1888 Fleischmann, Jeffrey R. – 1948, 49, 50 Fleming, Charles A. – 1985 Fleming, Francix X. – 1944, 45 Fleming, J. E. – 1889 Fleming, Michael – 1970, 71, 72 Fleming, Robert B. – 1969, 71 Flemming, Don D. – 1991 Florey, Todd F. – 1979, 80 Floy, Henry – 1890, 91 Flynn, Furlong H. – 1922 Flynn, James W. – 1970 Fochesato, Paul A. – 1983 Foley, Lawrence H., III – 1986, 87 Foley, Michael J. – 1996 Folger, T. W. – 1899 Follett, Donald S. – 1951 Follmar, Troy - 2003, 04 Forbes, William R. – 1954 Foreman, L. Scott – 1977, 78, 79 Forgy, John E. – 1903 Forlano, Bartholomew – 1990 Foster, Arthur N. – 1941 Foster, J. William – 1978, 80 Franklin, Paul A. – 1912 Fraser, Andrew S. – 1988, 1989 Fraser, Lawrence A. – 1960 Fratt, Charles K. – 1950, 1952, 1953 Fratt, Norbert Q. – 1925 Frawley, James F. – 1991 Frederick, Albert J. – 1933, 1934 Freeborn, Angelo C. – 1893 Freeborn, Faun W. – 1893, 1894, 1895 Freeman, John P. – 1983 French, Jeffrey H. – 1966 Frick, Allen J. – 1913 Fritz, William H., Jr. – 1911, 1912, 1913 Frontero, David M. – 1992 Frontero, James S. – 1984, 1985, 1986 Frontero, John D. – 1981, 1983 Fuller, John D. – 1992 Fullerton, Stuart H. – 1964 Furbush, Richard I., Jr. – 1968, 1969, 1970 Furman, Fred J. – 1904, 1905 Furman, Harry B. – 1942, 1943, 1946 Fusco, Douglas D. – 1981 Fusco, James E. – 1961, 1962

103

HISTORY Hill, Edward A. – 1911, 12, 14 Hill, Harrold H. – 1896 Hill, Theodore W. – 1890 Hilliard, James - 2003 Hindman, Richard E. – 1990 Hinman, William W. – 1966 Hipolit, Kasimer E. – 1940 Hirsch, Robert J. – 1942, 45 Hite, Andrew C. – 1992 Hoaglin, George Frederick, III – 1992 Hodson, Spencer J. – 1987 Hoekelman, Harold – 1926, 27 Hoff, Edwin J. – 1919, 20 Hoffman, Arthur L. – 1916, 17 Hoffman, Carl T. – 1928 Hoffman, Kenneth G. – 1959, 60, 61 Hoffman, Sargent G. – 1909 Hofher, James M. – 1976, 77, 78 Hofstetter, Gregg A. – 1983, 84 Holland, Carl R. – 1946, 47 Holland, Jerome H. – 1936, 37, 38 Holland, Joseph H. – 1976, 77, 78 Holleran, Matthew – 1999, 2000, 01 Homan, Stuart – 2004 Homicz, A. Joseph, Jr. – 1964, 65, 66 Hood, Michael T. – 1997, 98 Hooker, Danny W. – 1992 Hooper, Elliot H. – 1935, 36, 37 Hoover, Donald P. – 1954, 55 Hoover, Joseph M. – 1977 Horn, Robert W. – 1967 Horrell, Stephen B. – 1919, 20 Horrigan, Stephen P. – 1973, 74, 75 Horton, Elmer G. – 1890, 91 Howell, William G. – 1887, 88 Hrtko, Daniel – 1944 Hubbell, Nelson E. – 1943 Huff, Dennis A. – 1967, 68, 69 Hughes, Edward E., II – 1935, 36, 37 Huling, William W. – 1967 Hull, Joseph – 2000 Hull, Lyndon C. – 1949, 50, 51 Hummel, Frank K. – 1951, 52, 53 Hummer, Eugene J. – 1948 Humphrey, Larry A. – 1975, 77 Humphrey, Malcolm J. – 1987 Hunt, Paul N. – 1928, 29, 30 Hunt, Sanford B. – 1900, 01, 02, 03 Hunter, Chad E. – 1994, 95, 96 Hunter, George P. – 1928 Hunter, Oscar L. – 1893 Huntington, Lowell S. – 1917 Hurlburt, Russell B. – 1908, 09 Hutchinson, Alfred H. – 1908 Hutchinson, Edward M. – 1933, 34, 35 Huyghue, Michael L. – 1981, 82, 83 Hyman, John W. – 1951, 55

WWW .CORNELL B IG R ED . COM

III

104

Idziur, Stephen – 1983 Iliff, Bernard F. – 1958, 59, 60 Ingham, Doug J. – 1993, 94, 95 Inserra, John G. – 1986 Intihar, Stanley V. – 1953, 55 Irving, Frank J. – 1932, 33, 34 Isaly, Henry W. – 1924, 25, 26 Itin, Thomas W. – 1955, 56 Iverson, Peter E. – 1998, 99, 2000, 01

JJJ Jackson, Anthony - 2003, 04 Jackson, Fred E., Jr. – 1987 Jackson, Hiram E. – 1985 Jackson, Richard C. – 1953, 54, 55 Jacobs, Theodolph H. – 1967, 68, 69 Jaeckel, John E. – 1950, 51, 52 Jaeger, Craig R. – 1976, 77 Jaicks, Frederick G. – 1939 James, Lewis R. – 1902 Jameson, William H., Jr. – 1915 Jamieson, J. H. – 1906 Jamin, Michael F. – 1991, 92 Jandrain, Jay J. – 1988

2005 FOOTBALL

Jaso, John P., Jr. – 1945, 46, 48, 49 Jean, Donald C. – 1969, 70, 71 Jenkins, Irving A. – 1935 Jenkins, Jason G. – 1989, 90, 91 Jenkins, Raymond – 1939, 40, 41 Jennings, Bruce D. – 1978 Jensen, Eric F. – 1948, 49, 50 Jentes, Clarence E. – 1962, 63, 64 Jerome, James F. – 1949, 50, 51 Jewett, Rexford W. – 1915, 16 Joehl, Robert A. – 1970, 71, 72 Johanson, C. M. – 1890, 91, 92 Johnson, David E. – 1974, 75, 76 Johnson, Donnell A. – 1985, 87 Johnson, Howard S. – 1927, 28, 29 Johnson, Jeffrey T. – 1985, 86 Johnson, Kenneth A. – 1984, 85, 86 Johnson, Mauritz I. – 1928 Johnson, Michael E. – 1978, 79, 80 Johnson, Paul N. – 1969 Johnson, Richard W. – 1972, 73, 74 Johnson, Roy V. – 1940, 41, 42 Johnson, Ward C. – 1985, 86 Johnston, Joshua - 2003, 04 Johnston, Malcolm W. – 1958 Jolly, John R. – 1972 Jones, Michael W. – 1982, 83, 84 Jones, Reno V. – 1921 Jordan, Joseph B. – 1989 Joyce, Stephen L. – 1994, 95 Juvonen, Frank Norman – 1957, 58

KKK Kadivar, Kam – 1985 Kaiser, Frederick M. – 1964, 65 Kalinich, Paul T. – 1952, 53, 54 Kamon, Mark S. – 1974 Kanich, Joseph J. – 1928, 29 Kaplan, Jeffrey M. – 1979, 80 Kaplun, Thomas P. – 1998, 99, 2001 Kapsky, Mark S. – 1973, 74, 75 Kasparian, Jack H. – 1939 Kasserman, Ronald W. – 1951, 52 Katz, Bernard – 1927 Kaufman, Dudley S. – 1964, 65 Kavensky, Kenneth J. – 1960, 61 Kaw, Edgar L. – 1920, 21, 22 Kay, Harry R. – 1920 Keane, Kevin A. – 1988, 89 Kearney, Francis , Jr. – 1923, 24, 25 Kefgen, J. Keith – 1983 Keith, Arthur – 1981, 82, 83 Kelley, Alva E. – 1938, 39, 40 Kellner, John – 2001, 02, 03 Kelly, Edward J. – 1911 Kelly, John C. – 1996, 97 Kemp, Robert W. – 1992 Kennedy, Andrew R. – 1985 Kennedy, John P. – 1991 Kennedy, William E., Jr. – 1935, 36 Kenny, Sean M. – 1982, 83, 84 Kensinger, Timothy – 1982, 83 Kent, Ralph S. – 1901 Kessler, Howard F. – 1931 Kiesendahl, Bradley J. – 1996, 97 Kilburn, Lyman A. – 1900 Kilcoyne, John T. – 1979, 80 Killian, John C. – 1969, 70, 71 Kilmartin, William W. – 1968 Kimichik, David J. – 1980, 81 Kincaid, John H. – 1966, 67, 68 King, James V. – 1986 Kingrey, Derek – 2000 Kinne, H. E. – 1900 Kintigh, David A. – 1976, 77, 78 Kirk, Rodney E. – 1952 Kirk, William T. – 1949, 50, 51 Kirsanow, Peter – 1974 Kitlowski, Bradley – 2001, 02, 03, 04 Kleiber, Douglas A. – 1966, 67, 68 Kline, Philip S. – 1931 Knapp, Christopher D. – 1985, 86 Knapp, Gerald T. – 1955, 56, 57 Knauss, Walter P. – 1919, 20

AND

Knauss, Walter P. – 1951, 52 Kneen, Ferris P. – 1927, 28 Kneen, Harold F. – 1923, 24 Knight, Charles F. – 1955, 56 Knight, Peter S. – 1970, 71, 72 Knopp, Doug M. – 1993, 94, 95 Knopp, Gregory W. – 1991 Knowles, James G. – 1984, 85, 86 Knuff, James M. – 1971, 73 Knuff, John P. – 1971, 72, 73 Kobin, Thomas R. – 1987 Koehler, Kevin J. – 1993 Koerber, Jeb – 1984 Kolb, Todd L. – 1950, 51, 52 Konstanty, Jared A. – 1993, 94 Kopicki, Ronald J. – 1965, 66, 67 Koska, John A. – 1949 Kossack, Nathaniel E. – 1931, 32, 33 Kostes, William V. – 1946, 47, 49, 50 Kotler, Steve – 1981 Kovach, John M. – 1962 Kowalski, Raymond – 1972, 73 Koza, Terrence R. – 1994, 95 Kozel, Michael S. – 1969 Kramer, Irvin A. – 1949, 50, 51 Kratch, William H., III – 1981 Krawczyk, Eric M. – 1995, 96, 97 Kretz, Walter A. – 1942, 46, 47 Krutzsch, Armin , Jr. – 1909 Kuhman, Jonathan L. – 1994 Kuhn, Ryan – 2004 Kunit, Eugene R. – 1963, 64 Kutz, Richard H. – 1942 Kwiatkoski, Paul C. – 1974

LLL LaBeau, Timothy R. – 1974, 75, 76 LaBonte, Clarence V. – 1956 Ladas, George T. – 1958 Lafey, Curtis W. – 1939 Lahr, Charles – 1913, 14 Lahr, Steven C. – 1971, 72, 73 Lajoie, Gerry L. – 1994 Lally, Michael J. – 1984, 85 Lally, Robert M. – 1971, 72, 73 Lamb, John P. – 1935 Lamb, Thomas , III – 1977, 78, 79 Lambert, Craig E. – 1970, 71 Lampkins, James W. – 1961, 62 Landrum, Jason P. – 1998, 99, 2000 Landsberg, Mortimer W., Jr. – 1939, 40 Lang, Robert H. – 1947 Langan, Douglas J. – 1986, 87, 88 Lanker, Greg – 1979, 80 Lanman, Henry A. – 1935 Lansing, Theodore H. – 1941, 42, 46 Larkin, Patrick E. – 1902 LaRochelle, Paul J., Jr. – 1975 Larrowe, Dwight M. – 1912 Larson, Albert L. – 1930 Larson, H. Peter, III – 1964, 65, 66 Larson, Per B. – 1994 LaScala, Anthony J. – 1942, 43 Lautz, Edward G. – 1914 Laux, Clinton C. – 1945 LaVoy, Russell E. – 1971 Lawence, Norman S. – 1903 Lazor, Daniel J. – 1995 Lazor, William V. – 1991, 92, 93 LeBorgne, Thomas M. – 1997 Lechler, George P. – 1921 Lee, Charles R. – 1960 Lee, Harold B. – 1896, 97 Lee, Mitchell D. – 1987, 88, 89 Lee, Peter J. – 1981, 82, 83 Lee, Terrence – 1975, 76, 77 Leggiero, James C. – 1992 Lempa, Ryan – 2002, 03, 04 Leo, Edward – 1951 Leonard, Daniel J. – 1976, 77, 78 Lesczinski, Michael R. – 1976 Leven, Robert J. – 1990 Leventry, Ray L. – 1908 Levine, Ronald R. – 1983

