Edinburgh Festival Fringe programme 1997

Page 1


Lift the curtain on every performance by carrying the Edinburgh Festival Fringe Visa Card as the Fringe will receive a donation for every card that is issued by MBNA International Bank Ltd. A donation is made to help support the Fringe every time you use it - at no extra cost to you - while you benefit from: •No ANNUAL FEE •COMPETITIVE INTEREST RATE OF

•Low

19.9% APR

RATE FOR TRANSFERRED BALANCES OF

9.9% APR

(VARIABLE) FIXED FOR

6

MONTHS

•ALL THE PAYMENT EASE AND FLEXIBILITY OF A VISA CARD

FOR MORE INFORMATION CALL FREE NOW ON

0800 776 262 QUOTING REF BS42

Applications are available from the Fringe office: Edinburgh Festival Fringe, 180 High Street, Edinburgh, EH1 IQS. Open from 10am until 7pm daily purchases is 1.53% (variable), equivalent :e your account is opened, equivalent to

C'

z^Up'A/Oo ^ • ?’ c

V


THE SCOTTISH ARTS COUNCIL

For postal sales before and during the Fringe, ordering your Fringe Club membership, LRT Bus Pass, and 1998 programme.

TH£ V£NU€ MAP

•GDINBVRGH THE CITY OF EDINBURGH COUNCIL

Every Fringe Venue has a number shown on this map and is listed in a numerical index with their grid reference.

The Festival Fringe Society Ltd. is a company limited by guarantee and recognised as a charity (Charity no. SC46605). Its policy is determined by a Board of Directors elected at the ACM in late August and is the continual improvement of the world’s largest open arts festival, where any person can participate without constraints by the Fringe Society. The Festival Fringe Society Ltd. accepts no responsibility for the accuracy of the contents or details listed in this Programme. Printed by Macdonald Lindsay Pindar pic. Cover Illustration by Janice Tabraham, Edinburgh College of Art. Design by Crombie Anderson, Dunfermline. Typesetting and layout by The Festival Fringe Society. With grateful thanks to Dave Simpson.

contents

TICKCT BOOKING FORM


Beck's BP City of Edinburgh Transport Department Debenhams HMV Macdonald Lindsay Pindar MSN, The Microsoft Network The Bank of Scotland The List Maitland Hotel Web 13, The Internet Cafe

Welcome to the 1997 Edinburgh Festival Fringe programme. Turn these pages and discover the astonishing wealth and diversity of artistic enterprise that only the Fringe can offer. The Fringe is not a programmed festival. There is no selection process, no panel of “experts” and certainly no censorship. The performers and companies that you will see in action have chosen to be here and have funded all their costs - sometimes many thousands of pounds. Their commitment to the Fringe is the living proof of the continued importance of an open festival, and the freedom allowed to them is a rare and precious commodity in a world governed by business plans.

And the support of the many organisations around Edinburgh who have joined our Fringe Angels Scheme

These brave performers take a huge risk in bringing a show to Edinburgh; you can help them by taking a much smaller risk and choose to see at least one show that you know nothing about. You never know, it may turn

Carlton Highland Hotel

jARCHANl

Debenhams pic The Elephant House Factotum Property Services

out to be the highlight of your visit!

Festival Flats John Menzies Pic

Don't be overwhelmed by the sheer size of the

Lauriston Farm Brewers Fayre

programme - there is certain to be something that will

Macka/s Agency (Holiday Property Letting)

appeal. At Edinburgh, avant-garde theatre frequently

Morgan Grenfell (Scotland) National Westminster Bank

performs alongside mainstream comedy, opera with freakshows, dance beside satirical revues. Everything in the

Point Hotel Stewart Ivory St Co Ltd The Witchery by the Castle

programme has potential and your choice is just as

United Colours of Benetton

important as the critics' selection. It might be a serious

Valvona St Crolla Caffe Bar

Eastern European version of Shakespeare; it might be the

Warehouse

rudest comic on the Fringe. What matters is that you're

Bann's Vegetarian Cafe

here - being an essential part of the World's Largest Arts

Cafe Vienna

Festival.

The Cashmere Stores Clydesdale Bank Pic

Hilary Strong, Director

Henderson's Salad Table John Gray St Co. S.S.C. Kalpna Restaurant L'Auberge Restaurant Franijais Nicolsons Cafe Bar Restaurant Old Waverley Hotel Romanes and Paterson Tods Murray WS White Dove Crafts

Alfresco’s Alp-Horn Restaurant Archie’s Sandwich Bar Aitken Dott The Baked Potato Shop Celtic Leather Chez Jules Restaurant Circles Coffee House Denzler’s 121 Restaurant Domino’s Pizza The Edinburgh Floatarium

to the

Fringe Otticef (photo by Amanda Robbins)

Grain Store Restaurant Geoffrey (Tailor) Highland Crafts Giuliano’s Helios Fountain Gift Shop Helios Vegetarian Coffee House Helios Vegetarian Coffee House at Theatre Workshop lan Dickson Travel Service Jolly Judge

Le Sept Mammas American Pizza Company, Grassmarket Mammas American Pizza Company, Howard Street McCalls of the Royal Mile Meadows Guest House

Royal Mile Whiskies Spice Island Subway Leisure Ltd Supasnaps Susies Wholefood Diner The Witchery Tours


The Fringe Office, 180 High Street, Edinburgh, EHi iQS Tel. ( 0131) 226 5257 / 5259 Fax. (0131) 220 4205 email, admin@edfringe.com

Telephone Sales

(0131) 226 5138 10 Lines

INFORMATION The Fringe Cfjfjice During the festival we employ a large, well-informed staff who aim

Open: Hours:

to provide comprehensive information on all Fringe shows, including

Monday 23 J une ioam-6pm, Mon-Sat (23 June-26 July) 9am - 9pm, 7 days a week (28 July-30 Aug)

ticket availability and changes to information in the programme.

Tickets can either be posted or held for collection at the Fringe Box Office

They do not however recommend productions.

The Daily Diary This is an up-to-date chronological listing of every show or exhibition taking place at the Fringe on any one day. It is free and available

Minicom Number: (0131) 220 5594

at the Fringe Office as well as over 30 locations throughout Edinburgh.

for customers with hearing difficulties Disabled access information on page 145

LRT FCSTIVAL BUS PASS The Festival Fringe Society has negotiated a discount Bus Pass in conjunction with Lothian Regional Transport. Unlimited travel on LRT buses (excluding night buses) for one week costs â‚Ź10.00. Passes can be purchased at the Fringe Box Office (in person or by phone) and can also be ordered via the Booking Form at the back of the programme.

FRINGC '97 ON THâ‚Ź INTCRNCT Supported by WEB 13 Internet Cafe This programme is also available on the World Wide Web at

http://www.edfringe.coin

IN PCRSON At the Fringe Office 180 High Street, Royal Mile, Edinburgh Opens: Monday 28 J uly Hours: loam-ypm, 7 days a week

At Waterstones Waterstone's Booksellers, 83 George Street, Edinburgh Opens: Friday 1 August Hours: loam-ypm, Mon-Sat nam-ypm, Sundays

The programme includes a unique search facility to locate your favourite performer or show, or you can search on key-words given in the text. The Daily Diaries are also available on-line enabling you to plan day-by-day visits in advance. Once you have seen a Fringe show, you can also post your own review in the Unofficial Reviews Section and read those already posted by other Fringe enthusiasts. If you do not have your own access to the Internet, you can surf the Fringe Pages and the rest of the Internet at Web 13 Internet Cafe, 13 Bread Street, Edinburgh.

USCFUL TCLCPHONC NUMBCRS Fringe Club

Tourist Information

557 1700

International Festival 473 2000

650 4673

Accommodation

557 9655

Military Tattoo

225 1188

Police

311 3131

Film Festival

228 4051

British Rail

0345 484950

Jazz Festival

557 1642

Bus Information

225 3858

Airport

3331000

At the Fringe Club Teviot Row Bristo Square (venue no.2) Opens: Friday 8 August Hours: loam-ypm, 7 days a week

At the Scottish Gas Mobile Information Centre Princes Street Gardens, by The Mound Opens: Sunday 10 August - 29 August Hours: ioam-5.3opm, 7 days a week

At James Thin Booksellers 53-59 South Bridge Opens: Tuesday 5 August Hours: loam-ypm, Mon-Sat nam-5pm, Sundays

By POST To: Opens:

Becking term at the back ct the pregramme

BOX YQ_, 180 High Street, Edinburgh. EHi iQS Monday 16 June Please allow a minimum of ten days for delivery.

I


INDCX OF COMPANICS A A-Bit-Of-Rough Theatre Company 68 Ablaze Theatre Company 68 Abracadabarets 38 Absinthe 68 Absolute Banana Theatre Company 68 Absolute Blues And More 38 Action Theater 68 Active Performance Productions 68 ACTS 68 Adam Crow and Mitch Benn 10 The Adam Pottery 114 AFG (Cutting Edge Theatre Company) 68 Afterthought 69 Agape Theatre Co. 61,69 Aha! Sister City Sisters From Dunedin, New Zealand 10,69 Albatross Theatre Company 69 Alborada Productions 38 The Aldridge Gallery 114 American High School Theatre Festival 10,61,69,70 American University In Cairo 70 Amnesty International 10 Angel Fish Theatre 70 Angelic Voices 38 Annex Theatre - USA 71 Antonio Forcione & Neil Stacey 38 APIP Production 71 Apu - Dancing with the Inca 38 Aqua - Craft from the Island of Funen 114 Paolo Aragona 38 Arborea Musica And Friends 39 Architecture on the Fringe I 114 Architecture on the Fringe II 64,114 Architecture on the Fringe III I 14 Arkle Theatre Company 71 Arthrob 64,119 The Arthur Terry School 61 The Arts Out Of Africa 64 The Ashcombe School Theatre Group 71 Assembly Rooms 10,11,34,39,40,71 Asylum Theatre Company 72 Atlantic CTC 72 Attic Theatre Company 72 Aurora/Western Connecticut State University 7,72 Australian National Theatre Company 72 Axis 72 Azabache: Cuadro Flamenco de Diego Mora 40 B Bablake at Diverse Attractions 11 Backstage Theatre Company 72 David Baddiel 11 Bill Bailey 11 Barbys, Bulls and Haggis: The Comedy Feast 11 Bare And Ragged Theatre 73 Arj Barker 11 Barry Sorts it Out 73 Bats 73 Battlefield Band 40 BBC Radio 4 11,12 BBC Radio Scotland 12,40 BBC Television 12 Bea Love at Midnight 12 Be Ba Theatre 73 Lenny Beige 13 David Benson 73 Best of the Fest 13 Better Out Than In Theatre Company 73 The Big Picture/An Dealbh Mor 119 Big Top Extravaganza! 13 Big Word Performance Poetry 73 The Blackadder Gallery 114 Black Light Theatre Company 74 The Blasted Heath Players 74 Adam Bloom 13 Blunderbus Theatre Company 7 Bob Hellon & Catherine Side 74 Bodies Electric 34 Boilerhouse 74 Bold As Brass Entertainment 74 Bolshoi Circus 74 Jane Bom-Bane 40 Brainpool 64

Breakwith Productions 74 Diverse Attractions Theatre Complex 81 Brentwood Theater Company 74 DOM Festival of Art, Music and Animation 42 Marcus Brigstocke 13 Bringwonder the Storyteller from Double Edge Drama 81,82 17 New Zealand 7,74 Doug Healy as Chic Murray Bob Downe 17 Bristol Old Vic Theatre School 17 Graduating Students 75 Graham Duff 82 Bristol Travelling Theatre 75 The Dylan Dog Theatre Company The Broken Dream Theatre Company 75 Broken Heart Theatre Company 75 17 Bruised but Conscious Productions 75 Jenny Eclair Brunstane North 61 Eclipse 82 Peter Buckley Hill 13 Eclipse Theatre Company 82 Bunbury & Co 61 Ed Byrne & Brendan Burns 17 7,42,82 Burklyn Youth Ballet 34 Edinburgh Acting School Ed Byrne 13 Edinburgh College Of Art 115 The Edinburgh Comedy Revue 17 Edinburgh Contemporary Craft Fair 65,115 C C 7,75 Edinburgh Festival ofYouth Chamber Choirs 42 Cafe Graffiti 40 Caledonian Brewery 40 Edinburgh Festival Voluntary Caledonian Folk At The Guildford 40,41 Guides Association 65 California Faultzone 7,76 Edinburgh Gaelic Drama Group 82 Cambridge Footlights 13 Edinburgh International Science Festival 7 65 The Cambridge Mummers 76 Edinburgh Mela 82 Cambridge Opera Group 61 Edinburgh People’s Theatre 115 Cambridge University ADC 61,76 The Edinburgh Photographic Society Camera Obscura 114 Edinburgh Printmakers Workshop and Gallery 115 Capab (South Africa) 76 Scott Capurro 15 Edinburgh Renaissance Band 42 Catalyst Theatre (Canada) 76 Edinburgh Royal Choral Union 42 Caveat Theatre Co. 76 Edinburgh Theatre Arts 83 C.C.T. 76 The Edinburgh University Footlights 61 Charlie Cheese 15 Edinburgh University Theatre Company 17,83 The Cheese Shop 15 Edinburgh Workshop For The The Cherub Company 76 Expressive Arts 61 Choudhury & Co-The Bangladesh Edinburgh Youth Music Theatre 61 83 Festival Of Food And Culture 64 Edinburgh Youth Theatre 115 Chrysalis 41 Edinburgh Zoo I 15 Charlie Chuck 15 Edith Simon Gallery Cirque Baroque 76 Jo Enright 17 Cirque Diesal 34 Eskmouth Theatre Company 17 City Light Productions 77 Exacting Theatre Company 83 The Clarsach (Scottish Harp) Society 41 Ex Collegio Cantabrigiensi 42 Classic FM 64 Close to You 77 The Clothes Off Our Backs 115 The Fabulous Fourmel’dyhides 42 Club Seals 15 The Famous Grouse House - Scottish International presents 7,43,44,83,85 Jackie Clune 15 Cluub Zarathustra - Attention Scum 15 The Fantastical Theatre Company 61 Comedy Cafe Roadshow 15 The Far Canals 19 The Comedy Zone 16 Festival of British Youth Orchestras 45,46 Communicado Theatre Company 77 Festival Spirit 47 85 Compagnie Yvette Bozsik 34 Festival Theatre USC-USA Company Theatre 16,77 Firefly Productions 85 Conspiracy Theatre 77 Fireraisers Theatre Company 85 Continental Shifts at St Bride’s 34 Firkin Fringe 19 Melody Cooper 16 First Among Sequels 85 Corazon Productions with Paradise Max Fisher 86 by way of Kensal Green 77 Flux:The Edinburgh New Music Festival 47 George Costigan 77 Flying Pig Theatre Company 86 Crazy Horse Theatre Company 78 A Folking Palaver at La Belle Angele 49 Crumpet Theatre Company 78 Foolery 86 Crying in Public Places 78 Forkbeard Fantasy 86 Cuba Libre Scottish Cuba Defence Fork Tongue Theatre (Sheffield University Campaign Benefit 41 Theatre Company) 86 Cygnet Theatre 78 Forth Childrens Theatre 61 Fox Youth Theatre 7 D Jason Freeman 19 86 Daedalus Theatre Company 78 Fresh Blood Theatre The Daily Telegraph Open Mic Award Friends Of The Western Buddhist Order 65 - Grand Final 16 Fringe AGM 66 Dallas And Packer 16 Fringe Club 19,49 Dark Matter 78 Fringe Poster Exhibition 119 Dave Johns - On The Edge 16 Fringe Sunday 66 David A Hall Whitburn Band 42 Stephen Frost 19,86 David Mitchell & Robert Webb 16 Rich Fulcher 19 Dazzle Contemporary Jewellery I 15 full figure theatre company 35 Jack Dee 16 The Fun Factory 86 Demarco European Art Foundation 34,35,64,78,79,119 De Montfort Theatre Company 80 Galerie Mirages Desirable Residence Theatre 80 Gallery MacColl The Desperado Theatre Company 80 Gandini Juggling Project Devayani 35 GASP Diakonos Physical Theatre 35 Gay Men’s Health Dice Theatre Company 80 The Ghost Road Company (USA) Diverse Attractions 65,80,81,119 Kevin Gildea