RECORDS

HISTORY

AND

RECORDS

Levitas, Ethan – 1991, 92 Levitt, Chad A. – 1993, 94, 95, 96 Lewis, David H. – 1989 Lewis, James N. – 1977 Lewis, John A. – 1939 Lewis, John T., Jr. – 1980, 81, 82 Lewis, Richard N. – 1954 Licht, George – 1976, 77, 78 Lies, Bennett F. – 1902 Lightcap, Kerry M. – 1985 Lill, Charles G. – 1978 Linagen, Robert J., IV – 1978, 80 Lins, Donald M. – 1944 Lipic, Stephen J. – 1984, 85, 86 Lipinski, Richard – 1958, 59, 60 Little, Gordon R. – 1982 Litwin, Seth E. – 1993 Litzelman, John H. – 1950 Livingston, Victor M. – 1969, 70 Lofton, Jimmy T. – 1977 Logue, C. R. – 1987, 88, 89 Lomax, Clarence S. – 1890 Lombardo, Daniel W. – 1972 Lorditch, James T., Jr. – 1974, 75, 76 Loux, Albert J. – 1947 Lowe, G. – 1888 Loyd, Philip A. – 1979, 80, 81 Loynd, Richard B. – 1944, 45, 48, 49 Lubozynski, Dennis J. – 1969, 70 Lucas, Jonathan - 2003, 04 Lucas, Thomas G. – 1965, 66 Lueder, Archie B. – 1896, 97 Lueder, Charles A. – 1898, 1900, 01, 02 Lueder, Francis A., Jr. – 1929, 30 Lundin, Harry W. – 1931 Lutz, Steven E. – 1986, 87, 88 Lyle, H. M. – 1895 Lynah, James – 1903, 04 Lynch, Charles B. – 1957 Lynch, John A. – 1907 Lyon, Charles A. – 1905 Lyon, Robert N. – 1928 Lyons, Mark E. – 1980

M M M

Miller, Jay B. – 1967, 68 Miller, Jeff – 1979, 80 Miller, Mark G. – 1981, 82, 84 Miller, Moreno G., II – 1977, 78 Miller, Peter P. – 1915, 16, 19 Miller, Richard J. – 1969, 70, 71 Miller, Scott A. – 1988 Miller, William R. – 1896 Millhouse, Scott A. – 1973, 74, 75 Milne, Robert S. – 1961, 62, 63 Milosevic, George – 1970, 71, 72 Miner, Harry G. – 1920 Mitchell, Charles J. – 1998, 99, 2000 Mitchell, Stuart A. – 1985, 86 Mockapetris, David L. – 1973, 74 Molinet, Ignacio S. – 1924, 26 Mollica, Joseph – 1975 Monago, Frank A. – 1987, 88, 89 Monahan, David J. – 1975, 76, 77 Montgomery, Louis , Jr. – 1978 Moody, Jonathan – 2004 Moore, Michael C. – 1966 Moore, Patrick B. – 1990, 91 Moran, Dennis P. – 1968 Moran, Henry A. – 1939 Moran, John M. – 1962, 63 Morehouse, Edward J. – 1969, 70 Morello, David A. – 1992 Moresco, Christopher J. – 1980, 81 Moresco, Joseph B. – 1997, 98 Moresko, John C. – 1969, 71 Moretti, James M. – 1972, 74 Morgan, Jason – 2002 Moriarty, Jamie – 1999, 2001, 02 Moricco, Michael V. – 1998 Mork, Kyle – 1999, 2000, 01 Morosetti, Christopher J. – 1998, 99, 2000 Morris, David P. – 1967, 68 Morris, John F. – 1954 Morris, Robert – 1923, 24 Morrison, A. B. – 1898, 99, 1900 Morrissey, J. Neil – 2001, 02, 03 Morrissey, William D. – 1981, 82 Morton, C. C. – 1896 Mosely, E. A. – 1891 Mosser, Stacy C., Jr. – 1941, 42, 46 Moulton, William H. – 1936, 37 Mowe, Homer G. – 1908 Mower, Ronald W. – 1970 Muccio, Mike S. – 1998, 99 Mueller, Lucien W. – 1915, 16 Muha, Robert A. – 1979 Muldowney, Christopher A. – 1993, 94 Mullenhoff, Paul J. – 1981 Munk, William E. – 1909, 10, 11 Munns, David A. – 1920, 21 Munns, John J. – 1911, 12, 13 Munns, Ralph B. – 1924, 25, 26 Munsick, Donald B. – 1914 Murdock, Frank K. – 1931, 32, 34 Murphy, Dennis J. – 1952, 53, 54 Murphy, John F. – 1957, 58 Murphy, William J., III – 1965, 66, 67 Murphy, William J., Jr. – 39, 40 Murray, William – 1972 Musmanno, Richard A. – 1965, 66, 67 Musquiz, Gilbert – 2000

NNN Namack, W. H. – 1900 Nash, Colin – 2004 Nash, Robert A. – 1912 Nassoiy, Sean - 2003, 04 Navarre, Jeff J. – 1986, 87 Nazarro, Sam – 1981 Nedde, Norman A. – 1954 Nees, Louis A. – 1982 Nehrer, Daniel C. – 1941 Nelson, John – 2002 Nelson, Karl J. – 1935, 36, 37 Nelson, Phillip M. – 1933, 34 Nethercot, David G. – 1917 Neuman, Scott J. – 1991 Newell, Gabriel – 2004

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Macaluso, Anthony – 2004 MacArthur, Edward G. – 1908 MacDonald, Alan – 1904 MacDonald, Murdo G. – 1943 Macdonald, Thomas – 1976, 77 Maceyko, William S. – 1943 Machikas, Michael C. – 1981 MacKenzie, William D. – 1919 MacLachlan, Mark A. – 1995 MacLeod, Russell A. – 1950, 51, 52 MacLeod, Thomas D. – 1967, 68, 69 MacMeekin, Trevor – 2002, 03, 04 Madea, Jarad – 1999, 2000, 01, 02 Maentz, Hans S. – 1991 Magee, John A. – 1988 Magee, Noah D., Jr. – 1972 Maglisceau, Ralph Edwin – 1958, 59 Maguire, Shawn F. – 1983, 84, 85 Mahoney, Philip J. – 1990 Mahony, John J. – 1990 Majeske, Michael A. – 1977 Mako, Mark D. – 1991, 92 Malaga, Scott S. – 1986, 87, 88 Malavarca, Steven – 1974 Mallett, Mark G. – 1984 Mallory, Henry R. – 1913 Malm, Robert – 1950 Malone, Daniel P. – 1972, 73, 74 Malone, Thomas J. – 1984, 85, 86 Maney, Kevin M. – 1993, 94 Mannings, Ardrell A. – 1988, 89, 90 Manz, Keith R. – 1978, 79 Marchant, Reginald C. – 1949, 50, 51 Marciniak, Theodore A. – 1952, 54 Marcucci, Paul A. – 1968, 69 Marcus, Kevin M. – 1990, 91 Marcus, Peter M. – 1935 Marinaro, Edward F. – 1969, 70, 71 Marino, William G. – 1975

Marotta, Joseph L. – 1954 Martin, Andrew G. – 1990, 91 Martin, Joseph L. – 1941, 46 Martin, Paris – 1905 Martinez-Zorrilla, Cristobal M. – 1929, 30, 31 Martinez-Zorrilla, Jose – 1930, 31, 32 Marzec, Karl S. – 1985 Mason, C. B. – 1894 Massy, John P. – 1990, 91, 92 Masterson, Ryan C. – 1993, 94 Mateo, Ronald M. – 1992, 93, 95 Mathewson, Richard S. – 1953, 54 Matthews, Kevin L. – 1992 Matuszczak, Allen W. – 1969, 70, 71 Matuszczak, Walter J. – 1938, 39, 40 Maxwell, J. Brandon, III – 1981, 82, 83 May, Charles C. – 1907 Mayer, Clyde – 1919, 20 Mazoue, Christopher G. – 1990, 91 McAllister, Patrick E. – 1903 McAniff, Robert J. – 1955, 56, 57 McArthur, Frank – 1944 McAtee, Richard S. – 1989, 90 McAuley, Sean M. – 1988 McCallie, Edward L. – 1907 McCandless, Peter – 1974 McCarthy, John D. – 1961, 62, 63 McCarthy, John R. – 1950, 51, 52 McCarthy, Kevin C. – 1981, 82 McCollum, Joseph G. – 1908 McCombs, John W. – 1997, 98, 99 McCullen, Arthur – 1966, 67, 68 McCullough, Harold F. – 1938, 39, 40 McCurdy, Ronald J. – 1975, 76, 77 McCutcheon, Kenneth C. – 1914 McDermott, Timothy R.D. – 1992, 93, 94 McDevitt, Timothy M. – 1987 McDonnell, James C. – 1976 McDowell, John G. – 1887, 88, 89 McEnderfer, Timothy D. – 1968 McEneaney, Eamon J. – 1974, 76 McFarlin, Brian – 1979 McFarren, Michael H. – 1968, 69 McGinty, Michael – 2002, 03, 04 McGowin, John – 1928 McGrann, Michael N. – 1985, 87, 88 McGuire, Robert A. – 1986 McHale, Thomas – 1986 McHugh, Bernard J. – 1961 McIntosh, Brick E. – 1969 McKean, Michael – 1992, 93, 94 McKeever, William – 1895, 96, 97 McKeever, William W. – 1936, 37, 38 McKelvey, David E. – 1959, 61 McKeown, John P. – 1971, 72 McKinney, Timothy D. – 1982, 83 McLaughlin, Daniel M. – 1895, 97 McMahon, Bruce – 1976 McMahon, Daniel J. – 1983, 84, 85 McMillan, Londell – 1985, 86 McNiff, John M. – 1989, 90, 91 McWeeney, George E. – 1965, 66 Mead, Jerry W. – 1942 Meade, E. Richard – 1953, 54, 55 Meagher, Robert G. – 1935, 36, 37 Meaney, Joseph J. – 1974, 75, 76 Meeker, Martin W. – 1977 Megaro, John – 2001, 02, 03 Mehaffey, Albert B. – 1914 Meiss, Frederick L. – 1934 Mellon, David L. – 1962, 63, 64 Melstrom, Kurt A. – 1997, 98 Menapace, David M. – 1981, 82 Merdes, Edward A. – 1946 Merz, Stuart O. – 1950, 51 Metz, Christopher F. – 1981 Metzler, Charles W. – 1949, 50, 51 Michalewicz, Paul J. – 1980, 81, 82 Micklavzina, Frank C. – 1949, 50, 51 Milanes, Angel – 1981 Miles, David G. – 1964 Miles, Stephen W. – 1954, 56 Miller, Dan R. – 1987, 88 Miller, Frank M. – 1948, 49, 50 Miller, Granbery – 1911, 12

105

HISTORY Newell, Todd – 2001, 02, 03 Newhall, John – 1904, 05 Newman, William S. – 1903, 05, 06 Newsom, Rosco – 1999, 2000, 01, 02 Newton, Malcolm R. – 1967, 68 Newton, Mark L. – 1973 Nice, Chad – 2001, 02, 04 Nichols, Guy H. – 1943 Nichols, John S. – 1910 Nichols, Reginald W. – 1971, 72 Nicholson, Todd A. – 1987, 88, 89 Nicoletti, Richard A. – 1958, 59 Noel, Steve – 1982 Norman, George C. – 1963, 64 Norris, Joseph M. – 1996, 97 Noziglia, Dave – 1981 Nunes, Thomas M. – 1995, 96, 97, 98 Nunn, Harold F. – 1933, 34, 35

OOO O’Connor, Bernard – 1911, 12 O’Connor, John J. – 1909, 10 O’Hagan, Michael J. – 1974 O’Hearn, John E. – 1912, 13, 14 O’Neill, William B. – 1977 O’Rourke, Bernard J. – 1905, 06, 07, 08 O’Rourke, Frank H. – 1910, 11 O’Shaughnessy, Patrick E. – 1995 Oderkirk, Charles C. – 1904, 05 Ohl, W. F. – 1893, 94 Oliaro, Scott M. – 1989, 90, 92 Olney, Carl W. – 1921 Olszowka, Paul T. – 1988, 89 Oniskey, Leonard J. – 1952, 53, 54 Opre, Brian G. – 1996 Orel, Anthony J. – 1969, 70, 71 Ortega, Jose L. – 1977 Osgood, Winchester D. – 1888, 89, 91, 92 Osterhout, Glenn R. – 1975, 76 Otis, James C. – 1899, 1900 Otto, Samuel C. – 1925 Owen, Chauncey C. – 1909

WWW .CORNELL B IG R ED . COM

PPP

106

Page, Gerald F. – 1961, 62 Paige, Tommaso J. – 1995 Palazzese, Jeffrey P. – 1983, 84 Palmer, Charles A. – 1944 Palmisciano, Robert M. – 1961 Palumbo, Robert C. – 1979, 80, 81 Papich, Donald – 1974, 75, 76 Paquette, Patrick L.P. – 1992, 93 Paraskevopoulos, George – 1999, 2000, 01 Pardi, Paul - 2003, 04 Parke, Evan D. – 1987, 88, 89 Parker, Charles E. – 1928 Parker, James S. – 1887 Parr, Charles C. – 1969 Parris, Michael – 1999, 2000, 02 Pascal, Anthony A. – 1959, 60, 61 Pascavage, Peter P. – 1946, 47 Passalacqua, John E. – 1982, 83, 84 Pastuck, Henry F. – 1946, 47 Patterson, Jeffrey P. – 1967, 68 Patterson, Robert F. – 1923, 24 Pattison, D. B. – 1966 Patulski, Richard – 1981, 82 Paul, Anthony C. – 1985 Paul, Francis G. – 1941, 42 Payne, Charles T. – 1974, 75, 76 Payne, Seth C. – 1994, 95, 96 Pearlman, Marc J. – 1985, 86, 87 Peck, George W. – 1936, 37, 38 Pegan, Robert L. – 1966, 67, 68 Pegnetter, Eugene F. – 1963, 64 Peirce, Andrew W. – 1934, 35 Pendleton, Fields S., Jr. – 1917, 19, 20 Pennucci, Patrick J. – 1960 Penny, Wilford B. – 1930, 31 Penttinen, Eric W. – 1990, 91 Perkins, Fred C. – 1897, 98 Perrello, James V. – 1983, 84, 85 Pfann, Bruce W. – 1957, 58

2005 FOOTBALL

Pfann, George R. – 1921, 22, 23 Pfeffer, Walter F. – 1941 Pfeiffer, Egbert W. – 1934, 35, 36 Philippi, Carl A. – 1913, 14 Phillips, John D. – 1973, 74 Phillips, Michael E. – 1971, 72, 73 Pick, Herbert L. – 1951 Picking, Howard M. – 1958, 59 Pickup, Robert F. – 1992 Pierce, Burdick W. – 1935 Pierce, Samuel R., Jr. – 1941 Pierik, John G. – 1948, 49, 50 Pierik, Peter G. – 1949, 51 Pierson, Douglas C. – 1952 Pierson, John C. – 1899 Pinnie, Mark S. – 1977 Piscitelli, Mark M. – 1970, 71 Pitkin, David W. – 1960 Pitman, David I. – 1996, 97, 98, 99 Pogorzala, Arthur E. – 1984 Polichene, Joel W. – 1981 Politi, Frank J. – 1934, 36 Politi, George J. – 1941, 42 Pollak, Julian A. – 1905, 06 Pollin, David B. – 1987, 88 Pollock, Matthew – 2003, 04 Pond, Edward F. – 1930 Ponsaran, Bruce – 2000 Ponzer, William D. – 1961, 62, 63 Popielinski, James G. – 1971, 72, 73 Portuondo, Kevin L. – 1996 Posner, Jay – 1999, 2000, 01 Potash, Kenneth N. – 1989, 90, 91 Potter, Richard J. – 1952 Potts, Patrick - 2003, 04 Powers, John E. – 1945 Pozzobon, Steve V. – 1984, 85 Pratt, Douglas J. – 1982, 83 Pressley, Todd O. – 1983, 84, 85 Prevost, John – 1990 Printy, Dale B. – 1988, 89 Printy, Donald C. – 1988, 90 Profuseck, Robert — 1969 Prospero, Michael J. – 1981, 82 Pugh, Sol – 1986 Pujo, Victor A. – 1949, 50, 51 Purcell, Henry , Jr. – 1900, 01, 02 Purdy, William J. – 1954 Puterbaugh, John L. – 1933, 34 Pych, Joseph T. – 1989 Pyle, Cyrus – 1927 Pyle, James W. – 1965 Pyott, Albert E. – 1950, 51, 52

QQQ Quarles, David A. – 1986, 87 Quigg, Richard L. – 1941 Quinby, James D. – 1950, 51, 52 Quinn, Brian – 1978 Quinn, Joseph F., Jr. – 1945, 46, 47, 48

RRR Rackeman, William F. – 1887 Radway, Homero J.F. – 1998 Rafalski, Larry D. – 1966, 67, 68 Raga, Tom – 1987 Rahne, Ricky – 1999, 2000, 01 Raich, Michael – 1985, 86, 87 Rakowski, John T. – 1945 Rakowski, Thomas J. – 1970, 71 Ramin, Richard M. – 1948, 49, 50 Ramsey, Floyd D. – 1921, 22, 23 Rand, Richard N. – 1988, 89 Randall, Glenn D. – 1990, 91 Rankin, George C. – 1934, 35 Rao, Arjun - 2003 Rapuano, Michael – 1925, 26 Ratner, Phillip – 1963, 64, 65 Rauch, Martin W. – 1984, 85 Raymond, Richard T. – 1923 Razzano, Michael – 2002, 03 Reade, Scott C. – 1991, 92 Ready, Michael J. – 1987, 88

AND

Reardon, Kurt F. – 1983, 84 Reback, Brad R. – 1991 Reed, Daniel A. – 1896, 97, 98 Reed, Henry M., Jr. – 1924 Rees, Arthur F., Jr. – 1913 Reese, David L. – 1960 Reherman, Leo J., Jr. – 1985, 86, 87 Reiber, Richard H. – 1931 Reilly, Brendan M. – 1995, 96 Reimund, Todd E. – 1985, 86, 87 Reinking, Daane – 2000, 01 Rejda, Ronald R. – 1979, 80 Rems, Jeffrey I. – 1982 Renzi, Eugene M. – 1951, 52 Reuther, Bernard P. – 1917 Revak, Thomas W. – 1957, 58, 59 Rex, Kevin - 2003, 04 Reynolds, Peter M. – 1990, 91 Reynolds, Thomas C. – 1979 Rice, Lawrence J. – 1903, 04 Richard, Rob – 1988 Richards, Bartlett – 1922 Richards, Thomas C. – 1997, 98, 99 Richards, William R. – 1927 Richardson, Earl - 2003, 04 Richberg, Michael R. – 1979 Richie, David R. – 1895, 96 Rickell, David A. – 1993, 94, 95 Ridley, Jason S. – 1996 Riekert, Herbert J. – 1929, 30 Riescher, Robert J. – 1989 Rigueur, Philip – 1997, 98, 2000, 01 Riley, Johnny – 1976 Ring, Timothy M. – 1976, 77, 78 Rinkus, Gary J. – 1985, 86, 87 Riordan, Michael R. – 1949 Ripley, Robert H. – 1896 Ritchie, Graham M., Jr. – 1981, 82 Ritter, Christopher – 1966, 67, 68 Ritz, Robert J. – 1960, 61 Roadhouse, Chester L. – 1905 Roark, Michael – 1991 Robb, Stewart E. – 1909, 10 Robbins, Percy A. – 1893 Roberson, Irvin – 1955, 56, 57 Robertson, William B. – 1967, 68 Robeson, Paul , Jr. – 1944, 45, 47 Robinhold, Daniel G. – 1925 Robinson, Charles R. – 1941, 42 Robinson, Joseph R. – 1962, 63 Rochow, Frank R. – 1941 Rochow, Richard F. – 1941 Roderick, William M. – 1955 Rodin, John – 1994, 95, 96 Rodriguez, Jesse – 1999, 2000, 01, 02 Rogers, C. E. – 1894, 95 Rogers, John B. – 1942, 46, 47, 48 Rohlfing, Thomas J. – 1978, 79, 80 Roland, Paul – 1979 Roll, Charles S., Jr. – 1965, 66, 67 Rollo, Walter R. – 1922 Roman, Marshall – 1978 Romano, Wayne – 1988 Romney, Brian – 2004 Romney, Edgar H. – 1998, 99, 2000 Roney, Matthew J. – 1995 Rooks, Mark – 1989 Rooney, Kevin – 2001, 02, 03 Rooney, Thomas S. – 1952, 53, 54 Rooney, Thomas S., Jr. – 1981 Rose, Charles N. – 1995 Rose, Robert M. – 1936, 37, 38 Rosecrans, James A. – 1984 Rosenberg, Lester J. – 1925, 26 Ross, Steve P. – 1980, 81 Rosser, Barrett E. – 1970, 72 Rossiter, William G. – 1934, 36 Roth, A. Sidney – 1936, 37, 38 Roth, Brandon A. – 1987, 88 Roth, Thomas H. – 1978, 79, 80 Rothstein, Nathan – 1930, 31 Rousseau, Henry H., Jr. – 1929 Rowe, Norman L. – 1954 Rowlands, Thomas P. – 1969, 71 Royer, Paul A. – 1981, 82, 83

RECORDS

HISTORY

AND

RECORDS

Rubenstein, Kenneth J. – 1981 Rubin, Harry – 1944 Ruby, Jeffrey B. – 1968, 69 Rucker, James C. – 1942 Ruddy, Michael J. – 1939, 40 Rudiman, Andrew , Jr. – 1975 Rupert, David C. – 1976, 77, 78 Russell, Robert H. – 1944 Russo, Richard J. – 1971, 72, 73 Ruth, Lloyd D., Jr. – 1966, 68 Rutledge, James E. – 1938 Ryan, John F. – 1987, 88 Ryan, Joseph E. – 1963, 64 Ryan, Joseph R. – 1956 Ryan, Michael W. – 1978, 79, 80 Ryder, Robert O. – 1988, 89, 90 Ryerson, Robert E. – 1916

SSS

Sprinkle, Theodore A. – 1965 Sprow, Otis W. – 1968 Stadnik, Jason – 2001, 02, 03, 04 Stahl, Russell – 1976 Stahl, Samuel S. – 1937 Stallone, Martin J. – 1985, 86 Stancampiana, Louis – 1943 Starbuck, Frank M. – 1894, 95 Starbuck, Raymond D. – 1898, 99, 1900 Stark, Lawrence – 2000, 01 Starks, Claude Bruce – 1973, 74, 75 Starleper, Patrick - 2003, 04 Staun, Michael A. – 1978, 79, 80 Steinberg, Richard W. – 1928 Stenstrom, Jeffrey D. – 1994 Stento, Gregory V. – 1981 Stephens, William H. – 1968, 69, 70 Stevens, Joel – 1988 Stevens, Miles R. – 1929 Stiles, Earl W. – 1934 Stilwell, Winslow W. – 1941 Stimson, Richard L. – 1940 Stimson, Silas N. – 1911 Stofer, Gordon F. – 1934, 35 Stofer, Kenneth L. – 1940, 41 Stone, Michael – 2000, 01, 02, 03 Storto, Richard M. – 1969, 70 Stoviak, Francis S. – 1945 Strait, H. B., Jr. – 1890, 91 Stranahan, William – 1887 Straus, Henry H. – 1917, 19 Stremick, Jerome H. – 1961, 62 Strick, Michael E. – 1962, 63 Strigel, Michael J. – 1987, 88, 89 Stroud, Michael D. – 1994 Stuckert, Michael J. – 1991 Studnicka, James R. – 1982, 83, 84 Suiter, James W. – 1956 Sulc, Brian – 1986 Sumida, Aaron R. – 1987, 88 Sundstrom, Frank L. – 1921, 22, 23 Sundstrom, Warren E. – 1958, 59, 60 Supulski, Jeffrey J. – 1977, 78 Suren, Daniel J. – 1980, 81, 82 Susnak, Joe – 1980 Sussman, Joel – 2001, 02 Suter, Albert E. – 1954, 55, 56 Sutton, Francis M., Jr. – 1919 Swan, Kenneth G. – 1992 Swanson, Jarl R., Jr. – 1941, 42 Swanson, Ralph E. – 1917 Swartzwelder, Stephen – 1975 Sweeney, Charles R. – 1941 Sweeney, Jonathan – 2001 Sweetland, Edwin R. – 1895, 96, 98 Swift, David J. – 1949 Switzer, Walter D., Jr. – 1932, 33, 34 Szynalski, Bronislaw – 1973, 74, 75

TTT Tabasso, Anthony P. – 1991 Taber, David F., Jr. – 1912, 14 Taddei, Ernest E. – 1975, 76, 77 Tagliaferri, John S. – 1983, 84, 85 Talierco, John B. – 1955 Talton, Kenneth B. – 1976, 77, 78 Tamulonis, Frank L. – 1965, 66, 67 Tangman, C. H. – 1897 Tanner, Michael A. – 1976, 77, 79 Tansey, John – 1983 Taplin, Dwayne O. – 1979 Tarsi, Nathan - 2003, 04 Tattersfield, James P. – 1929 Taussig, Charles A. – 1899, 1900, 01 Taussig, J. Hawley – 1893, 94, 95, 96 Taylor, Alva – 1980, 81 Taylor, Charles W. – 1948, 49, 50 Taylor, Daniel O. – 1949, 50, 51 Taylor, J. W. – 1896 Taylor, Jeffrey P. – 1991 Taylor, Philip G. – 1957, 58, 59 Taylor, Wilberforce – 1919 Teagle, Ernest H. – 1910 Teeple, George L. – 1887

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Sabia, Edward - 2003 Sacco, Bryan – 1999, 2000, 01 Sadusky, John J. – 1957, 58, 59 Sampson, Harvey E. – 1948, 49, 50 Sampson, Peter G. – 1967 Sanford, Steven P. – 1972 Sansiveri, Sean – 2002 Santamaria, Frank A. – 1977, 78 Santone, Thomas J. – 1973, 74 Saussy, Gordon – 1895 Savage, Bernard A. – 1923 Savitsky, Edward J. – 1956, 57, 58 Saylor, John E. – 1942, 46 Scarton, Charles M. – 1963 Scazzero, William F. – 1950, 51 Schaefer, Frederick A. – 1941 Scherr, Nathan – 1944 Schlichter, Fred P. – 1915 Schmid, Christopher – 1955 Schmuck, James T. – 1939, 40 Schneider, Edward – 1943 Schneider, Joseph F. – 1963, 64 Schnuck, Craig D. – 1969 Schnuck, Scott C. – 1969, 70 Schoales, Dudley N. – 1926, 27, 28 Schoch, L. M. – 1897 Schock, Arthur P. – 1915 Schoellkopf, Henry – 1900, 01 Schoellkopf, Paul A. – 1903 Scholl, W. Brooks – 1969 Scholl, Walter A. – 1939, 40 Scholz, Ralph – 1982, 83 Schrauth, Amandus J. – 1947 Schreck, Leonard B. – 1926 Schreiber, Robert A. – 1963 Schroder, Andrew J. – 1956 Schroeder, Robert A. – 1990, 91 Schuh, Charles R. – 1948, 49, 50 Schumacher, August – 1926, 27 Schumacher, Edward C. – 1933 Schuster, Frank J. – 1973 Schwartz, Herbert – 1944 Schweizer, Michael F. – 1988 Scott, John W. – 1934 Scott, Kevin – 1974 Scott, Martin A. – 1997, 98, 99 Scott, Norman E. – 1927, 28, 29 Scott, Thomas – 1976, 77 Scroger, Rollin – 1980 Scullin, John P. – 1964 Scullin, Richard P., Jr. – 1998 Scully, Daniel T. – 1978, 79, 80 Scully, Michael J. – 1981, 82, 83 Scully, Robert J. – 1944, 45 Seagrave, Clarence N. – 1909, 10 Sebald, J. A. – 1951, 52, 53 Seeley, Harold K. – 1909 Seidenberg, Harold – 1949, 50, 51 Seider, John P. – 1944 Seifert, James W. – 1993, 94, 95, 98 Selsmeyer, Mark P. – 1978, 79 Sepessy, R. Keith – 1977, 78, 79 Shaffer, John M. – 1965 Shank, Paul W. – 1961 Shappee, Robert D. – 1960