Gilded Balloon 7,20,21,23,35,49,87,81 Good Idea Company Gordonstoun Youth Theatre Dave Gorman - in the Pleasance with the Microphone Boothby Graffoe Grassmarket Project (GMP) Grease the Night Club Steven Alan Green Gresham’s Youth Theatre Grid Iron Theatre Company Grin Reaper Guandaline Sagliocco

Hanky Park Productions 88 Hard Knock Kafe Kids 62 Harland Hamstrings Theatre Company 62,89 Harpsichords at St Cecilia’s Hall 50 H.D.G. Productions 89 Henry’s Cellar Bar 50 Herrick Theatre 89 Richard Herring’s Excavating Rita 23 Rainer Hersch 23 Highly Recommended 23,50 Holyrood Art Club 116 Hong Kong Youth Arts Festival 7 Horse plus Guest Players 51 Hourglass Productions 89 Sean Hughes 24 Hundred Heads 89 Hungarian Overtures/ Merlin International Theatre 51,89 I Ian Stone - Bit of Didley Squat Ian Turbitt’s Puppet Theatre Illyria imago Indian Dance Society in Association with Romanska Inhouse In Medias Res Theatre Company Instant Sunshine International CD & Record Fair In Your Space Productions

24 7 90 90 36 116 90 24 66 90

J Jacknife 90 Japan Experience 24,36,51,66,90,119 Jasperian Theatre Company 62 The Jazz Club 51 Jazz Jam Session 51 Jenners 116 Jimeoin 24 Jo Brand, Mark Lamarr, Jeff Green, Richard Morton & Andy Robinson 24 John Peel Puppets 7 Milton Jones 24 Judith Glue Interiors and Gallery 116 Judy with love 90 K Karen Kaderavek - Cellist Kassiopia Theatre Company K C Productions Ltd KCS Theatre Company Ian Kendall Kenny Young and The Eggplants: The Eggplant Evolution Tour Keti Productions Inc. Keyhole Theatre Company K.486 Khublai Khan’s Mongolian BBQ and Bar The Kimbara Brothers Bob Kingdom Kismet Theatre Company Kissing the Goldfish Kit And The Widow Kronis& Alger (USA)

The Laboratory La Canapia La Folia Teatro (Spain) Larry Trafalgar Presents Lawnmowers Lawrence Leyton’s Mindf***

51 90 62 90 24 51 66 90 91 25 52 91 91 25 25 36


The League of Gentlemen 25 Leaveners Theatre Company 92 Lee and Herring - This Morning with Richard, Not Judy II 25 Stewart Lee - King Dong vs Moby Dick 26 Leicestershire Youth Arts 7,8,62,92 Leitheatre 92 Leith Gallery Productions 93 Angie Le Mar 26 Les Enfants Terribles 93 LesVagues Francaises 93 The Lied Trio 52 Limb 93 LM Magazine 26,66 Loaded Theatre Company 93 Sean Lock 26 Looking Glass Productions 93 Loyko 52 Lucid Productions 93 L’Ultima Recital 26 Lusty Juventus 36 LWT Comedy Writing Award 26 M Alistair McGowan 26 Dougie MacLean 52 Donna McPhail 26 Alan McPherson 116 Magic Carpet Theatre 8 Mark Maier 26 The Makars and DMDC 93 The Mambo Club 52 Mamelodi Theatre Organisation 37 Manchester Metropolitan Drama Society 93 Maria Cardona Dance (Spain) 37 The Marsh 93 Shelagh Martin 27 Master Rosencrantz’s Little Eyases 94 Mathis Schrader 94 The Mean Fiddler 52 Megalomania 94 Eva Meier 53 Mel & Sue, Geraldine McNulty and Emma Kennedy 27 Menagerie Theatre Company 94 The Merlin Society (Scotland) 117 Mervyn Stutter’s Pick of the Fringe 27 Alex Milligan 119 Mirador Productions 94 Mr McFall’s Chamber 53 Modernising Theatre Company 94 Moliere for Lunch 94 Momentary Fusion 37 Montresor 117 Ben Moor 27 Dylan Moran 27 Bruce Morton 27 MPS - Guy Masterson Productions 95 Al Murray The Pub Landlord King of Beers 27 My Friend the Chocolate Cake 53 N National Gallery of Scotland 117 National Library of Scotland 117 National Student Theatre Company 95 National Youth Music Theatre 62 The National Youth Orchestra Of Scotland 53 National Youth Theatre of Great Britain 95 Negative Equity Theatre Company 95 Neptune Theatre Liverpool 27,29 The New Buckenham Players 95 Newbury Youth Theatre 95 The New Jim Rose Circus 29 The New Light Bulb Theatre Company 95 Newsrevue 29 New York Jazz! 53 Glynn Nicholas 29 Nights In The Carpenter’s Arms 53,66 Mieko Nishimura 117 NND Ngarindjeri - Narungga Dreaming 37 No Grey Suits 95 North West Leicestershire Youth Theatre 62,95 Graham Norton 29 Nottingham Playhouse Roundabout TIE 95

Nottinghamshire Education Theatre Company Nottingham University New Theatre Company

8,95 96

O Earl Okin 29 Old St Paul’s Music‘97 53 The Old Town Bookshop 117 Ole! 29 Omid Djalili is Ethnic 29 104 Theatre Company 96 Owen O’Neill 30 I 2 Look Out 4 30 On the Road 8,62 Opera Invention 62 Operaworks 62 Optimism 8,96 The Original Edinburgh Literary Pub Tour 96 Outhouse Productions 96 Out of Joint/Royal Court Theatre 96 Out of the Nomads Tent 117 Oxford Brookes Student Union Drama 96 Oxford Concert Party - Europe’s only Baroque & Tango Orchestra 54 Oxford Out of the Blue 97 Oxygen House and Merlin Theatre Company 97 Oxygen Productions 97 Ozmosis Productions 62 P The Paddie Bell Festival Folk Show 54 Pantomime Prods 30 The Paramount Comedy Channel presents The Britcom Benefit 30 Parsons & Naylor 30 Partially Total Theatre 97 Peepolykus 30 Pellew International 30 Penn Theatre Ensemble 97 Peppery Edge Productions 97 Performance Exchange 97 A Perret and a Well Oiled Limb 30 Perrier Pick OfThe Fringe 30 Persian Village 117 Petticoat Opera 62 Philomusica of Edinburgh 54 Pia Fraus Theatre Company 37 Plasticacid Theatre Company 97 The Player’s Company 97 Pleasance Comedy 30 Pleasance Festival of Theatre ‘97 8,54,66,97,98,99,100 Plunge! Productions 63 Porteous & Archer 30 Portfolio Gallery 118 Poulter and Duff 30 Pounds, Dollars and Cents 100 Margarita Pracatan 54 The Prince’s Trust 54 Prominent Theatre 101 Greg Proops 30 Proscenium Theatre Company 63 Provincial Booksellers Fairs Association 118 Psycho Zydeco 54 Pulse 101 Punchline Productions 30 Purves International Puppets 8

Q QMW Theatre Company Quaker Festival Committee The Queen’s Hall Queen Margaret College Drama Department Ft The R.A.T. Pack Re-Act Theatre The Realistic Theatre Company of Edinburgh Really Necessary Travelling Actors Red Eye Productions Red Fish Theatre Company Red Jam Red Shift Theatre Company Red Sox

101 118 54 101

63 101 63 101 101 101 103 103 54,103

The Regency Rooms with Lenny Beige 31 Richard Medrington’s Puppets 9,103 Rogues’ Gallery 118 Rosemary George & Richard Shadroui 55 Rowan Tree Company 103 Royal College Of Surgeons Of Edinburgh I 18 Royal National Theatre Studio 66

St Andrew’s & St George’s At Festival Time 55,56 St Mary's Cathedral 56 St Michael & All Saints Church 56 Sanctuary Gardens - Festival of Healing 67 S.A.S - A New Force in Comedy 31 Scared Weird Little Guys 31 Schhh! Theatre Company 103 Scottish-American Ballet 37 Scottish National Gallery of Modern Art I 18 Scottish National Portrait Gallery 118 Scottish National Portrait Gallery atTheRSA 118 Scottish Poetry Library 103 Scottish Sinfonia 56 The Scottish Theatre and Music School 31,63,103 Screaming Blue Murder Comedy 31 2nd Nature 103 Second Thoughts 103 Segovia Guitar Trio 56 Seventh Son Productions 103 Sexteto Canyengue 56 The Shakespeare Workshop 67 Shakti 37 Kerry Shale 103 Shambhala 56 Shattered Windscreen Theatre Company 103 Shiho Sound Japanesque 56 The Shoestring Players 104 Short Back & Sides 104 Showstoppers 119 Shrewsbury School 63 Junior Simpson 31 Sir Bernard Chumley 31 Frank Skinner 32 Slap Me Productions presents Kate Shortt 32 Sleeve Productions 104 Small Planet Productions 104 Smarx Arts Crew 63 Smashing Theatre Company 104 Sol Survivor 104 Soup Kitchen Theatre 104 Southern Light Drama 104 So You Think You’re Funny? 32 Spellbound Productions 105 The Spiegeltent - sponsored by Beck’s Bier 57,67 Spontaneous Combustion 32 Square Watermelon Productions 105 Stage 2 105 Stage 84 63 The Stand Comedy Club 32,105 Stand Up Straight 32 Stanley Theatre Group 105 Sternberg Theatre Actors Repertory Society 105 Shane St James 31 Stockbridge Bookshop 119 Straight Up Theatre Company 105 Stray Dogs Theatre Company 105 Stray Theatre Company 105 Strictly Scottish 37 Strut & Fret Theatre Company 105 Studio One Gallery 119 The Studio Theatre Company 57,105 The Summer of Love Dance Party 57 Sutton Coldfield College 105 Sylvia Troon’s Kenspeckle Puppets 9 Synaesthesia and Theatr lolo Goch 106

Tagus Theatre Lisbon Taihen (Japan) Tall Stories Tamar Theatre Company, West Leigh The Tarantinos Teatr Ludowy - Krakow, Poland

106 37 106 106 58 106

Teatr Snow (Theatre of Dreams) 106 Theater Ten Ten 106 Theatre De Simplicite 107 Theatre of Eternal Values 107 Theatre Transformations 107 Theatre West 107 Theatre Works 32 Theatre Workshop 108 Theatrum Botanicum - Theater of Plantes 108 ThinkTwice Theatre Company 108 Third Stage Productions 108 Mark Thomas 32 Those Theatre People 108 Three 32 3 Men and 2 Dogs 33 Tiny Mo’s 33 Tomee Theatre 108 Tommy Tiernan & Jason Byrne 33 The Topp Twins 33 The Totally Portable Theatre Company 108 The Touring Company 108 Traverse Theatre 109,110 Trestle Theatre Company I 10 Trip 26 Theatre Company 63 Tron Ceilidh House 58 20toTheatre 110 U The Ugly Duckling Theatre Company The Underground Theatre Company Ltd. Union Theatre The Unseam’d Shakeseare Company Y Valvona & Crolla JohnnyVegas The Venue Venue 13 Venue 123 Voices OfThe South & Theatre Whatsit Volcano Theatre

58,111 33 58 9,111 III 63,111 112

W Wallingford Parish Church Choir Sandy Walsh HankWangford Waxen Patience Theatre Liz Webb The Weird Sisters Philip Wells Wemyss Ware and its History West End Craft and Design Fair West End Theatre Company The Wey Valley Theatre Company Whistlebinkies Whistlebinkies Unplugged Cellar Club White Rabbit Cowboys Wierszalin Will Gaines - Jazz Hoofer With Wings & Nemesis Theatre Companies The Works Theatre Company World Music on 2 Guitars The Wotjacallem Players

Y Yes & No Theatre Co Yllana Young, Gifted & Green Young Opera Youth Connection Youth International at St Oswald’s Youth Theatre - Latvia Y Touring Theatre Company Z Zendo Martial Art Show Paul Zenon Frei Zinger Zoot Money, Woodstock Taylor and a Strawb Z Theatre Company

110 110 63 110

58 112 58 112 33 112 112 119 119 112 112 58 58 112 112 37 112 I 12 58 112

112 33 33 63 63 113 113 113.