Sharafanowich, Edward S. – 1944 Shaub, Harry – 1931, 32, 33 Shavers, John – 1974, 75, 76 Shay, Edward A. – 1969 Shayler, Randy M. – 1970, 71 Shea, David J. – 1980, 81, 82 Shearer, George K. – 1907, 08 Shearn, T. Michael – 1980 Sheble, John H. – 1902 Sheerin, Richard T. – 1995, 96, 97 Sheffer, John W., Jr. – 1936 Sheil, David – 1975 Sheldon, James H. – 1887 Shelton, Murray N. – 1913, 14, 15 Shepard, Alvin W. – 1889, 90 Shepard, Kirk V. – 1970 Shepard, William C. – 1902 Sherman, Larry R. – 1970, 71 Sherrill, James L., Jr. – 1981, 82, 83 Sherwood, Jules D. – 1996, 97, 98 Shields, Carl D. – 1972 Shirley, Paul – 1991 Shiverick, Francis T. – 1915, 16, 19 Short, John C. – 1898, 99 Shuler, Charles – 1913, 14 Shuler, John D. – 1919 Shulman, Matthew A. – 1993, 94 Sibson, Walter W., Jr. – 1927 Sidman, Scott E. – 1982, 83, 84 Sieger, John – 1988 Sigler, Kevin J. – 1974 Silver, Mahingus R. – 1995, 96 Simic, Paul M. – 1989 Simmons, Adrian – 1987, 88 Simmons, Evan – 2000, 01 Simon, Joseph P. – 1953, 54 Simpson, Joseph R. – 1961, 62 Simpson, Timothy A. – 1993 Simson, LeGrand D. – 1909, 10 Siwula, Lukas A. – 2004 Skawski, John – 1945, 47 Skillman, David M. – 1960 Skoczylas, Larry J. – 1975, 77 Skypeck, Thomas J. – 1956, 57, 58 Slisky, Edward J. – 1961, 62 Slocum, Andrew H. – 1993, 94 Slocum, George S. – 1960 Smith, Darryl F. – 1998, 2000 Smith, Deron – 2001, 02 Smith, Eric K. – 1991 Smith, James L. – 1948, 49 Smith, Joseph H. – 1911, 12 Smith, Larry – 1986 Smith, Manasseh , Jr. – 1901, 02 Smith, Randall L. – 1978 Smith, Robert A., Jr. – 1904 Smith, Robert T. – 1967 Smith, Rodney R. – 1964 Smith, Terrence D. – 1994, 95, 97 Snavely, Carl G., Jr. – 1941 Snavely, Francis B., Jr. – 1944 Snider, Warren G. – 1902, 03 Snyder, Cecil O. – 1944 Snyder, Herbert – 1915 Snyder, Kenneth A. – 1969 Solecki, John J. – 1974 Sonnenberg, Theodore – 2004 Sorochinsky, Frank C. – 1953 Sosenko, Arthur – 1954 Souchek, Donald R. – 1945, 46 Soumas, Charles A. – 1951 South, L. Cawood – 1994 Spaller, Jim – 1985 Spang, Carl F. – 1936, 37, 38 Speece, William E. – 1945, 46 Speed, Christopher M. – 1916 Speicher, Matthew A. – 1990, 91 Sperry, Phillip F. – 1967, 68 Spitler, Nate – 1999, 2000, 01, 02 Splendorio, Joseph P. – 1998, 99, 2000 Sponaugle, Martin Y. – 1963, 64, 65 Sponaugle, S. Woodrow – 1959, 60 Sponheimer, John P. – 1966, 67, 68 Spooner, LaVoy , Jr. – 1969, 70 Spoth, David C. – 1976

107

HISTORY Telesh, George G. – 1959, 60, 61 Templeton, Will D. – 1941 Tennant, Thomas E. – 1944 Tenuta, Benjamin G. – 1978, 79, 80 Tenuta, Joshua P. – 1981 Terry, John W. – 1932, 33 Texido, Michael A. – 1986, 87 Thayer, Guy H. – 1887, 89 Thelmas, Larry – 1986 Theodorakos, James T. – 1970, 71, 72 Thomas, David R. – 1900 Thomas, David R. – 1959, 60, 61 Thomas, Kyle – 2002, 03 Thomas, Terence L. – 1981, 82, 83 Thompson, Bryan G. – 1981 Thompson, Elmer I. – 1905, 06, 07 Thompson, Troy F. – 1991, 92 Thornell, Douglas V. – 1997 Tilley, Clarence – 1914, 15 Tilton, Benjamin E. – 1925 Timon, Stephen J. – 1992 Tino, Marcello A. – 1958, 59, 61 Tisdale, Jason – 1999 Toczylowski, Stephen A. – 1945 Tokish, Leonard J. – 1986, 87, 88 Toppe, Robert – 1982 Totten, William H. – 1970 Tourison, George B. – 1903 Towson, Arthur L. – 1927 Tracosas, Jon E. – 1971, 72, 73 Tracy, Lyndon S. – 1896, 97 Tredennick, Harry L. – 1941 Tretter, David J. – 1975, 77 Trimberger, George M. – 1964 Tross, Stuart A. – 1986, 87 Trousdell, James N. – 1939 Troutner, James F. – 1945 Trowbridge, Sherman – 1917, 19 Trumka, Richard - 2003, 04 Tsapis, Stanley – 1951, 52, 53 Tull, Christopher R. – 1985, 86 Tullar, Irving V. – 1929, 30, 31 Tully, John M. – 1943, 44 Tully, Paul H. – 1988, 89, 90 Turel, Anthony P. – 1960, 61, 62 Turley, Mark S. – 1978, 79, 80 Turnbull, R. A. – 1901 Tuths, Philip M. – 1937 Tydeman, Arthur F. – 1908, 09 Tydeman, William A. – 1901, 02

UUU Ulbricht, Brian – 1999, 2001, 02 Underhill, Harry E. – 1911 Unterzuber, Zane R. – 1950 Upcraft, Mark A. – 1987, 88 Upton, Daniel – 1888, 89

WWW .CORNELL B IG R ED . COM

VVV

108

Vadney, Frank R. – 1953, 54, 55 Vago, Steve – 1979, 80 Van Buren, James K. – 1952, 53, 54 Van Order, Edmund , Jr. – 1940, 41 Van Ranst, Alfred F. – 1936, 37, 38 Van Ranst, Alfred F. – 1972 Van Sweringen, Raymond A. – 1970, 71, 72 VanderKaay, Aaron M. – 1994, 95, 96, 97 VanHorn, Ralph C. – 1917 VanMetre, David C. – 1984, 85 Vanneman, Reeve D. – 1965, 66 VanOrman, Ray – 1904, 05, 06, 07 Vattes, Dimitris F. (Jimmy) – 1998, 99, 2000 Vaughn, Dru G. – 1998, 99, 2000 Vegh, Anthony J. – 1975, 76 Verna, Peter J. – 1944 Versteeg, Donald J. – 1974, 75, 76 Villella, Anthony D. – 1991, 92 Vinciguerra, Stephen P. – 1939 Visniski, Ryan – 1999, 2000 Vitale, Frank N. – 1949, 50, 51 Vitullo, Anthony J. – 1998, 99, 2000 Vitullo, John T. – 1992, 93, 94, 95 Vitullo, Ronald A. – 1990, 91, 92

2005 FOOTBALL

Viviano, Bartholomew J. – 1930, 31, 32 Voris, William S. – 1900, 03

W W W Wade, Henry S. – 1924 Wagner, George F. – 1891, 92, 93 Wagner, John D. – 1992, 93, 94 Wagner, Michael R. – 1984, 85 Wahl, John E. – 1920 Waite, James M. – 1970, 71, 72 Wakeman, Samuel – 1927, 28, 29 Walbridge, George B. – 1899 Walder, George H. – 1905, 06, 07, 08 Walker, Daniel M. – 1967 Wallace, George C. – 1929, 30 Wallace, John J., Jr. – 1965, 66 Wallace, John M. – 1932, 33 Walsh, Eamon M. – 1989 Walter, Scott F. – 1981, 82 Walterhouse, Kurt D. – 1981 Walters, Lloyd R. – 1951, 52, 53 Warner, Glenn S. – 1892, 93, 94 Warner, William J. – 1899, 1900, 01, 02 Warren, James R. – 1961, 62 Warrington, John M. – 1987, 88 Washington, Calvin W. – 1974, 75, 76 Wasilewski, Robert J. – 1960, 61 Waterbury, Jackson D. – 1927, 28 Watkins, Ramon L. – 1989, 90, 91 Watson, Charles H. – 1907 Watson, Charles L. – 1996, 97, 98 Waud, Ernest P. – 1902 Webb, Christopher J. – 1986, 87, 88 Webb, H. G. – 1902 Webster, John W. – 1957, 58 Weekes, Charles P., Jr. – 1909, 10 Weggler, Robert K. – 1975, 76, 78 Weidel, Brian C. – 1995, 96 Weideman, Edward A. – 1965 Weidenkopf, Thomas W. – 1978, 79, 80 Weidenthal, Harold G. – 1912 Weinstein, David – 1993, 94 Weiss, Charles P. – 1941 Weitsman, Andrew J. - 2003, 04 Welles, Theodore W. – 1945 Wenmoth, Robert – 1974 Wesson, Andy – 1984 West, Andrew - 2003 West, Frederick W. – 1938, 39, 40 Westcott, Mark E. – 1972 Wester, Frederick E. – 1924, 25 Westfield, Bryan J. – 1962, 63 Westphal, Frederick A., Jr. – 1942, 46, 47 Wetherell, Steve – 1982 Wetzel, Eric D. – 1981, 82 Weyandt, Daniel J. – 1998, 99, 2000 Whalen, Jon – 1988 Wheeler, William S. – 1942, 46 Whelan, William J. – 1950, 51, 52 Whetstone, Walter , Jr. – 1923, 24 Whipple, Kirt R. – 1989, 90 White, Rollin H. – 1890, 91, 92 Whiting, Allen E. – 1896, 97, 98 Whitney, George S. – 1900 Whyte, Jessel S. – 1910, 11, 12 Whyte, Robert B. – 1911, 12 Wickham, Woodward A. – 1926, 27 Wierbinski, Donald S. – 1973, 74, 75 Wight, Harry C. – 1908 Wilder, LaVerne A. – 1904 Wildes, Christopher – 1989 Wilkes, Jeff – 1990 Wilkinson, John – 1887, 88 Williams, Alfred D. – 1913 Williams, Dana P. – 1971, 72 Williams, George E. – 1943, 44 Williams, Kenneth W. – 1980, 81 Williams, Richard D. – 1963, 64 Williamson, George – 1911, 13 Willinger, Gerald F. – 1988, 89, 90 Willmott, Derrick L. – 1987, 88 Wilson, Christopher W. – 1897, 98, 99 Wilson, Edward P. – 1910 Wilson, Griswold , Jr. – 1935

AND

Wilson, Harrison S. – 1933, 34, 35 Wilson, Ian P. – 1996, 97 Wilson, James B. – 1919 Wilson, Ken – 1979 Wilson, P. A. – 1896 Wilson, R. H. – 1888 Wilson, Richard H. – 1972, 73, 74 Wilson, Ronald D. – 1934, 35 Wilson, Terrance M. – 1956, 57, 58 Wilson, William J. – 1951 Wilson, William L. – 1964, 65 Windsor, Philip B. – 1897, 99 Wingerson, Richard N. – 1950 Wise, Matthew – 1999, 2001, 02 Witherbee, George P. – 1891, 92 Witwer, Dale E. – 1965, 66 Wleklinski, Robert E. – 1992 Wolfe, Philip W. – 1955 Wolff, Peter M. – 1940, 41 Wood, Berwick B. – 1908, 09 Wood, Gary F. – 1961, 62, 63 Wood, George A. – 1991, 92 Wood, H. N. – 1889 Wood, Nollie P. – 1973, 74 Woodring, Jeffrey E. – 1990, 91, 92 Woods, David M. – 1992, 93, 94 Worcester, William H. – 1939 Worden, Warren L. – 1927, 28 Woznicki, Julius J. – 1945 Wrampelmeier, Fred J. – 1927, 28 Wright, Winfred B. – 1942, 46, 47 Wyckoff, Clinton R. – 1895 Wydo, Frank – 1946 Wyvell, Manton M. – 1898

YYY Yablonski, Robert F. – 1960 Yanz, Victor B. – 2000, 01, 02, 03 Yavinsky, Merrill – 1985 Yawger, Edwin – 1889, 90 Yerg, Jay E. – 1995 Young, Charles V.P. – 1898 Young, Courtney D. – 1942 Young, E. P. – 1891, 1893, 95 Young, George H. – 1897, 98, 99 Young, George H., Jr. – 1898 Young, George O. – 1930 Young, J. T. – 1888 Young, Spencer C., III – 1975 Young, William W. – 1988

ZZZ Zacek, Richard J. – 1998, 99, 2000, 01 Zack, William – 1974 Zak, Edward P. – 1966, 67, 68 Zander, Roy J. – 1915, 16 Zankowski, John – 1966 Zechman, Russel P. – 1951, 53 Zelko, Russell R. – 1959, 60, 61 Ziegler, William W. – 1936 Zielinski, Bob – 1978 Zielinski, James W. – 1961, 62, 63 Zingo, Chris J. – 1991, 92, 93 Zirkle, Douglas E. – 1963, 64, 65 Ziskind, Cory – 1999, 2000, 01 Zittel, William A. – 1981 Zogby, Peter S. – 1965, 66, 67

RECORDS

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

This Is Cornell University 2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

This Is Cornell

109

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Cornell University/Realizing a Bold Dream Inthemid1800s,twoNewYorkstatesenators,EzraCornell morethan100countries.Interand Andrew Dickson White, shared the bold dream of disciplinarystudyandresearch foundinga“trulygreatuniversity.”Cornell,aplain-spoken areCornellhallmarks,asisatinventor, wanted “an institution where any person can find tentiontoundergraduateeduinstructioninanystudy,”includingthemechanicalartsand cation.Theuniversity’s2,200 agriculture.White,ascholarlygraduateofOxfordandYale, faculty members are active yearnedtoestablishauniversitywhere“truthshallbetaught teachers as well as researchfor truth’s sake” in the arts and sciences. Together they ers—Nobellaureatesoftenconcreated a nonsectarian university that was the first in the ductintroductorycourses—and eastern United States to admit women and that pioneered thelinesoftraditionaldisciplines theconceptofelectivecourses.Theiregalitarianvisionand areeasilycrossed.Engineering innovative ideas, which set Cornell apart at its opening in students dabble in photogra○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ 1868,continuetoguidetheuniversitytoday. Cornell includes 13 colleges and schools. On the Ithaca campus are the seven undergraduate units—the College of Agriculture and Life Sciences; the College of Architecture, Art, and Planning; theCollegeofArtsandSciences;theCollegeofEngineering; the School of Hotel Administration; the College of Human ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ ○ Ecology; and the School of Industrial and Labor RelaU.S. states tions—as well as four from all 50 urbs and phy; theatre arts students explore the me co ds ra graduate and profesworldofcomputers;physicsmajorslearn s underg es, sub day Cornell’ s. They come from citi ound landscapearchitecture. ar y wa lf sionalunits:theGradu- To e ha i r 120 count u grew up or ate School, the Law and National Science Foundation studies e to where yo , sizes, shapes and peros cl s, ea ar l cal. on programs in research and developl colors hi al op in os School, the Johnson rura il me ph co , obe. They l, sexual , artists, Graduate School of the gl — religious, politica ors, athletes essors, mentatU.S.universitiesconsistently ns nt io ve as in su s, an Management, and the rank Cornell among the top 10 or 11 prof sici students — mu rising doctors, lawyers, ers, sysCollege of Veterinary Gifted in total research and development s; gn er si rm de l fa pare ets, nanciers, ap r organizers — who expenditures,andinfederally Medicine. (The Weill actors, po fi s, er ne gi m en labo think- financed expenditures. Medical College and the scientists , political activistsm ts ers, creative ys ev al hi an ac g in nd Weill Graduate School of tems Cornell ranks second ta They are outs shakers. Medical Sciences are in work hard. among U.S.universitiesin d an rs, movers New York City.) An Ivy ers, dreame fundsallocatedbytheNationalSciLeague university that is ence Foundation for programs in acaalsothelandgrantinstitutionofNewYorkState,Cornellis demic science and engineering. a unique combination of public and private divisions Cornellhasfivenationalresearch committed to teaching, research, and public service. centers: the Center for High Cornell’s 13,700 undergraduates and 6,000 graduate EnergySynchrotronStudies, and professional students come from all 50 states and the Floyd R. Newman

WWW .CORNELL B IG R ED . COM

“I would found an institution where any person can find instruction in any study.” EZRA CORNELL

110

Cornell may be a cutting-edge research university, but that doesn’t mean undergraduate education is an afterthought. A Cornell undergrad could spend the morning in a meeting with a professor for an independent study and the afternoon in large survey courses like psych 101. Students here work hard. Besides attending classes, there’s reading, writing, and research, not to mention preparing for exams. But students still find time to build friendships, volunteer off campus, hold part-time jobs and play sports. And while some students spend their four years close to campus, many go farther afield. They study natural medicinals in South America, marine biology off the coast of Maine, and public policy in Albany, N.Y. In addition to university-run programs in New York City, Washington, D.C., and Rome, Italy, Cornellians travel to sites around the world, polishing their language skills and broadening their horizons.

2005 FOOTBALL

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY LaboratoryofNuclearStudies,the Four thousand NationalAstronomyandIonosphere Center(whichoperatestheworld’s courses offered by largestradio-radartelescope,in nearly 100 departArecibo,PuertoRico),theCornell ments, more interNanofabricationFacility,andthe disciplinary proNational Science and Technology Center for Computer Graphics and grams than you’ll ScientificVisualization.Theuniverfind at any other sityalsohasfournationalresource university in the centers:theLatinAmericanStudies country, research Program, the East Asia Program, the South Asia Program, and the opportunities for SoutheastAsiaProgram. undergraduates in CornellUniversityLibrary’s17 nearly every field, Ithaca-campusunitsprovideanarand faculty-guided independent study give you the wherewithal to shape rayofreference,information,and instructionalservices.Atthesoutha program that speaks to your interests and passions and grows with you east edge of the Arts Quad, Olin over your four years here. andKrochlibrarieshousethelargest concentration of resources in cityofabout30,000situatedatthesouthernendof44-milethehumanities,socialsciences,andareastudies,including long Cayuga Lake, in the Finger Lakes region of New York extensiveAsiacollections,andrarebooks,manuscripts,and state. Campus attractions of special interest include the archival materials. Mann Library, on the Ag Quad, has mateJohnson Museum of Art, the Cornell Plantations, and the rialsinagriculture,biology,biotechnology,andrelatedfields. Cornell Lab of Ornithology and Sapsucker Woods wildlife Other libraries specialize in African and African American sanctuary. The heart of New York state’s wine-growing studies,engineering,entomology,thefinearts,hotelmanageregion is less than an hour away, as are the Corning Glass ment,industrialandlaborrelations,law,management,mathCenter and Museum and the Watkins Glen auto circuit. New ematics,music,thephysicalsciences,andveterinarymedicine. York City is about a four-hour drive from Ithaca. Famed for its woodlands, gorges, and waterfalls, the 745acremaincampusisonahilltopoverlookingIthaca,alively

SchoolofIndustrialandLaborRelations

www.Cornell.edu 2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Ataresearchinstitution,scholarsdon’tjustacquireknowledge—theyhelpcreateit. Cornell’s faculty members have garnered such prizes as the Nobel and the Pulitzer, not to mention MacArthur “genius” grants and countless other honors. Thesesameluminariesteachundergraduateclassesandincludestudentsontheirresearch teams. Cornellservesasalandgrantinstitution,receivingfundingfromNewYorkStateforits colleges of Human Ecology, Agriculture and Life Sciences and Veterinary Medicine and for its SchoolofIndustrialandLaborRelations.Inreturn,theuniversityoffersreducedtuitionto stateresidentsinthosecollegesandhelpscitizensapplytheresearchgeneratedheretoimprove the state’s economy and the health of its people. A network of more than 200,000 alumni around the world supports the efforts of CORNELL’S UNDERGRADUATE COLLEGES AND SCHOOLS currentstudentsbysponsoringinternships, College of Agriculture and Life Sciences offeringcareercounselingandmentorship, College of Architecture, Art, and Planning College of Arts and Sciences and providing much of the financial support College of Engineering thatmaintainstheuniversity’sworld-class School of Hotel Administration libraries,laboratories,andfaculty. College of Human Ecology

111

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Ithaca, N.Y.

Nestled in the heart of New York State’s beautiful Finger LakesregionisTompkinsCounty,withIthacaatitscenter. Long known for the excellence of its educationalandresearchinstitutions,andmore recentlyforitsmultitudeofscenicwonders, Ithacaisindeed,“Gorges.” which draws thousands from One of America’s first urban cartographers, Simeon around the planet. DeWitt, mapped Manhattan but settled in Ithaca. It is a town And there’s no shortage of lounges, that the Interstate never found, which is perfectly fine for dance clubs, and sit-down joints. Love most of the locals. But, as one restaurant hidden away on the reggae, ska, heavy metal, techno, hipwaterfront used to say, “Once you find us, you’ll love us.” hop, blues, or do-it-yourself garage-band music? We’ve IthacaislocatedinNewYorkstate’slushFingerLakesregion, got them all. Restaurants range from the country’s most plunkeddownrightatthesoutherntipofscenicCayugaLake, famous vegetarian café, Moosewood, to French traditional which is a veritable magnet for outdoorspeople. The lake to Thai, Indian, and Japanese, and taqueria to bagelry. providesswimming,sailing,kayaking,andfishingopportuniCoffeehouses abound, and Ithaca boasts ties.Inacoldyear,there’seven several old-timey diners, two of them ice-fishing! And bring your open round the clock. Eateries come in all boots – all of them. Ithaca is flavors and price ranges, and you’ll find built on hills and surrounded City of Ithaca Population: 28,775 them along the waterfront, tucked into byforests,providingopportuthe old Lehigh Valley Railroad station, in nitiesforcross-countryskiing, Tompkins County Population: 96,000 umbrella’d pavilions on the Commons, snowshoeing,hiking,biking, Elevation Above Sea Level: and in high-energy Collegetown. And we andclimbing.Butjustenjoying highest: 2,099 feet (Connecticut Hill) have three humongous supermarkets – thisgorgeous,glacier-cutlandlowest: 382 feet (at Cayuga Lake) visitors from “the big city” take home scapeissportenoughforsome. State parks: 4 trunkloadsofcomestibles. A couple of years back, the Despiteitsoff-the-beatenpathlocation, UtneReadercalledIthaca“The Movie screens: 15 Victorian and Greek revival architecture, Most Enlightened Town in Performing arts theatres: 8 and the woods, farms, and vineyards that America.”Theycitedourcivic Restaurants: 145 are only a few minutes’ drive out of town, involvement(inIthaca,poliIthacahasayouthfulenergyandcosmopoliticsisaparticipationsport, Houses of worship: more than 100 tanoutlookthatmakeitaperpetuallyexcitand nearly everybody plays), Museums and galleries: 16 ing place to be. It’s a mecca for students, bookstores,natural-foodsuintellectuals,inventors,artists,musicians, permarkets,andpopularfreeand computer geeks. ranging farmers’ markets. We even have our own monetary Perhaps this is why, in this “community of passionate system based on bartering for good and services: Ithaca people,” some never achieve escape velocity, choosing to Hours. (Don’t worry, we accept U.S. currency, too.) stayinthispowerfullybeautifulplaceinsteadofchasingthe But Ithaca is lots more than arguments and organic tofu. big bucks in bigger places. There is a strong cultural component – museums, galleries, theatre, and film. Ithaca was an early home to America’s filmindustry;itsgorgeswereperfectfortrolley-car-over-thebridge scenes, its ravines ideal for the lost-in-the-wilds scenes. There are 15 screens in town (these run the gamut from huge cineplexes to tiny art-film rooms). On campus, Cornell Cinema shows almost 400 films a year. Ithaca is also home to a ballet company, chamber orchestra,baroqueorchestra,concertband,severaltheatre groups, and the oldest small opera company (it recently celebrated its 50th birthday) in the U.S. Should you manage to spend a summer here, don’t miss the Ithaca Festival, featuring food, dancing, performances of all kinds, and more food; and our own world-music version of Woodstock, the Finger Lakes GrassRoots Festival of Music and Dance,

WWW .CORNELL B IG R ED . COM

IthacaFacts

112

2005 FOOTBALL

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

HUNTER R.RAWLINGS 10th Year at Cornell 10th President of Cornell University — Interim Hunter Rawlings, Cornell’s 10th president, became the university’s interim presidentinJune2005aftertwoyearsasafull-timeprofessorofclassicsatCornell. He previously had served as president from 1995 until 2003. Rawlings is a classics scholar who was the starting center on the Haverford basketball team during his undergraduate days and later had a pitching tryout with theBaltimoreOrioles. “There is nothing better than a vigorous combination of academic and athletic life,” says Rawlings. “My own college experience had a healthy measure of both and taught me the value of competition. My best friends continue to be my basketball and baseball teammates. “At Cornell, we strive for excellence in athletics as an important endeavor in its own right and as part of our commitment to the undergraduate education. The opportunity to earn an Ivy League degree and to be part of an intercollegiate team is a great reason to attend Cornell.” Rawlings, who earned his doctorate at Princeton University, came to Cornell in 1995 from the University of Iowa, where we was president and professor of classics from 1988 until 1995. Before that, he served for four years as vice-president for academic affairs and research as a dean of the graduate school at the University of Colorado. Rawlings returned to full-time research and teaching as a professor of classics at Cornell. Rawlings was elected a member of the Academy of Arts and Sciences in 1995. He has served on the board of directors of the American Council on Education and is now serving a second term on the executive committee of the Association of American Universities. He served as chair of the Council of Ivy Group Presidents and as a member of the Council on the Financing of Higher Education (COFHE). He is also a member of the National Academy Foundation, the Partnership for Public Service Governors, the Board of Managers of Haverford College and the National Advisory Committee of the Woodrow Wilson National Fellowship Foundation.