37 33 58 58 113.


Th^Programme otherwise stated. tickets for all shows are sold in advance from the Fringe Box Office and at the venue about 30 minutes before each performance. Some venues also run their own Box Office. This is indicated by the word 'Tickets' and a telephone number e.g. Tickets 123 4567 which may only operate during the Fringe. Please read page 3 for further Booking Details. How to.

Use the Programme

All entries in the programme have been standardised for ease of reading. A variety of abbreviations and symbols are used throughout.

WEEK BLOBS Show at a glance which week(s) the company is performing. Fringe weeks run from Sunday to Saturday, and any events before Sunday 10 August are deemed to be in Week o.

VENUE NUMBER Each fringe venue has its own number. Find it

MAP GRID REFERENCES

on the Venue Map using the Grid Reference

Use this in conjunction with

FRINGE FIRST STAR Indicates that the play is eligible for a Scotsman Fringe First Award. These awards are given to companies presenting outstanding new dramas which have not been performed more than 6 times in the UK.

NON-VERBAL THEATRE —

the location of the Venue

OOG0

FRINGE SUNDAY Venue 10 - Holyrood Park, foot of Royal Mile. Info 226 5257

Ki6~

★ ■ FRINGE SUNDAY The highlight of the Fringe! Where else

PRICES Are for unreserved seats

can you get it all - hundreds of Fringe performers, music, comedy,

in nearly all cases.

circus, theatre. Non-stop entertainment, great food and fresh air.

Concessions (reductions) are

Laze, graze and be amazed. The fun kicks off at II o’clock! Aug 17 11.00 (17.00)

Free

often given to students (S), Unemployed (U), OAP's (O), Disabled(D),

Indicates show suitable for

Children under 16 (C).

non-English speakers.

- Identification will be asked for.

TIMES DATES

The 24 hour clock is used. Shows starting in the early

Fringe performances can take place

morning eg. 0115 are listed under the day before date,

on any day of the week. Sundays are

but shows starting at 7am are shown on the current

assumed to be performance days unless

day's date. Finishing times in brackets are approximate

otherwise stated.

and cannot be guaranteed.


AURORA/WESTERN CONNECTICUT STATE UNIVERSITY

oo©o

Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226

Aug 12-23 (not 18) 11.30 (12.20) £4.00 (£3.00)

BLUNDERBUSTHEATRE COMPANY

OO©©

Venue 45 - Old St Paul’s Church & Hall, Jeffrey Street. Tickets 556 0476

BRINGWONDERTHE STORYTELLER FROM NEW ZEALAND ©OOO Venue 126 - C cubed, St John’s Hall, West End Princes Street Tickets 225 5105

19

★ BRINGWONDER’S WORD MAGIC With beautiful language and epic sweep, one of the greatest exponents of participation story-telling leads audiences into a colourful experience of fable and magic drawn from the story heritage of the Pacific, Native Americans and Celts. Aug 6-16 (not 10) 11.30 (12.20) £5.00 (£4.00) (£3.00 C)

®o©©

Venue 19 - C, Over-Seas House, 100 Princes Street Tickets 225 5105

110

★ ■ THE LITTLE MERMAID The sweet-bitterest story ever whispered between the stars and the sea. Lighter than spray, weightier than a forsaken heart, see Hans Christian Andersen’s classic brought to life by the creators of I996’s sell-out The Snow Queen. Thrilling, tautly-written’ TES Aug 6-30 (not 17) 11.30 (12.20) £5.00 (£4.00 SUOD) (£3.00 C)

CALIFORNIA FAULTZONE

K13

■ THE HONORABLE URASHIMATARO Based on a Japanese folktale character and his undersea adventure to save a Princess’s Palace from the evil Giant Sea Scorpion. Colourful costumes, enchanting dance and life-size puppets. Aug 11-22 (not 17,20,21) 12.25 (13.15) £4.00 (£2.00)

OOOO

Venue 177 - YMCA, 73 Ferry Road

B17

★ THE HAPPY PRINCE This adaptation ofWilde’s classic story is presented with the charm, style and sensitivity that Fringe audiences have come to expect from students of EAS.The moral of the story is vividly realised, the drama enacted with exuberant high spirits. Aug I 1-16 13.00(14.00) £3.50 (£2.50)

©GOO KIO

★ IT CAME FROM PLANET RIMELLE... Who will save us from Maxine Factor, evil Empress of Planet Rimelle, and her deadly foundation, Factor No 17? It must be.Jt has to be.Jt could only be...The Nice Girls! Girl Power...with talent. Aug 8-16 12.55 (14.00) £5.00 (£3.50)

GILDED BALLOON

®0©0

Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

K12

MAGIC BOB’S CABARET FOR KIDS Eye-popping Magic, side-splitting Comedy and heaps of audience involvement make Magic Bob’s latest show a must for all kids. A whole heap of new tricks and skill based routines guarantee ‘an hour that flies by like magic’ The Guardian. Aug 8-17 11.00 (12.00) £5.00 (£3.00) Venue 36 - Gilded Balloon II, People’s Palace, Old Fishmarket Close Tickets 226 2151

K12

MOONDANCE Where can you take a sick Teddy to recuperate after an accident? A trip to the seaside, a farm or somewhere quiet and peaceful like the moon. Meet Morag and her Guardian Angel in this show for 3-6 year olds. Aug 16-23 11.00(11.45) £4.00 (£3.00)

©G©0

Venue 34 -The Famous Grouse House,5 Chambers St Tickets 220 5606

KI2

★ ■ CURIOUSER ...AND CURIOUSER A high energy physical journey of self-discovery seen through teenage eyes. No quick fix solutions promised! ‘Youth theatre at its best’, a fun bilingual text blended with contemporary dance and original music. Aug 8-16 12.00 (13.00) £4.50 (£3.50) ★ SSSHHH...! Three traditional fairy tales. Let your imagination soar the skies!! High quality musical, physical, family theatre:The Frog Prince, Rumplestiltskin and The Emperor’s New Clothes. Performed by an international professional cast. Aug 8-17 15.30(16.20) £4.50 (£3.50)

IAN TURBITT’S PUPPET THEATRE

©O©©

Venue 30 - The Netherbow Theatre, 43 High Street. Tickets 556 9579

J13

■ THE ADVENTURES OF PETER RABBIT Peter has been eating in Mr McGregor’s vegetable patch, nearly getting caught by Mr McGregor himself. Is he safe at home now? Adapted from the original Beatrix Potter books with permission from Frederick Warne and Co. Aug 7-30 (not Suns) 11.15(12.05) £3.00 (£2.50)

■ TOM SAWYER’S TREASURE HUNT This delightful dramatisation combines adventure with childhood hopes and dreams. Its appeal reaches out to children and adults alike in this timeless story brought to you by the acclaimed student company from EAS. Aug 11-13 14.30 (17.00) £6.00 (£4.50) Aug 14-16 19.00 (21.30)

JOHN PEEL PUPPETS

EDINBURGH INTERNATIONAL SCIENCE FESTIVAL

®o@©

Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606

FOX YOUTH THEATRE Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226

HONG KONG YOUTH ARTS FESTIVAL

00©0

Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991

EDINBURGH ACTING SCHOOL

L THE CHIPOLATAS present their legendary children’s show - featuring riproaring energy, loony tunes, sparkling circus skills, stories, songs and riotous routines.The visual impression of their stripy attire, and their spirited sounds will inspire, enthuse & enthrall children of all ages! Aug 27-30 12.15 (13.15) £6.00 (£4.00)

J13

★ THE EMPEROR’S NEW CLOTHES This enchanting version of Hans Christian Andersen’s classic tale will transport your child into a fantastical world of magic and mayhem! Meet Emperor Umpityfoo and a host of comic characters in this ingenious and brilliantly funny adaptation for all the family!! Aug 11-30 (not Suns) 10.35 (11.35) £4.50 (£3.00)

c

CHILDREN'S SHOWS

KIO

★ ■ A TRIP TO THE FARM An inter-active children’s journey with singalongs and games.The exuberant cast will lead children on an imaginary fun filled trip to learn about farm life. Involving, imaginative and exciting. Kids get to

KI2

■ SOUNDS SENSATIONAL New from the Edinburgh International Science Festival, a fast, loud, action-packed look at the maths behind music and the science of sound. Discover supersonic and subsonic sounds, and let surround sound move you through space. Aug 8-17 13.45 (14.30) £3.00 ■ SECRETS OF THE THEATRE EXPLAINED Setting the scene with smoke, flashes and bangs! Creating atmosphere with light and space! This unique show from the Edinburgh International Science Festival explains how science creates the dramatic effects of stage and screen. Aug 20-24 13.45 (14.30) £3.00 ■ LIGHT AND ILLUSION What is light? Is seeing believing? A visual feast of flashes, sparks, lights and lasers! Witness live experiments and demonstrations on the nature of light and perception at this stunning show from the Edinburgh International Science Festival. Aug 27-30 13.45 (14.30) £3.00

THE FAMOUS GROUSE HOUSE - SCOTTISH INTERNATIONAL PRESENTS Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 BABUSHKA AND THE BEAR Papa Ivanov warms himself by a simple stove. He tells the story of Babushka and the bear who loves to dance but is too lazy to gather wood for himself. Intended for over 5’s. Aug 8-17 10.15(11.15) £4.00 (£3.00)

OG©0

Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212

L13

THREE BILLIGOATS GRUFF AND THREE LITTLE PIGS Best on the Fringe for tinies’ - John Peel Puppets return with an exciting retelling of two classic stories for 3-7 years.Very realistic puppets. Much participation. Book early - always a sell-out! Aug 11-23 (not 17) 11.00 (11.50) £3.50

LEICESTERSHIREYOUTH ARTS

OG©0

Venue 65 - St Ann’s Community Centre, South Gray’s Close, Cowgate. Tickets 557 0469 from 6 August KI3 ★ ■ GRIMMS FAIRYTALES Timeless tales from the masters of story telling. A montage of the best loved characters from all our childhoods. Snow White, Red Riding Hood and Hansel and Gretel are all waiting to meet you. But look out for witches...! Aug I 1-16 10.00(11.00) £4.50 (£3.50) ★ ■ WIND IN THE WILLOWS By Kenneth Grahame.‘Hang Spring cleaning!’ said Mole. And who wouldn’t, when the world‘up top’ is so enticing? Riverside picnics, adventures in the Wild Wood - and wonderful friends like Ratty, Badger and the incorrigible Toad! Aug I 1-16 12.00 (13.00) £4.50 (£3.50) ★ WHYTHE WHALES CAME By Michael Morpurgo, presented by The Theatre Company.The Scilly Isles. 1913. Can Grade and Daniel find out the truth behind ‘the curse of Samson Island’...? Aug 18-23 10.00 (11.00) £4.50 (£3.50) ■ HIAWATHA Adapted from the Longfellow poem. Michael Bogdanov’s award winning adaptation. The Young Vic triumph that became a modern classic. A fascinating portrait of the world of the native Americans - a timeless world of myth, earth magic, loyalty and betrayal... Aug 18-23 12.00(13.00) £4.50 (£3.50) LEICESTERSHIREYOUTH ARTS continues on

page


CHILDREN'S SHOWS LEICESTERSHIRE YOUTH ARTS continued ★ ■ MACHINE GUNNERS By Carnegie Award Winner Robert Westall. Tyneside, World War II. A group of kids‘borrow’ a machine gun - plus ammunition! - from a crashed German plane...A tough, comic tribute to the resiliant humour of ordinary people in wartime. Aug 18-23 14.00 (15.00) £4.50 (£3.50)

MAGIC CARPET THEATRE

©O©©

Venue 82 - Southside, Southside Community Centre, 117 Nicoison St. Tickets 667 2212

M12

THE WIZARD OF CASTLE MAGIC Funny and spooky play for 5-1 Is and families. When the Sorcerer’s Apprentice, Micky, meets the Wizard and Catastrophe, his invisible cat, the fun begins. Previous shows:‘show is a romp, children love it’ Scotsman. Aug 9-30 12.10 (13.25) £5.00 (£4.00) Double Bill Price (with Circus Workshop) £7.00 ■ CIRCUS WORKSHOP Try juggling, rola bola, unicycle, diabolo, plate spinning and other thrilling circus skills, even lie on a bed of nails! ‘Children left with faces painted, eyes shinning with excitement’ The Herald The audience are the stars’ Evening News. Aug 9-30 10.10 (11.45) £3.50 Double Bill Price (with The Wizard of Castle Magic) £7.00

NOTTINGHAMSHIRE EDUCATION THEATRE COMPANY OOO© Venue 126 - C cubed, St John’s Hall, West End Princes Street Tickets 225 5105

19

★ ■ HANS UP! Fairytale return for Fringe First winning youth company, integrating young people with special needs. Come to storyland - see The Emperor’s New Clothes, meet The Snow Queen and other favourite characters. Hans Christian Andersen’s enchanting tales delight all ages. Aug 25-30 11.15 (12.15) £4.50 (£3.50 SUOD) (£2.50C)

ONTHE ROAD

OOO©

Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212

L13

★ ■ DOTTY QUAVER’S LAST SYMPHONY A new musical play for all ages. When eccentric composer Dotty Quaver arrives on the Isle of Plenti, she finds trees and animals behaving strangely. A fortune teller recognises Dotty’s powers to combat Grabberman and save the trees. Aug 24-30 18.40 (19.40) £4.00 (£3.00)

OPTIMISM

©O©©

Venue 126 - C cubed, St John’s Hall, West End Princes Street Tickets 225 5105

19

POSTER EXHIBITION 199? See the winning entries and 200 commended runners-up from the Fringe’s annual schools poster competition. Chosen from 4,000 entries submitted by 5 -18 year olds across Scotland, the winning design now represents the Fringe around the world!