DR. SUSAN H.MURPHY ‘73 28th Year at Cornell Vice President, Student and Academic Services

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Susan H. Murphy has served Cornell University as vice president for student and academic services since July 1994. Under her direction are academic support, campuslife,deanofstudents,Greeklife,careerservices,publicservice,religious affairs,athleticsandphysicaleducationandhealthservices. A 1973 graduate of Cornell’s College of Arts and Sciences, Murphy majored in history. She subsequently completed master’s degrees at Stanford University and Montclair State College. In 1994, she earned a Ph.D. in educational administration fromCornell. Murphy joined the Cornell staff in 1978 following work as a guidance counselor and head of the guidance department at Chatham (N.J.) Borough High School. For 16 years, she worked in admissions and financial aid, including nine years as dean of admissions and financial aid. In addition to her responsibilities at Cornell, Murphy chairs the policy committee of the Council of Ivy Group Presidents. Previously, she has held state-wide and national positions in the College Board and the National Association of College Admission Counselors.

113

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

J. ANDREWNOEL Jr. 25th Year at Cornell The Meakem!Smith Director of Athletics and Physical Education Andy Noel begins his seventh year as Cornell University’s director of athletics and physical education having led the Big Red athletics program to unprecedented success while setting a course for his vision of continued prosperity. His position was endowed in December 2003 by Jack ’58 and Diane ’61 Meakem and Scott Smith ’79. Jack is a former oarsman and member of Cornell’s Athletic Hall of Fame, while Scott wrestled under Noel during his time on East Hill. The Big Red teams have parlayed Noel’s accomplishments into success on and off the playing field. Cornell’s athletic teams have won 28 Ivy League team titles and eight national championships during his tenure and have posted a cumulative .510 winning percentage or better in five of his first six seasons. The program’s 22 Ivy titles in the last three years is tied for the most ever at Cornell in that span, increasing from a total of six in his first three years to at least seven in each of the last three seasons. Academically in 2004-05, 28 of the school’s 36 teams had cumulative grade posint averages of 3.0 or better, with 128 individual semesters with a 4.0 GPA during the year. In addition, Cornell has had 10 student-athletes named Academic All-America in the last three years, the most of any Ivy school. Noel accepted the appointment as director after serving three years as an associate director of athletics for the Big Red. Since becoming director, Noel has continued to hire top coaches and has also successfully upgraded a number of department facilities (including renovating Schoellkopf Hall and building the Friedman Wrestling Center). During his tenure, he has also been a member of the team that raised $66 million in support of capital projects and endowment, helping secure the financial future of the department. During the campaign, 21 coaching and staff positions were endowed, bringing the total number of endowed positions within the department to 30, the most of any school in the country. Noel was the Big Red’s head wrestling coach from 1974 to 1988 and then served two years as an assistant director in the department’s public affairs office, implementing the athletic department’s annual giving program. At Cornell, his wrestling teams won four Ivy League championships and placed second four times. Under Noel’s direction, the wrestling team established a strong network of support from alumni and friends. In 1990, he was recognized at the Eastern Intercollegiate Wrestling Association Championships for his distinguished coaching career at Cornell, and in 1992 he was inducted into the New York State Wrestling Coaches Association Hall of Fame. He is also a member of the Franklin and Marshall Sports Hall of Fame. In addition to his coaching and administrative career, Noel served on the wrestling committee of the National Collegiate Athletic Association from 1997-2001. He is currently a member of the NCAA Championships Cabinet and serves on both the Misconduct Appeals committee and the Playing Rules Oversight Panel. Noel is a past chairman of the Ivy League athletic directors’ committee on administration and serves on the Cornell President’s Council on Alcohol and Other Drugs. A native of Lancaster, Pa., he graduated from Franklin and Marshall College in 1972 with a bachelor of arts degree in history and received his master of arts degree in counseling and guidance from Colgate University in 1973. Noel is married to Dr. Betsy Mead Noel ‘86, and has a son Jonathan ‘04 and two daughters, Amanda ‘07, and 1-year-old Amelie.

WWW .CORNELL B IG R ED . COM

2005-06 Athletic Adminstrators

114

ANITA BRENNER

STEPHEN P. ERBER

AL GANTERT

FRANK ARANEO

CHRIS WLOSINSKI

JOHN WEBSTER

PATTY WELDON

Assoc. AD/ Senior Woman Administrator

Assoc. AD

Assoc. AD/ Director of Physical Education

Assoc. AD/ Business and Finance

Asst. AD/ Student Services and Compliance

Director of Athletic Alumni Affairs and Development

Compliance Coordinator

PAT GRAHAM

DALE STRAUF

JEFF HALL

GENE NIGHMAN

BERNIE DEPALMA

MATT COATS

PAM DOLLAWAY

Facilities Manager

Head Equipment Manager

Director of Cornell Sports Marketing

Ticket Manager

Head Athletic Trainer

Operations Manager

Human Resources Manager

2005 FOOTBALL

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Meet The Big Red Coaches

AnimpressivestaffofcoachesleadstheBigRedteamsandrecruitssomeofthefineststudent-athletesfromanationalandinternational pool of accomplished young men and women. The coaches demonstrate a commitment to teaching and a willingness to share their own competitive experiences with their teams. Their individual achievements and accomplishments include playing and coaching time in the professional and international ranks as well as numerous all-star performances during their own collegiate careers.

BERHANE ANDEBERHAN

M ATT B AUGHAN

PAUL BECKWITH

DICK BLOOD

DEITRE COLLINS

TERRY CULLEN

Women’s Soccer

Golf

Gymnastics

The Jan Rock Zubrow ’77 Head Coach of Softball

The Wendy Schaenen ’79 Head Coach of Women’s Volleyball

The Terry Cullen Head Coach of Sprint Football

MELODY DAVIDSON

JULEE DEVOY

MARK DEVOY

IRYNA DOLGIKH

STEVE DONAHUE

LOU DUESING

Women’s Ice Hockey

Women’s Squash

Men’s Squash

Fencing

The Robert E. Gallagher ’44 Head Coach of Men’s Basketball

The Alan B. ‘53 and Elizabeth Heekin Harris Women’s Track & Field and Cross Country Coach

DAVID ELDREDGE ‘81 The Peter B. Orthwein ‘69 Head Coach of Polo

RICK GILBERT

LAURA GLITZ

JENNY GRAAP ‘86

JOHN HOLOHAN

The Richard W. Gilbert Head Coach of Diving

The Carl Meinig ‘31 Head Coach of Women’s Tennis

Women’s Lacrosse

Women’s Swimming

TODD KENNETT ‘91

JIM KNOWLES ‘87

ROB KOLL

JOE LUCIA

CHRIS MITCHELL

DAN ROOCK

The Roger J. Weiss ’61 Head Coach of Football

The David Dunlop ’59 Head Coach of Wrestling

The Philip H. Bartels ’71 Head Coach of Men’s Swimming

Equestrian

Field Hockey

The Robert B. Tallman ’41 Men’s Lightweight Rowing Head Coach

The Spirit of ’57 Director of Men’s Heavyweight Rowing

BRYAN SCALES

MIKE SCHAFER ‘86

BARRY SCHOONMAKER

DAYNA SMITH

JEFF TAMBRONI

NATHAN TAYLOR

CHRIS WILSON

Men’s Soccer

The Jay R. Bloom ’77 Head Coach of Men’s Hockey

The Richard Savitt ‘50 - Stephen Weiss ‘57 Head Coach of Men’s Tennis

The Rebecca Quinn Morgan ’60 Head Coach of Women’s Basketball

The Richard M. Moran Head Coach of Men’s Lacrosse

The George Heekin ’29 Head Coach of Men’s Track & Field and Cross Country

The Staley Head Coach of Women’s Rowing

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

DONNA H ORNIBROOK

TOM FORD The Ted Thoren Head Coach of Baseball

115

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

WWW .CORNELL B IG R ED . COM

The Ivy League

116

Council of Ivy Group Presidents (The Ivy League)

The Ivy League is truly one of a kind. 228 Alexander St. While the 2005-06 academic year marks the Princeton, NJ 08544 50th season of official Ivy League athletic compePhone: (609) 258-6426 tition, the rivalries and traditions in the League go Fax: (609) 258-1690 so much deeper. The first official athletic compeWeb Site: www.ivyleaguesports.com tition between League schools was more than 150 years ago (1852, Harvard-Yale rowing) and the first Executive Director: Jeffrey H. Orleans football game was more than 130 years ago (1872, Senior Associate Director: Carolyn Campbell-McGovern Associate Director: Charles Yrigoyen III Columbia-Yale). Assistant Director: Brett Hoover In the early days, the Ivy schools dominated Compliance Assistant: Mary Mulvenna college athletics. All-America status, Olympic Public Information Assistant: Josie Carlson medals and national championships were routinely Public Information Assistant: E.J. Hubbard earned by students from the Ancient Eight. Office Coordinator: Jane M. Antis Today, Ivy Leaguers continue to claim national Administrative Assistant: Robin Patsey titles and Olympic medals — as well as All-America and Academic All-America status. Hundreds conIVY FAST FACTS tinue athletic careers as professionals and hunFounded—1956; 49th season dreds more as coaches and athletic administraStudent Population—51,525 Members—Brown, Columbia, Cornell, Dartmouth, Harvard, Penn, Princeton, tors. The student-athletes also are among the Yale nation’s leading public servants, doctors, journalIvy-Sponsored Championships—33 ists, lawyers, scientists, scholars, business leaders, entertainers, educators and so much more. The success of the League Since 2000 alone, the Ivy League has... up of one senior non-athcomes without letic administrator from • Produced 23 individual and eight team NCAA national chamathletic scholareach school; and the compions. The League has also had national champions in a numships while mainmittee on Administration, ber of non-NCAA sports like squash and rowing. taining self-imcomprised of the eight di• Finished behind only the six BCS conferences in all-sports posed high acarectors of athletics. rankings in the Sears Cup for five consecutive seasons. demic standards. The Ivy Presidents ex• Had more than 100 All-Americans each year. The Ivy League tended the Ivy Group Agree• Averaged more than a dozen Academic All-Americans (inhas demonment to all intercollegiate cluding an all-time high of 17 in 2004-05) stratedararewillsports in February 1954. • Had 133 competitors at the three Olympic Games (2000, 2002, ingness and abilTheir statement also fo2004). Those 133 have collected 36 medals, including 11 gold. ity,giventheprescused on presidential gov• Sent hundreds of athletes into the professional ranks, insures on intercolernance of the League, the cluding dozens of NFL players headlined by Pro Bowlers Matt legiate success importance of intra-League Birk and Marcellus Wiley. throughout the competition, and a desire • Hosted the first ESPN College GameDay football show to nation, to abide that recruited athletes be draw more than 1.5 million households. by these rules and academically ‘representastill compete suctive’ of each institution¹s cessfullyinDivisionIathletics. overall student body. Although that is the League¹s official foundSponsoring conference championships in 33 ing date, the first year of competition was 1956-57. men’s and women’s sports, and averaging more The Ivy League office is housed in Princeton, N.J., under than 35 varsity teams at each school, the Ivy League the leadership of Executive Director Jeffrey H. Orleans, who provides intercollegiate athletic opportunities for has been at that post since 1984. more men and women than any other conference in the country. All eight Ivy schools are among the Ivy League By The Numbers “top 20” of NCAA Division I schools in number of sports offered for both men and women. 33 - Intercollegiate championships offered in the Ivy The term “Ivy colleges” was first in October, 1933 League, more than any other conference in the by Stanley Woodward of the New York Herald Tricountry bune to describe the eight current Ivy schools (plus 37 - NCAA Team Championships won by Ivy League Army). On Feb. 8, 1935, Associated Press sports edischools since 1956 tor Alan Gould first used the exact term “Ivy League.” The first “Ivy Group Agreement,” signed in 1945, applied only to football. It affirmed the observance of common practices in academic standards and eligibility requirements and the administration of need-based financial aid, with no athletic scholarships. The agreement created the Presidents Policy Committee, including the eight Presidents; the Coordination and Eligibility Committee, made 2005 FOOTBALL

146 - The number of Ivy Leaguers who have combined to win 169 Olympic Gold Medals 156 - NCAA Individual Championships won by Ivy League athletes since 1956 201 - Ivy League athletes currently playing professionally, including 24 NFL players

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

The Friedman Center

TOMHOWLEY

Champions are crowned duringtheseason,butchampionships are earned long before competition begins. Cornell’s900varsityathletes haveexclusiveaccesstoone ofthenewestandbesttrainingfacilitiesinthenation— the8,000-square-footFriedman Strength and Conditioning Center. Completed in June 1997, this impressive $2 million additiontoBartelsHallreflectstheuniversity’sstrongcommitmentto athleticexcellence.Coachesandteammembersalikecreditthecenter, itsworld-classequipment,andfirst-ratestaffwithaddingimmenselyto the success of the Big Red athletic program. TheFriedmanCentercontainsfree-weight,selectorized,plyometric, and cardiovascular equipment and has been designed to meet the diverse training needs of Cornell’s athletes. The center can accommodate up to 100 users at a time without compromising safety or function. Itsuniquefeaturesincludeair-conditioning,a175-wattstereosystem, and damage-resistant flooring. Cornell’s varsity strength and conditioning program—nicknamed “Big Red Power”—focuses on enhancing performance and preventing injury. The new facility and equipment enable the staff to prescribe year-roundsport-specificprogramswithvarietyandprecision. Before the training programs are designed, the muscular and metabolic needs for each sport—and for each position within the sport—are analyzed. Athletes are then assessed to identify their individual strengths and weaknesses, and follow-up assessments are conducted at regular intervals. Comprehensive workouts are prescribed to address deficiencies and promote the development of skills used during competition. Injurypreventionalsoisemphasized.Throughresistancetraining, the number and the severity of injuries are reduced. If an injury does occur,thestrengthandconditioningstaffworkscloselywiththesports medicine staff to ensure a safeandcompleterehabilitation.Theobjectiveistoallow theathletetoresumefullparticipationassoonaspossible.