Edinburgh College of Art, Lauriston Place August 10 - 29,10am - 5pm Admission Free

Magif w e arP L

★ FERDI THE FERRET Ferrets get a bad press - they do more than just getting stuck down trousers. So join Ferdi and his family, together with stoats, weasels, polecats and other assorted rodent chums, and get ready for some ferreticious fun! Aug 6-30 (not 17) 12.30 (13.20) £5.00 (£4.00) (£3.00 C)

PLEASANCE FESTIVAL OF THEATRE ’97

A Very Funny Spooky Play Perfect for Family Audiences “Magic Carpet — A Highlight of the Festival” BBC TV SCOTLAND

OO©©

Venue 33 - Pleasance,60The Pleasance. Tickets 556 6550

LI4

★ ■ FUN SONG FACTORY‘ON STAGE’ (ONE) From the award-winning video series for 2 to 7 year olds - Starring lain Lauchlan (BBC Playdays) - The Fun Song Factory creates all your favourite action songs. Come and join in. Aug 18-30 (not 26) 10.15 (11.30) £6.50 (£5.50) Aug 18-30 (not 26) 12.00 (13.15) I DARE YOU - RAILTRACK (ONE) Powerful educational drama about how peer pressure and bullying can lead to danger on the railway line. For children aged 10-12. Commissioned and funded by Railtrack. Written & directed by John Cotgrave. Produced by Anderson Design Associates, Leeds. Aug 18-30 (not 26) 13.45 (14.45) £4.00 (Children Free) ★ ■ THE HAPPY GANG SING-A-LONG (OTR) An interactive musical extravaganza where the audience decides what happens next. Join The Happy Gang’s unpredictable adventure featuring dozens of children’s songs, old and new. Described as ‘U2 for children’,The Happy Gang are simply brilliant! Aug 11 -16 10.30 (11.25) £4.00 (£2.75)

PURVES INTERNATIONAL PUPPETS Venue 180 - South Leith Parish Church Halls, Henderson Street

OO©© CIS

■ PIPS AND PANDA’S MAGIC EGG Especially for young children up to 7, it is a NEW join in-show with favourite songs, fun and adventure. Bring your Panda to meet the puppets afterwards! Aug 12-30 (not Suns) 10.30(12.00) £4.00 (£3.00) ■ THETINDERBOX Hans Christian Andersen’s classic tale in a musical production with our HUGE puppets that glow in the dark. For family audiences of all ages - adults too! Aug 12-30 (not Suns) 13.30 (15.00) £4.00 (£3.00)

SAT 9th — SAT 30th AUGUST 12.10pm Tickets: £5.00 (£4.00)

82

SOUTHSIDE

0I3I

668 22I2

Nicoison Street, Edinburgh 8

CIRCUS

WORKSHOP Try Juggling, Unicycling, Plate Spinning... Every Day at 10.10am - £3.50 Super Saver Show & Workshop Ticket £7


RICHARD MEDRINGTON’S PUPPETS

®0©©

Venue 30 -The NetherbowTheatre, 43 High Street Tickets S56 9579

JI3

■ A.A. MILNE’S WINNIE THE POOH For those who missed it last year and are now six (or even five), plus parents who remember When They Were Very Young.‘Magnificently melancholy tale of Eeyore’s birthday’, Scotsman; ‘enormous fun...spellbinding’, The Stage. Aug 7-30 (not Suns) 12.45 (13.35) £3.00 (£2.50)

I il

SYLVIA TROON’S KENSPECKLE PUPPETS

©O©©

Venue 30 -The Netherbow Theatre, 43 High Street. Tickets 556 9579

JI3

■ RAINBOW MAGIC Grindle, the grey elf, wants to be as colourful as the Rainbow Elves. Come and help him find the sun jewel stolen by the Storm Brothers! Colourful puppets, music, song and audience participation ideal for three years upwards. Aug 7-30 (not Suns) 10.00 (10.50) £3.00 (£2.50)

VENUE 13

©O©©

Venue 13 - Harry Younger Hall, Lochend Close, Canongate

J15

■ TOM AND THE MAGICAL FLOWER After 4 pick of the fringe’ accolades, Ripley Theatre now presents its acclaimed family musical, commissioned in 1995 by the Welsh National Opera. Celtic Cats, Forgetful Elephants and fifteen show-stopping songs. Aug 8-23 10.00(11.20) £5.00 (£2.50) ■ THEATRE TRAIN For the third year running,Theatre Train will arrive from the Scottish Highlands bringing a highly entertaining & informative show for children aged between 7 and 11 years. Aug 25-30 10.30 (11.30) £1.00

CREDIT CARD SALES RING 0131-226 5138 (10 lines) Open 10am-6pm (June H: July) 9am-9pm (during August)

a Scottish National Portrait Gallery exhibition at the Royal

Scottish

Academy,

Princes Street, Edinburgh. 1 August - 5 October 1997. Admission £4, concessions £2.50. Monday - Saturday 10am - 5pm. Sunday 2 - 5pm.

Schhh! Theatre Company

Opening

hours extended

during the Edinburgh Festival.

12.00 noon at Venue 45 Old St. Paul's Church Hall, Jeffrey Street 18 th-23rd August 1997*° Tickets Adult: £4.00 Con: £2.00

NATIONAL GALLERIES OF SCOTLAND SPONSORED BY ELF EXPLORATION UK PLC IN ASSOCIATION WITH ELF AQUITAINE


1

'Devilishly Funny

COMCDy & R£VU£ ADAM CROW AND MITCH BENN

THE SCOTSMAN

®O0©

Venue 47 - The Cafe Royal, 17 West Register Street Tickets SS6 2549

112

A-Z OF COMEDY? Described as The best show at the festival’ (by A Scotsman), starring Adam Crow ‘Cracking act’ Dr Fox Capital FM and Mitch Benn ‘hilarious., musical..numatic visigoth’. A show with stand-up comedy, magic, songs and shoes. Aug 8-30 21.15 (22.15) £5.00 (£4.00)

AHA! SISTER CITY SISTERS FROM DUNEDIN, NEW ZEALAND OOO© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226

K10

THOSE JAMMY COWS are a quirky off-beat women’s comedy duo bouncing back home by their umbilical bungy-cord to show-off their set of skits. See favourites like Escapology, Flabba, Cracker of a cow, unfairystory and more. Aug 24-30 (not 28) 22.40 (23.25) £5.00 (£4.00)

AMERICAN HIGH SCHOOL THEATRE FESTIVAL

oo©o

Venue 137 - Church Hill Theatre, Morningside Road

06

DON’T DRINK THE WATER This Woody Allen classic is packed with snappy gags and one-liners as Allen pokes fun at a family of American tourists, accused of espionage by the communist police, who take refuge in the US Embassy in an obscure country. Aug 12,14,16 14.15 (15.45) £3.00 (£2.00) Aug 17 16.15(17.45) MARVIN’S ROOM Hilarious, exhilarating and wondrous, a commitment to loving others first.‘...funniest..wisest..most moving. When the American theatre gains a new voice this original, this unexpected, you really must hear it for yourself.’ Frank Rich, NY Times Aug 12,14,16 12.15 (13.45) £3.00 (£2.00) Aug 17 18.15(19.45)

AMNESTY INTERNATIONAL

OOOO

Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428

C>aracters Sketch

3.50pm AUG 8-30

PLEASANCE 0131 556 6550

(not tuesdays)

III

‘JUST A TICKLE’ FROM AMNESTY INTERNATIONAL For one night only, a feast of top comedy talent compered by Mark Little and featuring Dylan Moran, Sean Lock and John Hegley (plus special guests). Book early - it’s sure to sell out. Aug 10 midnight (02.30) £ 12.00 (£ 10.00) Doors open 23.45

ASSEMBLY ROOMS

!%Um^ yenue 3 . Assembly Rooms, 54 George Street. Tickets 226 2428

®O0© III

BRIGHTON THEATRE EVENTS:THE BLUES BROTHER The life addicted, dangerously tempramental, seriously comic, on-the-edge, high octane, blues singing one and only... John Belushi.The Best Rock‘n’ Roll story of them all.‘Steve Steen’s superb one-man virtuoso performance’ Daily Mo//.‘Wickedly funny’ The Guardian. Aug 9-12,14,17-19,21 17.40 (19.00) £7.50 (£6.50) Aug 15,16,22,23 17.40(19.00) £8.50 (£7.50)

An Hour of Punchy Hard ling Comedy Featuring:

■ TALKIN’VAGABOND JAZZ Franklyn Ajaye delights audiences worldwide with his humorous insights and flights of fancy on his life and the absurdities of the world. ‘Richard Pryor’s insights, Bill Cosby’s cool’ San Francisco Chronicle ‘Quite simply a pleasure to watch’ The Melbourne Age Aug 8-10,12-14,17,19-21,25,27-30 21.50 (22.50) £8.00 (£7.00) Aug 15,16,22-24 21.50 (22.50) £9.00 (£8.00)

Qoutow

MARK LITTLE: PSYCHOBUBBLE Join Mark in his ‘hysterical’ paranoid wonderings and wanderings. Feel the fear, trapped for an hour, inside a capsized mind.‘Effortless charisma... inspired master of improvisation’ The Scotsman ‘Relentlessly funny... an exhilarating evening’s entertainment’ The Herald Sun Aug 8-14,17-21 20.25 (21.35) £8.50 (£7.50) Aug 15,16,22,23 20.25 (21.35) £9.50 (£8.50) ■ THE RIGHT SIZE: DO YOU COME HERE OFTEN? Comedy about two men stuck in a bathroom, from the creators of‘Stop Calling Me Vernon’. ‘Theatre or comedy? Who cares when they’re this funny’ The Guardian. ‘Indescribable and very, very funny’ Independent Aug 9-14,17,19-21,25,27-30 18.00 (19.15) £8.00 (£7.00) Aug 15,16,22-24 18.00 (19.15) £9.00 (£8.00) ★ HATTIE HAYRIDGE: RANDOM ABSTRACT MEMORY From her birth as a suspected appendicitis, comedian Hattie Hayridge has been bombarded by a meteorite shower of the surreal. In a show taken from her autobiography, Hattie ponders her own particular oddball universe. Aug 17-21,25-30 13.15 (14.30) £7.50 (£6.50) Aug 22-24 13.15 (14.30) £8.50 (£7.50) VICE AND VERSE:THE POETRY OF MURRAY LACHLAN YOUNG A range of strange, cautionary stories laced with wickedly carcinogenic humour. Delivered with melodramatic malevolence and Withnailesque style. Praised for his ‘profound and seductive’ presentation of ‘complex and darkly satirical tales for adults’ The Scotsman Aug 8,9,11 -14,18-21,25-30 20.25 (21.25) £7.50 (£6.50) Aug 15,16,22-24 20.25 (21.25) £8.50 (£7.50) 10

Manchester Evening News He Will Make You Love Him

)oiitkJe i/ftMMimii VENUES

7pm Every Night - August 6th to 23rd Tickets - £5.00 Supported by:-

For more nformation

'

(£4.00 concession) - Tel: 0131 5551039 - (Gordon Brunton) 9B Springfield Street Edinburgh EH6 5EF 0131 5551039


MAX MAVEN:THINKING IN PERSON He knows you want to see him. A one man show from one of the best known Stateside paranormal experts. ‘A comical cross between Vincent Price and Orson Welles’ The Stoge.‘Incredible and unbelievable’ New York Post. Aug 8-14,17-21,25-30 23.35 (00.35) £7.50 (£6.50) Aug 15,16,22-24 23.35 (00.35) £8.50 (£7.50) JERRY SADOWITZ isn’t your average white-gloved top-hatted magician.This mad Scotsman is brash and up-front, and has a list of expletives as long as your arm, but he’s also extremely funny. ‘Compelling, hilarious, unpredictable and unmissable’ Evening Standard. Aug 8-11,13,14,17,18,20,21,25,27-30 12.00 (12.55) £8.00 (£7.00) Aug 8-11,13,14,17,18,20,21,25,27-30 20.55 (21.55) £8.00 (£7.00) Aug 15,16,22-24 12.00 (12.55) £9.00 (£8.00) Aug 15,16,22-24 20.55 (21.55) £9.00 (£8.00) NORTHERN BROADSIDES: ANTHONY AND CLEOPATRA Shakespeare’s love tragedy of maturity shows a couple magnetic in life magnetic into death. ‘Northern Broadsides bring Shakespeare to life as gripping, accessible theatre...’ Guardian.‘A majestic production... A right rare, and real, treat.’ Observer. Aug 16-30 13.30 (15.45) £8.50 (£7.50) JO BRAND BENEFIT A special gala comedy show for the children’s hospital in Brasov, Romania. Featuring the best of this year’s Festival Comedians. Aug 26 22.00 (23.05) £10.00

BABLAKE AT DIVERSE ATTRACTIONS

OOQO

Venue 11 - Diverse Attractions, Riddles Court, off Lawnmarket Tickets 225 8961

J11

ABIGAIL’S PARTY Social ineptitude and suburban strains provoke laughter and concern as Beverley entertains the neighbours with disastrous results.This, however is not just another production of Mike Leigh’s brilliant savage play, but one of the funniest you are likely to see. Aug 18-23 13.30 (15.00) £3.50 THE CANTERBURY TALES Chaucer’s tales, dramatised in modern English by Phil Woods, retain the comic energy and bawdy humour of the original stories. Seduction, Millers’ daughters, sly students, loud farting, vain chickens and what women most desire all contribute to good, healthy, rude fun! Aug 18-23 12.00(13.00) £3.50

London Weekend Television’s Comedy Department is presenting the first ever prize for comedy writing at the Edinburgh Fringe.