11th Year at Cornell Head Strength and Conditioning Coach

Strength & Conditioning Staff TOM DILLIPLANE Asst. Strength Coach

MARILYNN BROCKMAN Asst. Strength Coach

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

Tom Howley has been the strength and conditioning coach at Cornell since July 1995. In that role, he oversees the design and implementation of athletic performance programs for Cornell’s 36 varsity sports. The comprehensive, year-round programs include strength and power development, mobility skill training and conditioning, and are implemented in a motivating, team-oriented environment. Prior to his arrival at Cornell, Howley was the assistant director of strength and conditioningatEastCarolinaUniversityfrom19911995. During these seasons, the Pirates participated in two bowl games (1992 Peach Bowl and 1995 Liberty Bowl), qualified for the NCAA baseball regional tournament (1994) and played in the NCAA basketball tournament (1993). Howley was a graduate assistant strength and conditioning coach at Auburn University from 1989-91, where he earned his master’s degree in exercise physiology. The Tigers were the 1989 Southeastern Conference cochampions, the 1990 Hall of Fame Bowl and the 1991 Peach Bowl champions. Howley also served as an assistant coach with the special teams. A 1988 graduate of Tulane, Howley earned a bachelor of arts degree in history and was a three-year letterman and two year starting offensive lineman on the football team. The Green Wave played in the 1987 Independence Bowl his senior year. He was the recipient of the New Orleans Quarterback Club Student-Athlete Award as a senior. HowleyisanactiveparticipantintheCornell University/IthacaCollegechapteroftheFellowshipofChristianAthletes. Heandhiswife, Amanda, reside in Ithaca with their daughter, Anna Corrine.

117

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Support Services Class of ‘44 Study Room Student-athletes at Cornell have access to the Class of ’44 Study Room. The room is furnished with study tables and chairs to comfortably accommodate 15-20 people in addition to the computers that are all equipped with internet access. Members of Cornell’s Class of 1944 contributed to the project, covering the expense of new furniture, computers, a printer, a lectern and a coat rack. The space is conveniently located in Bartels Hall and is accessible to studentathletes between classes and before and after practice. The room is open Monday to Thursday 8 a.m. to 11 p.m. and Fridays 8 a.m.to 4 p.m.

Academic Services Academic counseling is provided in partnership with the student-athletes’ assigned academic advisers and college advising office. Academic contracts are developed in conjunction with the student-athlete to outline specific academic goals for the semester. Academic monitoring of current course grades and academic performance can be requested from instructors by coaches or student-athletes at anytime throughout the semester. The instructor will be asked to fill out a form and return it to Athletic Student Services Office. Once received, a follow-up meeting with the director allows the student-athlete to meet and discuss their academic progress. Tutoring services are available to all student-athletes as a supplement to existing tutorial services on campus. Student-athletes may request a tutor by completing a tutor request form that can be obtained from their coach or the form can be printed from www.CornellBigRed.com. Laptop computers are available for student-athletes to sign out on away athletic trips. You may request a laptop by contacting Chris Wlosinski. There is a limit of one per team and are available on a first-come first-serve basis. Study skills workshops can be arranged through the Athletic Student Services office. Referrals to the Center for Learning and Teaching provide additional support for individual academic and study skills support.

Support Services

For more information regarding Student-Athlete Support Services at Cornell, contact ... Mailing Address Chris Wlosinski Department of Athletics — Cornell University Teagle Hall, Campus Road Ithaca, NY 14853-6501 Phone Number: (607) 254-7472 E-mail: cmw32@cornell.edu

Personal Needs Counseling Student-athletes are encouraged to schedule an appointment with the director when they have concerns regarding academic, athletic, or personal issues. Assistance will be provided and referrals will be made to appropriate support services on campus. Educational Seminars/Workshops Various seminars and workshops are given throughout the year and provide information relevant to student-athletes. Past workshops include topics such as nutrition and eating disorders, alcohol education, sports psychology, women’s health issues, and study skills. Career Development Services Career development services for student-athletes are coordinated with the University Career Center and each of the undergraduate colleges. Services including assistance with resume writing and conducting a job search is also available through the various Career Centers across campus. Student-Athlete Assistance Fund Money is available for Pell Grant recipients and to non-US citizens who have demonstrated need that is comparable to those qualifying for Pell grants and are receiving institutional aid. There is a $500 allowance for clothing and essentials and/or travel home and $100 for academic course supplies.

CHRISWLOSINSKI

WWW .CORNELL B IG R ED . COM

Seventh Year at Cornell The Andrew ‘78 and Margaret Paul Assistant Athletic Director for Student Services and Compliance

118

Chris Wlosinski took over the role of the Andrew ‘78 and Margaret Paul Director of Student-AthleteSupportServicesinAugust 2001 and was promoted to Assistant Athletic Director for Student Services and Compliance in March 2005. In her position,shehasassumedadedicatedrolefocusedonstudent-athlete support and compliance with NCAA and Ivy League rules. Cornellanditscounterpartsembraceaphilosophythatincludesthe notionthatstudent-athletesshouldexperienceamainstreamcollegiatelife,buttheuniversityalsorecognizedtheextrademandsplaced onthisspecialpopulation.InAugustof1998,theposition,thefirstof itskindintheIvyLeague,wascreated,arolethatasksWlosinskitowork as an available and reliable adviser who understands the lifestyle student-athletesleadandassiststheminbalancingtheiracademic, athleticandpersonalchallenges.Inthiscapacityshealsoservesasa liaisonwiththecollegesanddirectsstudent-athletestoappropriate campus-wide resources for academic and personal needs. When Wlosinski first joined the Big Red program, she worked collaborativelywiththedirectorofstudent-athletesupportservices, coaches and administrators to provide counseling and 2005 FOOTBALL

academicsupportservicesserving36varsitysports.Shedeveloped and maintained personal contacts with administrators and professors throughout Cornell’s seven colleges, and she assisted the directorinmonitoringtheacademicprogressofstudent-athletes. Most of Wlosinski’s time is devoted to personal meetings with student-athletes, and while the bulk of her work focuses on freshmen, sophomores and transfer students, she does assist athletes fromallclassesandacrossallcollegesatCornell. Wlosinski came to Cornell in August 1999 and worked in compliance, student services and event management. In June 2000, she accepted the position of associate director of alumni affairs and development for athletics where she served until assuming her current position. PriortojoiningtheCornellstaff,Wlosinskispentayeareachas an athletics administrative intern at Bates College and Plymouth StateCollege. Shealsoservedasaspecialeducationteacherforthe learningdisabledforsevenyearsinLancaster,Pa. WlosinskigraduatedfromMillersvilleUniversityin1989witha bachelor’s degree in special education and from Plymouth State College in 1999 with a master’s degree in education.

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Athletic Training AthletictrainingatCornellUniversityisdedicatedtoprovidingall student-athletesinthedepartmentwiththehighestlevelofhealthcare. The care given by the Big Red trainingstaffgoeswellbeyond thedailymedicalconcernsthat everyDivisionIprogramhasregardinginjuryprevention,treatment and rehabilitation. The total health care of the individualisthegoaloftheCornell program.

B ERNIE DePALMA

25th Year at Cornell Doc Kavanagh Head Athletic Trainer/Physical Therapist

MARC CHAMBERLAIN, ATC

ED KELLY, ATC

KENAN GUILMETTE, ATC

KATHY MACCHEYNE, EMT

JIMCASE 18th Year at Cornell AssociateAthleticTrainer

DR. DAVIDWENTZEL 16th Year at Cornell Chief of Sports Medicine

LINDA HOISINGTON, ATC

CHRIS SCARLATA, ATC

ROSE HOWLAND, ATC

JOCELYN STARK, ATC

2005 FOOTBALL

WWW .CORNELL B IG R ED . COM

2005-06 Big Red Athletic Training Staff

thestudent-athlete’swell-beingandperformance. He also manages programs he developed for graduate assistantships with IthacaCollegeandathletictrainerinternships from Ithaca and other area colleges. Hesupervisessevenfull-timestaffmembers and numerous part-time assistants. Bernie’sexpertiseimpactsnationalathletics legislation. He has served on numerous NCAA committees, including the committee on competitive safeguards and medicalaspectsofsportsafety,whichhechaired; the NCAA special committee on studentathlete welfare, access and equity; and the nationalathletictrainer’staskforcewhich developed medical coverage guidelines for allintercollegiateathleticprograms. He was honored in 2001 by the National Athletic Trainers’ Association (NATA) with the Most Distinguished Athletic Trainer Award. The award recognizes the NATA’s certifiedmembersfortheiroutstandingcontributionstotheprofessionofathletictraining and to the association. Bernieandhiswife,Mary,haveadaughter, Taylor,andason,Turner.

119

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Prominent Cornell Alumni AEROSPACE ED LU ’84 MissionspecialistfortheSpaceShuttleAtlantis,whichdockedwiththe RussianSpaceStationMir ARTS RICHARD MEIER ’57 Internationallyknownarchitect SUSAN ROTHENBERG ’67 Painter JASON SELEY ’40 Sculptor;Cornellfacultymember PETER YARROW ’59 Musician; Peter, Paul & Mary BUSINESS ADOLPH ’07 AND JOSEPH COORS ’39 Founder/executivesofthenation‘slargestsinglebrewery PETER COORS ’69 President, Coors Brewing Company HERBERT F. ’22 AND SAMUEL C. JOHNSON ED LU ‘84 ’50 Founder/executives of Johnson Wax Company SANFORD I. WEILL ’55 Financierandphilanthropist;CEOofCitigroup EDUCATION AND HUMANITIES URIE BRONFENBRENNER ’38 Pioneer in human development studies; Cornell faculty member JEROME H. HOLLAND ’39, MS ’41 FormerAmbassadortoSweden;formerpresidentofHamptonInstitute and Delaware State University; businessman WILLIAM STRUNK PHD 1896 Educatorandeditor;co-authorofElementsofStyle

WWW .CORNELL B IG R ED . COM

ENTERTAINMENT ARTHUR LAURENTS ’37 TonyAward-winningplaywright,screenwriter,director,andauthor; wrote West Side Story and directed La Cage Aux Folles BILL MAHER ’78 Comedian,author;hostofPoliticallyIncorrectpanelshowonABC EDWARD MARINARO ’72 Actor,HillStreetBlues,Sisters CHRISTOPHER REEVE ’74 Actor,SupermanI,II,IIIandIVmovies;awardwinningdirector;activist formedicalresearch

120

GOVERNMENT SAMUEL (SANDY) R. BERGER ’67 Internationalconsultant;nationalsecurityadvisor1993-2000 STEPHEN FRIEDMAN ’59 AssistantforeconomicpolicytoPresidentGeorgeW.Bush,anddirector of the National Economic Council RUTH BADER GINSBURG ’54 U.S.SupremeCourtJustice;memberofNationalWomen’sHallofFame JANET RENO ’60 U.S. attorney general, 1993-2000; member of National Women’s Hall of Fame LEE TENG-HUI PHD ’68 PresidentofTaiwan LITERATURE KENNETH BLANCHARD ’61, PHD ’67 Author, The One-Minute Manager; management consultant TONI MORRISON ’55 Winner of 1988 Pulitzer Prize and 1993 Nobel Prize for literature KURT VONNEGUT JR. ’44 Author(CatsCradle,SlaughterHouseFive);prisonerofwarinGermany during World War II