DAVID BADDIEL

00©0

Venue 26 -The Palladium, Broughton Place Tickets 557 2100 (557 6969 pre August)

GI4

DAVID BADDIEL The star of THE MARY WHITEHOUSE EXPERIENCE and FANTASY FOOTBALL LEAGUE comes back from writing bestsellers and singing new national anthems to his stand-up roots in an all-new, ridiculously revealing show.‘Inventive and hilarious...blisterlingly funny’ Sunday Times. BOOK EARLY. Aug 15-23 21.00 (22.15) £ 10.00 (£8.00)

BILL BAILEY

OO©©

Venue 37 - George Square Theatre, George Square. Tickets 650 2001 (pre 6 Aug 651 1332 10am-5pm) MI2 BILL BAILEY 1996 Perrier nominee returns after a sell-out tour of the UK, Australia and New Zealand. ‘Musical gag-meister, bonsai Meatloaf, king of popular culture’ Australian Herald-Sun ‘Hysterically funny musical mayhem on a grand scale’ Wellington Post. Aug 18-29 21.45 (22.45) £9.00 (£8.00)

K7

BARBYS, BULLS AND HAGGIS:THE COMEDY FEAST ‘Lehmo .like an Aussie Tarantino on speed’ Sidney Morning Herald.‘Luis Alberto...bitingly satiricaL.Latin humour to die for.’ London Review‘Brian Higgins..the verve and energy of a young Connolly.’ The Scotsman Aug 8-26 21.15 (22.30) £5.00 (£4.00)

ARJ BARKER

®0©@

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4

ARJ BARKER’S LETTERTO AMERICA Dating. travel. stupid t-shirts.Top US comedy from rising star.Arj Barker (ITV’s Live from Jongleurs and CS’sThe Comedy Store).‘A sharp & highly inventive comedian’ Evening Standard Preview Aug 8 20.30 (21.30) £5.00) Aug 9-11,13,14,17-21,27-30 20.30 (21.30) £6.50 (£5.50) Aug 15,16,22-24 20.30 (21.30) £7.50 (£6.50)

BBC RADIO 4

OO©©

Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

LI4

LOOSE ENDS I Voted second best Saturday morning radio show by KwikSave shoppers. Hell, it’s free - and it can’t be any worse than last year. Aug 16 09.45 (11.00) Free Tickets available day before show COMEDY MASTERCLASS An introduction to writing radio comedy from top BBC writers, producers and performers. Aug 16,17 10.00 (12.00) Free Tickets available day before show SHORT STORY Enjoy coffee and especially commissioned short stories by some of the country’s leading writers. Aug 18-22 11.00(11.30) Free Tickets available day before show BBC RADIO 4 continues

page

by a panel of judges headed by Humphrey Barclay, LWT’s Controller of Comedy. The winner will be announced at

BARBYS, BULLS AND HAGGIS:THE COMEDY FEAST ®o©© Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116

An award of £1000 and a commission to develop a script for television will be given

THE LWT COMEDY WRITING FORUM on Monday August 25th at 10.30am at Pleasance Over the Road Join a top team of producers, writers and editors in a lively discussion about future opportunities for comedy writing on TV. FREE TICKETS

from The Pleasance Box Office Tel:0l3l 556 6550


COMZDy & RCVUC

STANZA Nigel Planer, well known comedy actor and lesser known poet, in performance with Martin Newell. Introduced by Simon Armitage. Aug 26 21.00 (22.00) Free Tickets available day before show Venue 199 - Edinburgh Festival Theatre, 13-29 Nicolson Street Tickets 529 6000

BBC RADIO 4 continued JUST A MINUTE Paul Merton is amongst those players taking on the stopwatch with Nicholas Parsons in the chair. Aug 19 12.00 (13.00) Free Tickets available day before show KALEIDOSCOPE Paul Allen with a frenetic 40 minutes of news, reviews and performances from the Festival and Fringe. Aug 21 15.45 (16.45) Free Tickets available day before show THE NEWS QUIZ The team, including Jeremy Hardy and Alan Coren, return with more sharp observation, blunt humour and side-splitting satire. Aug 21 21.30 (22.30) Free Tickets available day before show

LI2

KALEIDOSCOPE Paul Allen’s 1997 Edinburgh Festival round-up. Aug 14 15.45 (16.45) Free Tickets available day before show

BBC RADIO SCOTLAND

OO©©

Venue 57 - BBC Scotland, Studio One, 5 Queen Street.

H11

■ THE USUAL SUSPECTS LIVE The best of the Festival in one venue; comedy, theatre, music, plus first night reviews.The Usual Suspects IS the Fringe’ Miles Kington. Aug 11-29 (not Sat,Suns) 22.10 (23.30) Free ■ RADIO 5 LIVE ATTHE FRINGE and immediately following The Usual Suspects, Janice Forsyth with more of the best of all the festivals, broadcasting to the whole of Britain. 25 extra minutes for no extra charge. Aug 11-15,18-22 23.00 (23.30) Free

FIRST IMPRESSIONS Talkback presents Alistair McGowan and Steve Nallon who lead the panelists as they put their repertoire of voices to the test under the watchful eye of chairman Pete McCarthy. Aug 22 11.00 (12.00) Free Tickets available day before show

Venue 26 - The Palladium, Broughton Place Tickets 557 2100 (557 6969 pre August)

LOOSE ENDS II Come to the witty, intelligent, much talked about radio show. Alternatively there’s Loose Ends II. Aug 23 09.45 (11.00) Free Tickets available day before show

■ BBC TELEVISION will be filming all that’s good and great, they have chosen the best venue in the Fringe, all that’s missing is the best audience. For details and FREE tickets call 0131 557 2100. Aug 11,13,21,26-28 22.00(00.30) Free

WITH GREAT PLEASURE In a special double bill, Stephen Berkoff and Muriel Gray reveal the writing that has had the greatest impact on their lives. Aug 26 13.00 (14.00) Free Tickets available day before show JOHN SHUTTLEWORTH’S OPEN HOUSE Transport yourself to Sheffield with John Shuttleworth, his friends, family and neighbours - plus a few unexpected celebrity guests. Aug 26 18.00 (19.00) Free Tickets available day before show

BBC TELEVISION

OO©©

BEA LOVE AT MIDNIGHT

®Q©©

Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215

NEED MORE INFORMATION ? RING THE FRINGE ON

0131-226 5257 or 5259

Noel FUG' Frankie BOYLE • Neil BROMLEY Cliris ADDISON "OUTSTANDING COMEDY" rhe Daily Tolegroph

12

K9

★ BEA LOVE AT MIDNIGHT A lavish, glaring and glittering musical cabaret, starring the waspish and glass shattering Bea Love, trilling her clipped, bitter sweet lyrics. With ebullient, swerving pianist, Arthur Somerset. Flee with full hands and heart.... Late License. Aug 8,9,11,13,15,17,18,20,22,24,25,27,29 midnight (01.00) £4.50 (£3.50)

BBC NEW COMEDY AWARDS Ardal O’Hanlon comperes the final, televised by BBC I. Last year’s winner now has her own TV show - can this year’s do better ? Aug 26 19.30 (21.00) Free Tickets available day before show

1

G14

"GUT-BUSTING HUMOUR" [femg Slomkrd

30th Ot 10.50pm (Except 12th & 26th) PLEASANCE Box Office: 0131 556 6550

"THUMPINGLY TUNNY" Tk Bmdian

"FEARSOMELY TALENTED"

Jk Times for (wlker Wwnwtioe dl the Comedy Zone bottle M M91 887766 (0* lost 50p per minute ot d tines)


Mam Bloom "A rising star, it's time to sit up and take notice" WilinmM-Tbetiardian

COMZDy & RCVUC

LENNY BEIGE

(DO@©

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4

■ LENNY BEIGE - ONE MAN AND HIS TALENT After yet another complete sell-out season at The Regency Rooms, the legend that is Beige is presenting his first ever full Edinburgh show. ‘A walking show case of multitalent’ Time Out Previews Aug 6,7 16.00 (17.00) £4.00 Aug 8-11,13,14,17-20,25-30 16.00 (17.00) £6.00 (£5.00) Aug 15,16,22-24 16.00 (17.00) £7.00 (£6.00)

BEST OF THE FEST

00©0

Venue 26 -The Palladium, Broughton Place Tickets 557 2100 (557 6969 pre August)

GI4

■ BEST OF THE FEST THE MAIN EVENT - a big variety bill featuring the HOTTEST COMICS on the Fringe. At least SIX TOP ACTS FOR THE PRICE OF ONE. Well known names, fresh new faces and some great surprises. Book early. Aug 14-23 (not 21) 22.45 (midnight) £9.50 (£8.50)

BIG TOP EXTRAVAGANZA!

OQ©@

Venue 189 -The Meadows Big Top,The Meadows, Melville Drive Tickets 667 7367

NI2

BIG TOP EXTRAVAGANZA! NO OTHER SHOW COMPETES! Six top comics for the price of one! Different bill each night picked from the best acts on the Fringe. Six days only. BOOK EARLY - ANNUAL SELL-OUT. Aug 15-17,22-24 21.15 (22.45) £9.50 (£8.50)

ADAM BLOOM

0O0©

Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

LI4

ADAM BLOOM is a ‘highly intelligent, dazzling original thinker’ (The Stage) who is ‘constantly hilarious, always thought provoking’ (The List) with ‘no puns, no ersatz nostalgia, just pure Adam Bloom-ness’ (The Independent). SELL OUT 96. DON’T MISS HIM! Preview Aug 6 18.45 (19.45) £5.00 Aug 7-14,17-21,25,27-30 18.45 (19.45) £7.00 (£6.00) Aug 15,16,22-24 18.45 (19.45) £8.00 (£7.00)

MARCUS BRIGSTOCKE

®0@©

Venue 139 - The Honeycomb, 36 Blair Street Tickets 226 2151

K12

MARCUS BRIGSTOCKE Winner of the BBC New Comedian of the Year and Ha-Bloody-Ha Comedy Awards, Marcus is being hailed as the comic to watch. His debut solo show delivers a hilarious mixture of character comedy and upfront observational satire. Aug 8-30 (not 12,28) 19.00 (20.00) £6.50 (£5.50)

PETER BUCKLEY HILL

OO©©

Venue 85 - Footlights and Firkin, 7 Spittal Street Tickets 229 8368

K9

PETER BUCKLEY HILL AND SOME COMEDIANS - FREE AGAIN Take a comedian.Add another comedian.And a third comedian.What have you got? Three comedians.Then do the same every night, except with different comedians.That’s it, basically. Oh, and Peter. Aug 10-30 21.25 (22.25) Free Venue 16 - Southside Courtyard, Davie St. Tickets 6672212

LI3

BOTTOM OF THE BILL IN A ONE-MAN SHOW (FREE) ‘60s relic PBH, amiably lunatic guitarist, wielder of bad puns’ The Scotsman: songs of urban love, small furry animals, sex education and flying haddock. If you like that sort of thing.... Aug 17-30 19.15 (20.10) Free

ED BYRNE Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

©O©© K12

ED BYRNE: PSYCHOBABBLE Dysfunctional comedian takes funny look at what makes us tick. Bring sense of humour, comic asides provided.‘Wondrously witty, high calibre, observational comedy. Hilarious’ Scotland on Sunday. ‘Hotly tipped as the one to watch this year’ Evening News. Aug 8-30 (not 11,18,28) 21.00 (22.00) £7.50 (£6.50)

CAMBRIDGE FOOTLIGHTS Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

®G©© LI4

EMOTIONAL BAGGAGE The Best revue show in town’ Independent. Join Britain’s brightest young comedians as they take you by the hand and lead you astray. With all your emotional baggage in one trunk. Quite a claim. Quite a show. Quite a night. Preview Aug 6 18.00(19.00) £5.00 Aug 7-11,13,14,17-21,26-30 18.00 (19.00) £7.00 (£5.00) Aug 15,16,22-24 18.00 (19.00) £8.00 (£6.00)

13


GILDED BALLOON PRODUCTIONS PRESENT

FRED MACAULAY "He doesn't so much tickle your ribs as launch a Cantona-like attack on them. Be warned ■ you will ache" SCOTLAND ON SUNDAY

QUEENS HALL 8PM FRIDAY 22 AUGUST

QUEEN'S HALL BOX OFFICE 0)31 668 2019 GILDED BALLOON PRODUCTIONS PRESENT

FEATURING PREVIOUS YEARS' ENTRANTS

8,9, 13-16, 21-30 AUGUST

10:15PM BACKSTAGE THEATRE

I

NATIONAL TOUR 1997

GILDED BALLOON AT LA BELLE ANGELE 7:30PM 8-23 AUGUST

(NOT

10/17/24

AUGI

STEUE FROST S PUB QUIZ GILDED BALLOON AT LA BELLE ANGELE 7:30PM SUNDAY 10/17/24 AUGUST GILDED BALLOON PRODUCTIONS PRESENT A NE wSi Y wmmmw FbRCMlERNAN; f & GRSM HEMPHIL L UiHECimBY ■: 1. „ ALANWE PELLETTE

i-ftw ^ ■

#2,

# ^

^ f ' mrwmmm

GILDED BALLOON II DOWNSTAIRS 6:45PM 8-30 AUGUST ^

GILDED BALLOON BOX OFFICE:

0131 226 2151 14

LIVE AT THE PALLADIUM OUT ON VIDEO NOW

|


CCMCDy & RCVUC

SCOTT CAPURRO

®0©©

Venue 33 - Pleasance, 60 The Pleasance. Tickets 5566550

LI4

SCOTT CAPURRO Yes, he’s recovered from his career-threatening illness (thanks for the cards and letters), but he still does not put up with any bullshit, so just sit there and speak only when spoken to.‘Julian Clary with barbs’. The Independent. Preview Aug 7 22.30 (23.30) £5.00 Aug 8-10,12-14,17,19-21,25-27,29,30 22.30 (23.30) £8.00 (£7.00) Aug 15,16,22-24 22.30 (23.30) £8.50 (£7.50)

CHARLIE CHEESE

©O©©

Venue 47 - The Cafe Royal, 17 West Register Street Tickets 556 2549

112

I BEG YOUR PARDON? ‘Friend to the stars, Charlie Cheese is the king of catchphrase’ The Independent. He leaves no tacky stone unturned in his parody of Mr Light Entertainer.‘Excellent’ Sunday Times ‘A star is born’ The Stage. Aug 8-30 (not 28) 22.45 (23.45) £5.00

THE CHEESE SHOP

®0@©

Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

'truly a star is born' The Stage Excellent" Sunday Times,

Venue 47 Cafe Royal Bistro Bar 17 West Register Street, Edinburgh BUZ Venue Box Office 0151 556 7549 Fringe Box Office ZZ6 5158 8th-50th August 1045 pm (except ZS Aug) Tickets £5.00

LI4

THE CHEESE SHOP PRESENTS...BOOF! boof i .(excl.) - of surprise 2.n Legendary comedy show by The Cheese Shop, stars of The Paramount Comedy Channel and Radio 4. Sell outs ‘95 and ‘96.‘Hugely talented’ Time Out;' Catch them if you can’ Sunday Times. Aug 8,9 17.10(18.10) £5.00 Aug 10,11,13,14,17-2 i ,25,27-30 17.10 (18.10) £7.50 (£6.50) Aug 15,16,22-24 17.10(18.10) £8.00 (£7.00)

CHARLIE CHUCK

®O0©

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4

CHARLIE CHUCK (Uncle Peter from Reeves and Mortimer) gives you a further insight in to the world of Chuck.‘Charlie takes absurdism to new heights’ ES Magazine ‘An indescribable treat’ Scotland on Sunday ‘Addictive... painfully funny’ Sunday Times. Aug 8-14,17-21,25-30 18.50 (19.50) £7.00 (£6.00) Aug 15,16,22-24 18.50(19.50) £8.00 (£7.00)

CLUB SEALS

©O©©

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4

CLUB SEALS Sit in teepee. Watch white men come and go.Trade trinkets and firewater. Return to Fringe with a papoose packed full of new characters. ‘Frequently priceless’ The Scotsman. Credits: Radio 4, Channel 4. Features Marcus Brigstocke. Previews Aug 6,7 23.30 (00.40) £3.50 Aug 8-10,12-14,17-21,25-27,29,30 23.30 (00.40) £5.00 (£4.00) Aug 15,16,22-24 23.30 (00.40) £6.00 (£5.00)

JACKIE CLUNE Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428

®0©© III

■ CHICKS WITH FLICKS An evening of HAIRSPRAY and HARMONY. Get CURL POWER with Abba,The Nolans, Olivia Newton John, Kiki Dee, Kelly Marie and, of course, Jackie’s brilliant, uncanny impersonation of the great KAREN CARPENTER.‘Clune is INCANDESCENT’ Daily Mail. Aug 8-11,13,14,17-21,25,27-30 22.25 (23.25) £7.50 (£6.50) Aug 15,16,22-24 22.25 (23.25) £8.50 (£7.50)

CLUUB ZARATHUSTRA - ATTENTION SCUM ®0©© Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

LI4

CLUUB ZARATHUSTRA - ATTENTION SCUM The most original and inventive comedy you will ever see’ Sunday Times returns to irritate, delight and terrify Fringe-going sub-wormes. Featuring Simon Munnery (aka Alan Parker Urban-Warrior) and BBC 2 FIST OF FUN's Stewart Lee. ‘Utterly Exquisite...’ Scotland on Sunday. Previews Aug 6,7 22.05 (23.05) £4.00 Aug 8-11,13,14,17-19,21,25-30 22.05 (23.05) £8.00 (£7.00) Aug 15,16,22-24 22.05 (23.05) £8.50 (£7.50)

COMEDY CAFE ROADSHOW

OO©©

Venue 14 - The Comedy Cafe Roadshow, Charles Street, By Fringe Club Tickets 0410456669 III ■ TRIPTERRANUS Earth’s one and only mobile Comedy Theatre set in the back of a truck. Moving throughout its performance the audience will be taken by our friendly superheroes on an exhilarating journey in their ‘spaceship’ to Uranus. May the farce be with you! Aug 14-30 (not Suns) 14.00 (15.15), 16.00 (17.15), 18.00 (19 15) £7.00


coMcoy & THE COMEDY ZONE Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

RCVUC

®0©© LI4

THE COMEDY ZONE Edinburgh’s acclaimed late-night cabaret returns with ‘comedy’s finest new-additions’ Observer. Chris Addison (‘fearsomely talented’ The Times) comperes Frankie Boyle (‘gut-busting humour’ Evening Standard), Neil Bromley (‘thumpingly funny’ Guardian) and Noel Fielding (‘outstanding comedy’ Daily Telegraph). Sell-out 90-96. Previews 6,7 22.50 (00.30) £4.00 Aug 8-1 i, 13,14,17-21,25,27-30 22.50 (00.30) £8.00 (£7.00) Aug 15,16,22-24 22.50 (00.30) £8.50 (£7.50)

COMPANY THEATRE Venue 47 - The Cafe Royal, 17 West Register Street Tickets 556 2549

®0©@ Ii2

★ STONE ME - IT STHE LAD HIMSELF Played to perfection by Pip Utton’ The Express. There are flashes of brilliance’ The Scotsman.‘First class and fiercely poignant’ Sunday Times.‘A must for all Hancock fans’ Evening News. ‘Excellent’ The Stage. Aug 9-30 (not 28) 16.10 (17.00) £5.00 (£4.00) Double Bill price (with Hancock s Last Half Hour - see Theatre) £7.50

MELODY COOPER Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105

®0©© 110

★ ■ TORCH! Grab your hipflasks and shimmy into a swingin’ Harlem cabaret! Gershwin, Rodgers & Hart, Porter, and Waller’s finger-poppin’ hot jazz and steamy stories of lost love will pierce your soul and leave you with a song in your heart. Aug 6-30 (not 14,28) 21.20 (22.20) £5.50 (£4.50)

®ht Qailc CTdjrsraph OPEN MIC AWARD - GRAND FINAL Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

OOO© LI4

THE DAILY TELEGRAPH OPEN MIC AWARD - GRAND FINAL After 12 months of intense competition and 500 regional heats, Perrier nominee Boothby Graffoe hosts the climax of Britain’s biggest new comedy talent search. The finalists compete for the prestigious title and £2000 prize. Aug 25 18.00(19.40) £5.00

DALLAS AND PACKER

®Q©©

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4|

DALLAS AND PACKER GO LARGE! An hour of uninterrupted sketches, characters and comic oddities from writers/performers of the recently commissioned BBC sitcom ‘The Absurd Adventures of Dallas and Packer’ and stars of BBC Radio Scotland’s ‘Lifestyle Lounge’. Finely tuned mayhem... ‘Devilishly funny’ The Scotsman. Previews Aug 8,9 15.50 (16.50) £4.00 Aug 10,11,13,14,17,18,20,21,25,27-30 15.50 (16.50) £5.00 (£4.00) Aug 15,16,22-24 15.50 (16.50) £6.00 (£5.00)

DAVE JOHNS - ON THE EDGE

j

;

I

®0©©

Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

Kl 2 ||

DAVE JOHNS - ON THE EDGE My dead good show has got stuff about Van Gogh, yellow paint, other impressionists, raving, ladymen and other funny things. That is all I can remember...The End.‘Simply superb..a true comedian’ The Scotsman. Preview Aug 8 22.15 (23.15) £3.50 Aug 9-30 (not 13,28) 22.15 (23.15) £6.50 (£5.50)

DAVID MITCHELL & ROBERT WEBB Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

®o©© LI4

★ INNOCENT MILLIONS DEAD OR DYING Real comic talent’ Time Out.The unimaginable has happened. Don’t try to imagine what.You can’t - it’s unimaginable. Let’s just say it’s something to do with global annihilation. Nasty. Brings Christmas to the nuclear winter. Preview Aug 6 11.00(12.00) £4.00 Aug 7-11,13-21 11.00(12.00) £5.50 (£4.50) Aug 24-30 17.20(18.20) £5.50 (£4.50)

JACK DEE

OO©©

Venue 59 - Edinburgh Playhouse, 18-22 Greenside PI.Tickets 557 2590.

HI4

AN EVENING WITH JACK DEE Direct from his sell-out 6 week run in London’s West End, Jack Dee returns to Edinburgh with a brand new show. ‘A modern comic marvel....a timeless stand-up’ Guord/on.‘Britain’s comic genius of the 90’s’ Loaded. Aug 21,26 20.00 (22.30) £13.50 (£12.50)

CANT FIND THE SHOW YOU’RE LOOKING FOR ? See page one

:


DOUG HEALYAS CHIC MURRAY

COMCDy & RCVUC

Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 THE CHIC MURRAY STORY Ladies and Gentlemen! The tall droll Chic Murray. Float downstream back to the Sixties and Seventies when a Scottish legend made audiences laugh. Doug Healy stands up and pays tribute to this truly original and unique master funnyman. Aug 8,9,15,16,22,23,29,30 20.30 (21.30) £5.00 (£4.00)

THE EDINBURGH COMEDY REVUE

®0©©

Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

BOB DOWNE

00©0

Venue 72 - Queen’s Hall, Clerk Street. Tickets 668 2019

N13

■ BOB DOWNE - JAZZY! Join the crooning King of polyester style in a brand new show to celebrate ten years on the Fringe. A perennial Fringe favourite - it doesn’t get much better than this!! ‘Camp as cucumbers’ Evening Standard. Aug 19-21 19.30 (21.30) £ 10.00, £8.00 and £6.00

GRAHAM DUFF

©O©©

Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428

111

VINYL ANORAK A SINGLE MINDED COMEDY. 20 characters... I Obsession...Duff’s character sketch show is an hilarious fast-forward through the world of music fanatics, record collectors and liggers. A comic vox pop of our nation’s devotion to the chord, the beat and the bleep. Aug 9-1 1, 13,14,17-21,25,27-30 12.00 (13.00) £7.00 (£6.00) Aug 15,16,22-24 12.00 (13.00) £8.00 (£7.00)

JENNY ECLAIR

OOO©

Venue 26 - The Palladium, Broughton Place Tickets 557 2100 (557 6969 pre August)

GI4

JENNY ECLAIR The Queen of the Fringe returns FOR ONE NIGHT ONLY. Don’t miss this opportunity to see Perrier-Award winner and ‘Britain’s funniest and most outrageous comedienne’ The Mirror. BOOK EARLY.‘A triumphant hour...she was magnificent’ Sunday Times. Aug 24 21.00 (22.00) £ 10.00 (£8.00) Aug 24 23.00 (midnight) £ 10.00 (£8.00)

ED BYRNE & BRENDAN BURNS Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

©O©© KI2

★ THE ACT It’s just something that you do...24 hours a day. A fast-paced comic play from last year’s Edinburgh sensations.‘A more mercurial odd couple you’d be hard pushed to find...a true Fringe find’ Scotland on Sunday. Aug 8-30 (not 11,18,28) 16.00 (17.00) £6.50 (£5.50)

LI4

C.R. FUN An exciting new group, fresh from a sell-out domestic run, already touted as the stars of tomorrow, with a frenetic and outrageous show. Will Sergeant said ‘Quite simply the best comic talent in Britain... hilarious’. Forgettable. Previews Aug 7,8 15.00 (15.40) £4.00 Aug 9-11,13,14,17-20,25,27,28,30 15.00 (15.40) £6.00 (£4.00) Aug 15,16,22-24 15.00 (15.40) £7.00 (£5.00)

EDINBURGH UNIVERSITY THEATRE COMPANY

oo©o

Venue 49 - Bedlam Theatre, I lb Bristo Place Tickets 225 9893

LI I

■ IMPROVERTS Improvised comedy.You suggest it, we do it. In its fifth year at the Fringe, this show is high speed, energetic and sharper than a really sharp thing. Better than the usual dross. Cheap. Late. Funny. Rude. Aug I 1-23 (not 17) 00.15 (01.15) £3.50 (£2.50)

JO ENRIGHT

©O©©

Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

LI4

★ JO ENRIGHT: NOTTONIGHT JOSEPHINE ENRIGHT ...marvellous, genuinely funny..’ Daily Express. Star of ITV’s Funky Bunker and Club Class (C.5) returns with her fine stand-up and character comedy show ‘...Birmingham has a new star on its’ hands...’ What’s On. Aug 6-14,17-21,25,27-30 19.15 (20.15) £6.50 (£5.50) Aug 15,16,22-24 19.15 (20.15) £7.50 (£6.50)

ESKMOUTH THEATRE COMPANY Venue 191 -The BruntonTheatre, High Street, Musselburgh Tickets 665 2240

OOOO K22 Outer

OUT OF ORDER Remember‘Uproar in the House’ and‘Move Over Mrs Markham’? We’re back with Ray Cooney’s award winning comedy - when a government minister cavorting with the opposition discovers a body en suite, attempts to conceal the sleaze are hilarious. Aug 11-14 19.30 (22.00) £6.00 (£4.50) Aug 15,16 19.30 (22.00) £6.00 (no cones)

17


!

PACIFIC RIM PRESENTS

"cruelly Intelligent; deeply hilarious; unmissably good

G&J PRODUCTIONS PRESENT

Brand

SIX TOP STAND-UPS FOR THE PRICE OF

daring, startling and seriously funny" k

The Scotsman

^ "the most exciting sketch show on the Edinburgh fringe'

PLEASANCE

0131 556 6550

THE INTERNATIONAL SHOWBUSINESS LEGEND

LENNY HIS TALENT ‘adored by a well-heeled and beautiful clientele” London Evening Standard

“a walking show-case of multi-talent ...the future’s bright, the future’s Beige” TimeOut

Venue 33

4pm

6-30 AUG

A DIFFERENT BILL EVERY NIGHT 15-24 AUGUST (EX. 21)

THE PALLADIUM

*** TICKETS £9.50 (£8.50) PALLADIUM BOX OFFICE 0131 557 2100 FRINGE BOX OFFICE

A PACIFIC RIM PRESENTATION

0131 226 5138

'


THE FAR CANALS Venue 98 - Marcos, 5S Grove Street. Tickets 228 9116

K7

A CANAL RUNS THROUGH IT Sharp satire in a slick and witty revue directed by BBC ONE FOOT IN THE GRAVE director, Diane Messias.‘It’s truly funny’ What’s On. Aug 8-30 (not 17) 16.45 (17.45) £5.00 (£4.00)

FIRKIN FRINGE

®0@©

Venue 85 - Footlights and Firkin, 7 Spittal Street Tickets 229 8368

K9

SLAP SLAP SLAP Songs of Lechery Avarice and Perversity from Slaphead Jonny Blarney, star of Channel 4 and the British Isles. Saucy Slapper Tales of Table dancing from Belinda Merryman of Stringfellows fame, and Slapstick danger from ventriloquist Mark Felgate. Aug 8-14,17-21,24-28 20.00 (21.00) £3.00 Aug 15,16,22,23,29,30 20.00 (21.00) £3.50 Venue 86 - Physician and Firkin, 58 Dalkeith Road Tickets 662 4746.