2005 FOOTBALL

E. B. WHITE ’21 Author(Charlotte‘sWeb,StuartLittle) andeditor;co-authorofElementsofStyle MEDIA ANN H. COULTER ’84 Lawyer,politicalanalyst,andauthor FRANK GANNETT 1898 Newspaper publisher; founder of the Gannett chain BILL NYE ’77 Award-winning popular-science media host and author CHRISTOPHER REEVE ‘74 KEITH OLBERMANN ’79 Televisionsportsanchorandcommentator DICK SCHAAP ’55 Emmy Award-winning television sports commentator , sports commentator,journalist,andauthor SCIENCE, MEDICINE AND HEALTH JOYCE BROTHERS ’47 Psychologist,author,andmediapersonality HENRY HEIMLICH ’41, MD ’43 Developer of the Heimlich maneuver and of esophagoplasty C. EVERETT KOOP MD ’41 U.S. surgeon general 1981-89 BARBARA MCCLINTOCK ’23, ’25, PHD ’27 Genetics researcher; winner of the 1983 Nobel Prize in physiology/ medicine DOUGLAS OSHEROFF MS ’71, PHD ’73 Co-winner of the 1996 Nobel Prize in physics STEVEN WEINBERG ’54 1991 National Medal of Science winner, andco-winnerofthe1979NobelPrizein physics SPORTS JON ANDERSON ’71 1972 Olympian, track; winner of 1973 Boston Marathon BRUCE ARENA ’73 Coach of U.S. National soccer team; coached 1996 U.S. Olympic team GARY BETTMAN ’74 First National Hockey League commissioner GLENN (POP) WARNER 1894 KEN DRYDEN ’69 FormerNHLplayer,MontrealCanadiens, 1971-79; inducted into the Hockey Hall of Fame, 1983; current Vice Chairman, Toronto Maple Leafs AL HALL ’56 Four-time Olympian (1956, 1960, 1964, 1968), hammer throw ROBERT TRENT JONES ’30 Golfcoursearchitect;constructedover450coursesaroundtheworld; inducted into PGA World Golf Hall of Fame, 1987 CHARLES H. MOORE ’51 1952 Olympic gold medalist (hurdles) and silver medalist (1600meterrelay);honoredasGoldenOlympian,1996;CornellDirectorof Athletics,1994-99 JOE NIEUWENDYK ’88 DraftedinsecondroundbytheNHLCalgaryFlames,1985;currentlyplays fortheTorontoMapleLeafs;three-timeStanleyCupwinner;1998Olympian; 2002 Olympic gold medalist; 1999 Conn Smythe Trophy winner GLENN (POP) WARNER 1894 Football coach at Cornell, Georgia, Carlisle (where he coached Jim Thorpe),Pittsburgh,StanfordandTemple. Overall44-yearcoaching record was 319-106-29.

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Schoellkopf Field

WWW .CORNELL B IG R ED . COM

Schoellkopf Field has undergone many greatchanges,resultingintoday’smagnificent structure. During the 19th century, many of Cornell’s athletic teams trained on Percy Field where Ithaca High School now stands. During the early 1900s, though, Cornell’spopulationgrewquicklyandPercy Fieldwasnolongersuitableforthegrowing number of Cornell athletes. Gradually, the idea of having adequate athleticfacilitiesoncampusdeveloped. The Alumni Field Committee was created to considerthispossibilityandtheypersuaded theuniversitysetasidelandforafield. The committee “strove, pled, and prayed” for donationstotheproposedathleticfacilities. Because of a generous donation from Willard Straight ’01, the construction of a field house was made possible. The contriOpened: 1915 bution came in memory of his friend, Henry First Game: vs. Gettysburg, 26-0 Win (9-28-1915) (Heinie) Schoellkopf ’02, an outstanding Total Games at Schoellkopf: 433 shortened hours of dayfootballplayeranda“belovedgentlegiant.” Itissaid Record at Schoellkopf Field: 269-149-15 (.639) lightcutdownafter-class that he once dove 70 feet into a gorge pool to rescue Largest Football Crowd (all-time): practicetime. 35,300 vs. Michigan (W, 20-7) on Nov. 10, 1951 a drowning dog. Before 1915, the largThe Schoellkopf family themselves then responded Largest Football Crowd (since 1970): est crowd to assemble for toStraight’sdonationandhelpedfinancetheproject. 23,000 vs. Columbia (W, 24-21) on Oct. 30, 1971 anathleticeventinIthaca Finally,constructionofSchoellkopfField,whichwould was less than 5,000. The be on the highest point on campus, could take place. Schoellkopf Field was ready to open the fall of 1915. The University development of automobiles and improvement of roads brought planned a huge parade from the Arts Quad to the field for the larger and larger crowds to the stadium. Soon, it became apparent dedication exercises and opening football game. Everyone in that Schoellkopf’s capacity of 9,000 was no longer sufficient. In 1921, a study and report was commissioned and in the spring Cornell—undergraduates, faculty and staff, in addition to alumni of 1923, University trustees approved the plans to reconstruct the and invited guests—was expected to participate. On Saturday, October 9, 1915, all campus activities were sus- east side stands. Construction began that winter and in September, pended at noon. An estimated crowd of 6,000 quickly gathered in 1924, the Crescent was completed increasing capacity to 21,500. frontofGoldwinSmithHallasinstructedbytheUniversity.President In June 1947, permanent steel stands on the west side of Schoellkopf Jacob Gould Schurman slowly led the procession to the awaiting Field were built, boosting total stadium capacity to 25,597. The SchoellkopfField.Theimpressiveparadewasthelargestturnoutof stands,aswellasanewpressbox,werecompletedintimeforCornell football’s Navy game on October 18, 1947. itskindintheIthacaareaatthetime. Schoellkopf Field was one of the University’s most valuable, but Cornellfootball’sbestseasonwasitsfirstonSchoellkopf.That year, the team won all of its nine games and went on to become leastusedareasoncampusuntiltheintroductionofanartificialturf. In early 1971, it was announced that an anonymous donor had national champion. madeagiftforturfonSchoellkopf Exactlyfiveyearsafterthededication,the Field. The person who first benGeneral Electric Company completed work on efitedfromtheartificialsurface afloodsearchlightsystemforthefield,which was probably Cornell’s star was designed to illuminate the field without tailback Ed Marinaro ’72, who causingglarevisibletotheplayers.Theproject eventually broke every school was of major importance to athletic teams, rushingrecord.Theartificialsurespecially in the fall and winter months, when face was more flexible than natural grass and would therefore cause less of an impact on Marinaro’s body when he went down. Also, there had been a historyofimprovedfootballrushing performancesonartificialturf.The field has since been resurfaced three times, most recently in 1999. Expansion and growth for Schoellkopf Field continued. The new press box was built in 1986, and the stands have been refurbished. This season will be the first for the Big Red in the newly renovated Schoellkopf Hall, which includes an addition featuring new locker rooms, meeting rooms, a football tradition room and coaches offices. Schoellkopf Field has become an irreplaceable part of Cornell’sathletictraditionandcampus. PartsofthisarticleoriginallyraninTheCornellDailySun(Nov.21,1985)

2005 FOOTBALL

121

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Big Red Facilities

WWW .CORNELL B IG R ED . COM

Set against a backdrop of the natural beauty of Cayuga Lake and the surrounding hills, an extensive array of facilities provides a tremendous environment for practice and competition for Cornell’s varsity teams. Schoellkopf Field and its distinctive crescent-shaped stadium may be Cornell’s most familiar sports venue, but since the mid-’90s, a number of new facilities have become landmarks as well. The Friedman Strength and Conditioning Center, a state-of-the-art facility dedicated to the support and improvement of athletes’ performances, is a place where all teams gather to train. The Kane Sports Complex, with its Berman Field for soccer and the Simon Track, and the Niemand•Robison Softball Field are also impressive facilities. The Reis Tennis Center, the Belkin Squash Courts, and the Oxley Equestrian Center, home of the equestrian and polo teams, are part of an expanding complex that will include new homes for other teams as Cornell continuestorealizeitsplanforrenovationandbuildingofathleticfacilities. Spacious and historic Barton Hall is home to the indoor track and field teams. The volleyball and basketball teams compete in Bartels Hall’s 4,473-seat Newman Arena and the fencing team’s home, the Stifel Fencing Salle, is located on the lower level of the facility. Adjacent to Bartels Hall is famed Lynah Rink, where the Big Red hockey teams perform before sellout crowds for most home games. The Friedman Wrestling Center, opened in 2002, is located to the north of Bartels. The gymnastics and swimming teams are housed in Teagle Hall, where Cornell crews also train during the winter months. Just down the hill from campus are the Collyer Boat House and the Doris Robison Shell House, which are scheduled for renovation and expansion.

122

TEAGLE HALL

SCHOELLKOPF FIELD

(GYMNASTICS, M&W SWIMMING)

(FOOTBALL, SPRINT FOOTBALL, M&W LACROSSE, FIELD HOCKEY)

N EWMAN

REIS TENNIS CENTER/BELKIN SQUASH COURTS

A RENA

(M&W BASKETBALL, VOLLEYBALL)

(M&W TENNIS, M&W SQUASH)

JAMES LYNAH RINK

BARTON HALL

(M&W H OCKEY )

(M&W INDOOR TRACK & FIELD)

2005 FOOTBALL

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

DAVID F. HOY FIELD

NIEMAND•ROBISON SOFTBALL FIELD

(BASEBALL)

(SOFTBALL)

OXLEY EQUESTRIAN CENTER

FRIEDMAN WRESTLING CENTER

(EQUESTRIAN, M&W POLO)

(WRESTLING)

ROBERT TRENT JONES GOLF COURSE

COLLYER BOAT HOUSE/ROBISON SHELL HOUSE

(GOLF, M&W CROSS COUNTRY)

(M&W

ROBERT J. KANE SPORTS COMPLEX

ANDREW P. STIFEL ‘91 FENCING SALLE

(M&W OUTDOOR TRACK & FIELD, M&W SOCCER)

(FENCING)

R OWING )

WWW .CORNELL B IG R ED . COM

2005 FOOTBALL

123

TTHIS HIS I ISS CCORNELL ORNELL U UNIVERSITY NIVERSITY

Success In And Out Of The Classroom ... To be a Cornellian is to be among the best and Cornell DEPARTMENT OF ATHLETICS AND University’s intercollegiate athletic program is no difPHYSICAL EDUCATION MISSION STATEMENT ferent, ranking among the nation’s elite. The Big Red The Department of Athletics and Physical Education strives to competes at the highest level of intercollegiate ath- provide students with powerful and meaningful participatory experiences that forge enduring bonds with Cornell, and to provide for letic competition as an NCAA Division I institution. the well-being of members of the faculty, staff, and community. We offer a diverse program of physical and outdoor education, Rich tradition and history follow Cornell athletics recreational services, and intercollegiate athletic competition, eqthroughout the university’s storied past. Cornellians uitably adminstered with special attention to the needs of women and members of under-represented minority groups. We foster have been national champions in ice hockey, lacrosse, the values of physical fitness, total well-being, and enduring parin athletics; teach leadership skills, teamwork, responsipolo, rowing, track and field and wrestling. They have ticipation bility, and accountability; and administer programs that can be also earned spots in halls of fame, on All-America critical to the educational and personal development of students in keeping with the high standards of Cornell, teams, on the Olympic the Ivy League, the Eastern College Athletic Conference, and the National Collegiate Athmedal podium and have leticAssociation. written their names in The department promotes pride and unity within the university community and record books as provides opportunities to develop, strengthen Wimbledon tennis chamand maintain ties to external audiences such as alumni, friends, the educational commupions and major league nity, and the general public by attracting players in baseball, basinterest, recognition and support. ketball, football and hockey. More recently, Going National Cornell has won 22 Ivy The Big Red participated in student-athletes give back to the local and world comeight NCAA tournaments and League titles in the last Cornell munities through a variety of projects which have included three years, which is a reading to local elementary school children, a tsunami relief national meets in 2004-05 and raising funds for cancer research. Above, memwhile getting All-America perschool record for a three- concert bers of the Ivy League and ECAC Hockey League champion formances from 21 studentyear span. That is only men’s hockey team celebrate another successful season of sup- athletes. Cornell athletes were porting the Ithaca Breast Cancer Alliance. part of the equation. Duralso recognized for their acaing the same time period, the Big Red has had 10 student-athletes demic performances, garnering three ESPN the Magazine Acanamed Academic All-Americans, the most of any Ivy school. demic All-America selections and eight All-District bids.

WWW .CORNELL B IG R ED . COM

CORNELL BY THE NUMBERS ...

124

Travis Lee ‘05 celebrates his second NCAA championship in 2005. Cornell student-athletes have won 18 NCAA team and individual national championships in the university’s history.

2005 FOOTBALL

2 3 3 3 3 6 8 8 8 15 18 18 21 21 22 36 39 52 63 131 156 291

NCAA Woman of the Year finalists ESPN The Magazine/CoSIDA Academic All-America Hall of Fame members NCAA Postgraduate Scholarship Recipients Cornellians who own major professional sports franchises Cornell athletes named ESPN The Magazine/CoSIDA Academic All-Americans in 2004-05 Cornell student-athletes who have been awarded Rhodes Scholarships Ivy League team championships in 2004-05 NCAA tournament or championship meets Cornell participated in during 2004-05 Cornell athletes named ESPN The Magazine/CoSIDA Academic All-District in 2004-05 Ivy League team championships the last two years (School record) Total NCAA individual and team national championships Olympic gold medalists Cornell All-Americans in 2004-05 First team ESPN The Magazine/CoSIDA Academic All-Americans Ivy League team championships the last three years (School record) Varsity sports at Cornell Cornellians who have earned Olympic medals Total Cornell ESPN The Magazine/CoSIDA Academic All-Americans Total national championships in all sports for the Big Red All-Ivy selections in 2004-05 Total Ivy League team titles for the Big Red since 1956-57 Total Academic All-Ivy selections