PI4

■ HYPNOTIST HUGH LENNON & HIS HYPNO-DOG The fastest, most high-octane, gut-splitting 120 minute show I have ever seen.The range of suggestions for Hugh’s volunteers was staggering... a definite MUST SEE; if only to see ‘Hypno-Dog’ put people under!’ Aug 7-24 21.45 (midnight) £5.00 (£4.00)

JASON FREEMAN

®O0©

Venue 33 - Pleasance, 60 The Pleasance. Tickets 556 6550

L14

★ JASON FREEMAN After critical acclaim last festival portraying Sid Vicious in Richard Herring’s hit PUNK’S NOT DEAD, the slinky, kinky, rinky-dinky funky Kung-Fu monkey returns with his first solo stand-up show. Secret knowledge or just minking around? ‘Star in the making’ Guardian. Previews Aug 6,7 21.00(22.00) £4.00 Aug 8-11,13,14,17-21,25,27-30 21.00 (22.00) £8.00 (£7.00) Aug 15,16,22-24 21.00 (22.00) £8.50 (£7.50)

FRINGE CLUB

OO0©

Venue 2 - Fringe Clubjeviot Row, Bristo Sq. Tickets 226 5138

LI I

FRINGE CLUB CABARET Classy. Sassy. Raw. Raucous. Risque. Frisky. Brilliant! The Fringe Club - the ultimate cabaret experience. From the hottest new talent to those irresistible old favourites.This is the ultimate cabaret experience. Changing line-up every evening. Aug I 1-30 21.30 (23.30) Free with Fringe Club Membership Membership £5 daily and £25 for the season Passport photo required for season membership

STEPHEN FROST Venue 101 - La Belle Angele, 11 Hasties Close,off Guthrie Street

CGMZDy & R£VU£ STEPHEN FROST’S CELEBRITY PUB QUIZ We ask the questions, you give the answers. Cash prizes. Join Steve and a host of showbiz chums (Malcolm Hardee, Andy Smart, Arthur Smith) in a pub quiz to remember - but what was the year? Aug 10,17,24 19.30 (22.00) £5.00 (£4.00) Venue 38 -The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

KI2

★ HEY GRINGO Written and performed by Peter Searles.Wild tales from Peru, Bolivia and Chile. A heartfelt and hilarious performance of one man’s crazy South American Odyssey. Jungles and mountains, drugs and guns, prisons and tarantulas - a true story. Aug 8-30 13.15(14.15) £6.00 (£5.00)

RICH FULCHER

(DO©©

Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550

LI4

THE RICH FULCHER SHOW Professor Fulcher of the absurd improv show Modern Problems in Science reveals his current research, ‘The raging hand puppet within all of us’, as part of a surreal and comic lecture on the entertainment world.‘screamingly funny’ The Independent. Previews Aug 6-8 16.10(17.10) £5.00 Aug 9,10,1 1,13,14,17-21,25-30 16.10 (17.10) £7.00 (£6.00) Aug 15,16,22-24 16.10 (17.10) £8.00 (£7.00)

KEVIN GILDEA

©O0©

Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

LI4

★ KEVIN GILDEA Kevin ‘Brilliant comedian whose careworn style is an absolute winner’ City Limits, Manchester Gildea.'A rollercoaster of sick and surreal wit’ Deadpan. Superfluous.‘Highly original, quite naughty and explosively funny’ Sunday Times. Gildea is that rare creature - a tiger. Preview Aug 7 22.30 (23.30) £5.00 Aug 8-14,17-21,25-30 22.30 (23.30) £8.00 (£7.00) Aug 15,16,22-24 22.30 (23.30) £8.50 (£7.50)

HELP & INFORMATION RING THE FRINGE ON 0131-226 5257 c Open 10am-6pm (June Et July) and 10am-7pm (during August)

©O©© KI2

STEPHEN FROST’S IMPRO ALL STARS Top improvisation from the best improvisors around. Watch the comedy unfold before your very eyes. No tricks, no safety nets, just your suggestions. With Colin Mochrie, Steve Steen, Andy Smart and guests. You turn up, we make it up. Aug 8-23 (not Suns) 19.30 (20.45) £7.50 (£6.50)

GILDED BALLOON PRODUCTIONS PRESENT

TH€ SMASH HIT OF FCSTIVAl' RCTURNS

"funny, moving and literally unbelievable the most startling experience of the Fringe" Scotland on Sunday

capsis GILD6D BALLOON MAIN TH€ATR€ 11:30pm • 8-11, 13-17, 19-21, 23-26 AUGUST Gilded Balloon Bo* Office 0131 226 2151


GILDED BALLOON

©O©© :

Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

BOUND & GAggED

KI2

The ever dynamic fringe venue is steaming ahead with its challenging and ever expanding programme. The cream of comedy, cabaret and physical theatre. Laugh your (allies off at Late ‘n’ Live or hang out in our many cafes, bars and clubs.

presents

A TASTE OF D’UNBELIEVABLES Jon Kenny and Pat Short, Ireland’s top comedy duo take on Edinburgh for the first time. Don’t miss the late 20th century Vaudevillian performers with their brand new show,‘I doubt it says Pauline’. Critics Choice.Time Out. Aug 8-16 20.45 (21.45) £7.00 (£6.00) RICH HALL’S LOUISIANA HAYRIDE Winner of Edinburgh Critics Award two years running. Perrier flop. Wild, woolly comedy ride. Climb On! ‘Verbally astonishing. Rich Hall has reached his peak’ Toronto Globe & Mail. Aug 8-30 (not 12,24) 22.00 (23.15) £7.50 (£6.50) FRANS RUHL PRESENTS AMSTERDAM COMEDY EXPLOSION Watch your bicycles, the Dutch are in town. Holland’s best known stand-up comics, with news from Amsterdam, about sex, drugs and dykes. With comedians Martijn Oosterhuis.Arie Koomen, Silvester Zwaneveld and others. And... the jokes are in English. Aug 27-30 23.30 (00.30) £7.00 (£6.00) THE LATE, LATE, LATE BREAKFAST SHOW Afternoon adult fun as Six-pack take your mind off your problems and make you concentrate on theirs instead.The lighter side of paranoia, back biting and fear of death. An extremely funny show by some very funny people.‘Excellent’ The Guardian. Aug 8-30 15.30 (16.45) £7.00 (£6.00) ■ LATE ‘N’ LIVE The flagship of the Gilded Balloon provides the creme de la creme of comperes, bands and comedians. Opening at one and continuing into the wee small hours Late ‘N’ Live provides the perfect antidote to Festival indulgences. Aug 8-30 (not 22) 01.00 (04.00) £ 10.00 (£8.00)

bit of diddley squat ‘A NATURALLY FUNNY COMEDIAN’ THE GUARDIAN

GILDED BALLOON 0131 226 2151

8 - 30 august

at 9.15pm (except 13 & 28) prey. 8 augt

“King of the tricksters... funny as hell’

IN LOVE 2 WITH JANIE ANDERSON AND GREGG FLEET The In Love team are back with all new thrills, romance and danger. Like walking tightrope without a safety net - one day you’re going to fall.‘Devilish, menacing and totally mesmerising’ The Scotsman. Aug 8-30 17.00(18.15) £7.00 (£6.00) MISS ITCHY’S BASTARD BREAKFAST SHOW Ever wanted to know how to crumb a puppy? Well, first you have to skin it. Just one of the stunning recipes in Miss Itchy’s Bastard Breakfast Show.‘Banned’ in Australia. But only because of the offensive and cruel parts. Aug 8-30 18.30 (19.30) £6.50 (£5.50) MARION RASHLY PULLS IT OFF Marian is back! After the success of Stand Up Women, she brings her funny, personal and occasionally caustic one woman show. ‘Pashley could be Les Dawson’s Great Granddaughter’ The Herald. ‘Delightful’ The Guardian. Aug 8-30 17.15(18.15) £6.00 (£5.00) MATT KING IN LA LA LAND We’ve all been there, some of us may even live there, but this is the only guided tour going to La La Land.‘Hilarious’ The Advertiser,‘Hilarious’ The Herald & Sun,‘Hilarious’ The Daily Telegraph. Aug 8-30 18.30 (19.30) £7.00 (£6.00) SIMON LIPSON IN PIECES ‘Brilliant’ Guardian. Star of BBCI’s Stand Up Show, Simon Lipson is the top comedy impressionist. See De Niro and Hoffman decimate Jane Austen: Bowie and Woody reinvent the nursery rhyme: Prince and Sinatra implode. ‘ awesomely talented’ Sunday Telegraph. Aug 8-30 (not 18,26) 19.45 (20.45) £6.50 (£5.50) JILL PEACOCK & VIV GEE IN BURNS BABY BURNS Two of Scotland’s finest comedy wordsmiths join forces with their own mix of stand-up and bard. If you hate poetry you’ll love this, if you love poetry you’ll love it all the more. Bring your own beard. Aug 8-30 16.15(17.15) £6.00 (£5.00)

! i

NICOLE BUNTING - IN THETHIGHS OF THE BEHOLDER In this wildly funny multi-media revue/sextravaganza, the Erostitutes, three adventurous sexy sisters, romp through our generation’s sexual evolution in search of PURE PASSION. Audience participation, so check your repressions at the door! Aug 8-30 18.45 (19.45) £6.00 (£5.00) THE COMEDY STORM with Brendan Riley, Steve Keyworth and Natalie Haynes. ‘More oral sex in an hour than most people get in months’ Time Out. Of all the stand up shows in all the festivals you have to walk into this one. Aug 8-30 20.00(21.00) £6.50 (£5.50)

,

VLADIMIR MCTAVISH IN 101 GREAT MOMENTS IN SCOTTISH SPORT Defeat snatched from the jaws of victory! Fast and funny stand-up and character sketches - get intae them! Directed by Scott Johnston.‘Affable and abrasive, nothing short of superb’ The Scotsman. Aug 8-30 (not 12,28) 22.30 (23.30) £6.50 (£5.50) Venue 36 - Gilded Balloon II, People’s Palace, Old Fishmarket Close Tickets 226 2151 at 10pm (except 23 & 28 Aug) Prewew 8 August BECK’S FAMOUS

SPIEGELTEIffl « 0131 558 8010 ;* Fringe Box Office:

0131 226 5138

20

K12

★ KOOKIE PRESENTS ANTHEM FOR DOOMED YOUTH Satirical Revue, performed by people you’ve never heard of. Recommended viewing for pretentious, arrogant, arty, pseudo-intellectuals. Or if you hold nothing but contempt for the afore mentioned, come along and be cynical. Aug 16-30 11.45 (12.45) £6.00 (£5.00) THE OXFORD REVUE From the company that brought you Rowan Atkinson and Al Murray comes an all star cast of unknowns, who one day might just be on your television screen doing voice overs for frozen food adverts! ‘Comedy Messiah’ The Scotsman 1996. Aug 8-30 17.45 (19.00) £6.50 (£5.50)

I

’ |


COMZDy & RCVUC THETHREE CANADIANS IN BEN HUR -THE EPIC Hit of 1997 Melbourne Comedy Festival bringing high paced stupidity to a new level. They perform the epic saga of Ben Hur complete with Roman legions, lepers, crucifixion and a full scale chariot race. Aug 8-30 19.15 (20.30) £7.00 (£6.00) BEST OF SCOTTISH Broaching the great North/ South divide and providing more laughs than you can shake a thistle at. It is used nightly by the Scottish Comedy elite and is packed full of Caledonian comedy capers. Aug 8-30 20.45 (21.45) £7.00 (£6.00) KAMIKAZE FREAK SHOW After starring in last year’s sell out success ‘Circus of Horrors’, the Prince of Pain is back!! Marvel at his bizarre collection of human curiosities: Powertool - World’s Strongest Penis, Darwin the Pinhead, Master of Macabre - the Liberate of Accordion Freaks. Aug 8-30 (not 12,19,26) 23.30 (01.15) £7.00 (£6.00) THE GENTS Picture a man, going on a journey beyond sight and sound... He has entered... The Gents! Enter the twilight world of beer, women, football and stained urinals.Tidemark is back after their sell-out success at Edinburgh 1996 with a brand new comedy. Aug 8-24 (not 19) 15.45 (17.00) £6.00 (£5.00) ■ LEANDRE, MES LUNATIC is a party where everybody plays, face to face with the audience. Leandre is a fool, a strange being with an overflowing imagination. No venue can contain this fool’s genius, whatever you do, don’t miss him. Aug 25-30 17.15 (18.30) £6.00 (£5.00) HELLO, WE’RE THE NUALAS ‘Funniest women in the world’ Irish Times. All girl cult comedy singing trio. Household name in Ireland, debuted in Edinburgh last year with a sell-out show and rave reviews. ‘Queens of the Comedy Circuit’ Evening Herald. Aug 8-30 (not 12,26) 20.15 (21.15) £6.50 (£5.50) TINA C IN RHINESTONE COWGIRL Nashville’s spunkiest singer, is over here promoting her album ‘No Dick’s As Hard As My Life’. Rhinestone Cowgirl is a night of songs, laughs and the finest character comedy around.‘Set to attract a major following’ Independent on Sunday. Aug 8-30 midnight (01.30) £6.50 (£5.50)

master of irrelevant nonsense... bloody hilarious"

^ l

THE NIMMO TWINS IN POSH SPICE NUDE! Using only the finest dew-fresh English words, lovingly hand fashioned into sketches and monologues that guarantee all-day freshness, even under the rim.This collection of onyx and silver-plate comedy will delight and thrill for years to come. Aug 8-30 13.30 (14.30) £6.00 (£5.00) MOTHERS UNLEASHED PRESENT PERINEUM INTACTA Following a very successful run during Glasgow’s Mayfest 1997. Mother’s Unleashed have managed to get a babysitter and will be performing Part I of their original trilogy - an hilarious insight into their own experience of pregnancy. Aug 8-24, 28-30 17.00 (18.00) £6.00 (£5.00) PHIL NICHOL IS A SPY Paranoid? You should be... I am. From the boy who brought you Phil Nichol is Schizo, another collection of monologues from some of the world’s finest comedy writers. ‘Compelling.You’d be barmy to miss him’ The Herald. Aug 8-30 18.15(19.15) £6.00 (£5.00)

So funny it's painful the Observer PACIFIC RIM PRESENTS

★ LOGAN MURRAY IN UNCLE RON EXPLAINS IT ALL Star of yesteryear, Ronnie Rigsby, returns to tickle the Nation’s Funnybone. And to teach all these newer comedians a thing or two. Honestly, they’re all rubbish... Now, in my day... ‘Hugely talented’ Evening Standard. Aug 8-30 (not 19,28) 19.30 (20.30) £6.00 (£5.00) ★ FRANKIE BOYLE & RUBY SLIPPERS IN SCOTS PISHED Great value from two of Scotland’s best acts. Fresh from Children’s BBC Ruby Slippers delivers ‘Genuinely funny’(SOS) songs. Frankie Boyle won last year’s Daily Telegraph Open Mic Award. Aug 8-30 20.45 (22.00) £6.50 (£5.50) TAIKA & JEMAINE: HUMOURBEASTS Back home (NZ) their work has been labelled ‘surreal’,‘clever’,‘dadaist’,‘manic’, and ‘howlingly funny’. A rockin’ Rock-Operetta, a digital dance-off and the type of myth that legends are made of. Howl for a beastly little hour. Aug 8-30 23.30 (00.45) £6.00 (£5.00) Venue 101 - La Belle Angele, 11 Nasties Close, off Guthrie Street

GURGLING FOR MONEY #1* COMEDY

CHANNEL New British Comedy Every weeknight at 11pm

930PM 7“* Venue 33

vismilVIDEOITO

PLEASANCE1

0131|l556 6550 |

K12

SPORTS REVUE PRESENTS - DON’T CRY FOR ME GARETH SOUTHGATE Sexy football tips with Ruud Gullit,Alan Hansen and Mrs Lineker: Geoff Boycott’s cookery tips: Damon Hill revealed as Benny Hill’s lovechild. Sixty minutes of sporting comedy to leave you over the moon. Aug 8-30 (not 26) 15.45 (16.45) £6.50 (£5.50) MASSIVE DEJA-VU The Durham Revue are back with shiny new sketches, songs and stand-up from the satirical to the surreal in an altogether better class of revue ‘... with a heavy post-modern, deconstructive flavour...’ The Scotsman. ‘Pardon?’ The Durham Revue. Aug 8-30 (not 26) 17.00(18.00) £6.50 (£5.50) ■ THE CONDOS - HEY GET A LIFE! Low self esteem? Recently been abducted by aliens? Turning into a piece of cheese? These problems solved by superb singing and ‘striking satire’ The Guardian of the Condos’ new show. Evening Standard Hot Tickets Choice ‘97. Aug 8-30 18.15(19.15) £6.50 (£5.50) THE GILDED BALLOON continues

page


THE FINAL £2000 FIRST PRIZE

I“

Monday 25th August at 6.00pm PLEASANCE

Box Office: 0131 556 6550


GILDED BALLOON continued

ccMCoy &

SMILEY IN CONFESSIONS OF A CATHOLIC BUDDHIST Another Edinburgh and Smiley the techno prisoner is back this time with an all new show. Less standup more in the great Irish tradition of storytelling. Funny, poignant but above all intimately enchanting. Aug 8-30 (not Suns) 21.00 (22.15) £7.00 (£6.00) Venue 139 - The Honeycomb, 36 Blair Street Tickets 226 2151

K12

★ A RIGHT ROYAL VARIETY GALA EVENING Live from the royal heart of royal Edinburgh’s royal West End comes a glittering array of twisted comedy. Britain’s most twisted comedy group take you to Brucie’s worst nightmare. Aug 8-30 14.45 (15.45) £6.00 (£5.00)

®0©© LI4

STEVEN ALAN GREEN

©O©©

Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212

GREGG FLEET’S UNDERWATER WORLD Fleety dives deep, opens Davy Jones’ locker and finds all the clothes he wore when he was in the Monkees. Get moist. Aug 8-30 20.45 (21.45) £7.00 (£6.00) HUNG LE - NOWAND ZEN The fall of Saigon and the plight of its boat people may not sound like the stuff of a stand up. But for Hung Le a lot of funny things happened on the way to Australia. UK Premiere. Aug 8-30 22.30 (23.30) £6.50 (£5.50) Venue 37 - George Square Theatre, George Square. Tickets 650 2001 (pre 6 Aug 651 1332 10am-5pm) Ml2 ■ THE UMBILICAL BROTHERS ARE BACK WITH ‘DON’T EXPLAIN’ Australia’s Perrier nominated dynamo’s return with their legendary Edinburgh debut show. A subversive cartoon come to life.‘See the Umbilical’s and learn that an imaginatively propelled human body has no limits’ The Herald. Aug 8-17 21.45 (23.00) £8.50 (£7.50) NI3

FRED MACAULAY - FOR ONE NIGHT ONLY In his brilliant stand-up show, ‘one of the most accomplished raconteurs on the circuit’ The Scotsman will enchant his devoted followers and bewitch new converts as classic one liners spring from his experiences of life, being a Dad, a husband and a Scot. Aug 22 20.00 (21.15) £8.50 (£7.50)

GOOD IDEA COMPANY

BOOTHBY GRAFFOE Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550

★ BOOTHBY GRAFFOE In 1995 he was described as ‘The hottest ticket in Edinburgh’ Times. Now he’s back at the Fringe following sell-out success in Australia and Montreal.‘One of the funniest and most inventive comics you’ll find west of Peking’ Time Out. 10% discount for Nuns. Previews Aug 6,7 20.10(21.10) £4.00 Aug 8-11,13,14,17-21,25,27-30 20.10 (21.10) £8.00 (£7.00) Aug 15,16,22-24 20.10 (21.10) £8.50 (£7.50)

★ ADAM HILLS - STAND UP AND DELIVER Fresh, friendly and very funny, Adam Hills makes his Edinburgh debut - doing for Australian Comedy what David Helfgott did for trampolining. Hilariously cheap and personal. ‘Highlight of the night’ Sydney Morning Herald. Aug 8-30 (not 12,19,26) 17.15 (18.15) £6.00 (£5.00)

Venue 72 - Queen’s Hall, Clerk Street. Tickets 668 2019

RCVUC

OO©©

Venue 143 - out of the blue,The Bongo Club, 14 New Street (off Royal Mile) Tickets 558 7604 J14 ★ ■ ARE YOU TALKING TO ME? ATTE...N...TION! For the first time in history NATO opens its doors. Sgt. Munoz (Spain), Sgt. Pappila (Sweden) are here to serve you. Ar-Un-Ar-Un. In the army we don’t say hello, we say.....(Absurd Comedy Clown). Aug 17-30 17.45 (18.45) £5.00 (£3.00)

DAVE GORMAN - IN THE PLEASANCE WITH THE MICROPHONE ®0< Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 DAVE GORMAN - IN THE PLEASANCE WITH THE MICROPHONE Following his critically-acclaimed ‘96 sell-out run the double BAFTA Awardwinning writer, whose hits include THE MRS MERTON SHOW and STEVE COOGAN returns with a brand new stand-up show. ‘Spontaneous, original and brilliant’ The Times. Previews Aug 6,7 21.15 (22.15) £4.00 Aug 8-11,13,14,17-21,25,27-30 21.15 (22.15) £8.00 (£7.00) Aug 15,16,22-24 21.15 (22.15) £8.50 (£7.50)

CREDIT CARD SALES 0131-226 5138 (10 lines) Open 10am-6pm (June ft July), 9am-9pm (August)

LI3

★ DIE ON STAGE, LOUD AMERICAN BASTARD Yes, legendary Hollywood movie actor and unique stand-up has decided to end his career, his life and comedy as we know it, Jim. Forget Hale-Bopp.This is the place to be when it happens. Aug 4-14,18-21,25-30 22.50 (23.40) £5.00 (£4.50) Aug 15-17,22-24 22.50 (23.40) £5.50 (£5.00)

GRIN REAPER Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 2257226

00©0 KIO

■ BEYOND THE BRINK The authoritative exposition of the simultaneous attraction and revulsion that is the horror film paradox. Honest.‘consistently silly and cleverly put together’ Scotsmen,‘truly hilarious antics.Jt’s physically impossible to laugh any more.’ The Stage. Aug I 1-23 19.30 (20.25) £4.50 (£4.00)

RICHARD HERRING’S EXCAVATING RITA

©O©©

Venue 33 - Pleasance, 60 The Pleasance. Tickets 556 6550

L14

RICHARD HERRING’S EXCAVATING RITA Fix Yourself a Ticket Immediately’ The Times - for this new play about love, death, chemical toilets and archaeology from the star of BBC2’s FIST OF FUN and last year’s sell-out hit PUNK’S NOT DEAD.‘His best show yet!’ Independent On Sunday. Previews Aug 6,7 15.30 (16.50) £4.00 Aug 8-11,13,14,17-21,25,27-30 15.30 (16.50) £8.00 (£7.00) Aug 15,16,22-24 15.30 (16.50) £8.50 (£7.50)

RAINER HERSCH

©O©©

Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428

Ii I

■ ALL CLASSICAL MUSIC EXPLAINED:THE MASTERCLASS Brilliant stand up comedian and musical tearaway Rainer Hersch returns with another virtuoso performance:The Great composers - why are they all dead? Is that bloke from Shine completely bonkers? Brand new show.‘The world’s first classical music hooligan’ Sun. Preview Aug 8 16.00 (17.00) £5.00 Aug 9-14,17,19-21,25,27-30 16.00 (17.00) £7.50 (£6.50) Aug 15,16,22-24 16.00 (17.00) £8.50 (£7.50)

HIGHLY RECOMMENDED

OO©©

Venue 90 - Graffiti,Corner Broughton and East London Streets Tickets 557 8330

GI3

MARVIN HANGLIDER -THE POWER OF NEGATIVE ADVERTISING The Fringe wouldn’t be the same without Marvin Hanglider’s solo effort. But it’s only for two shows, thank god. Not recommended. Don’t come. Negative advertising is never interesting. Avoid at all costs (has it’s moments though). Aug 23,24 14.30 (15.30) £6.00 (£5.00)

8TH-30TH AUGUST,

8.20PM

EVERY NIGHT

SOUTHSIDE, VENUE 82, BOX OFFICE TEL.6672212,£5 23


COMCDy & RCVUC

SEAN HUGHES

OO©©

Venue 37 - George Square Theatre, George Square. Tickets 650 2001 (pre 6 Aug 651 1332 10am -5pm) M12

IAN STONE - BIT OF DIDLEY SQUAT

©O©© KI2

INSTANT SUNSHINE

OG©0 114

INSTANT SUNSHINE - ANNIVERSARY This unique musical comedy team, with their hilarious blend of gentle satire and consummate musicianship take a fresh look at our fashions and foibles in a mix of witty patter, visual humour and brilliantly funny songs. Aug 10-14 17-21 17.20 (18.30) £6.50 (£5.50) Aug 15,16,22,23 17.20 (18.30) £7.00 (£5.50)

MILTON JONES

©Q©©

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4

MILTON JONES: JOYRIDER PERRIER BEST NEWCOMER OF THE YEAR 1996. Milton’s got a scooter and he knows how to pedal it.‘A slow-burning gagmeister, audiences should be grateful!’ The Herald. Preview Aug 6 20.00 (21.00) £5.00 Aug 7-10,12-14,17-21,25,27-30 20.00 (21.00) £7.00 (£6.00) Aug 15,16,22-24 20.00 (21.00) £8.00 (£7.00)

IAN KENDALL

OO©©

Venue 55 - Randolph Studio, Inst Francais d'Ecosse, 13 Randolph Cres. Tix 225 5366

HI4

JO BRAND, MARK LAMARR, JEFF GREEN, RICHARD MORTON & ANDY ROBINSON return to Edinburgh to play a benefit for Glasgow Women’s Support Group and Edinburgh Rape Crisis.‘Jo Brand a carbuncle on the hard-earned face of feminism’ Mail on Sunday. Aug 23 23.30 (02.00) £13.50 (£12.50)

©O©©

Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 6672212

,

JAPAN EXPERIENCE

N13

Venue 59 - Edinburgh Playhouse, 18-22 Greenside PI.Tickets 557 2590.

IAN STONE - BIT OF DIDLEY SQUAT Anxious, judgemental, pathetic, argumentative, obsessive, anally retentive? So am I. Shit isn’t it? ‘A superior blend of irreverent comedy, Woody Allen filtered through a nineties sensibility’ The Scotsman. Preview Aug 8 21.15 (22.15) £3.50 Aug 9-30 (not 13,28) 21.15 (22.15) £7.00 (£6.00)

Venue 33 - Pleasance, 60 The Pleasance. Tickets 556 6550

OO©©

Venue 72 - Queen’s Hall, Clerk Street Tickets 668 2019

JIMEOIN Australia’s favourite Irishman - 5 nights only! Sellout 1996 COOKING SHOW and solo seasons.‘Series of hilarious, often surrealistic climaxes-.Don’t you miss it!’ Evening News;‘Inspired ramblings’ independent;This year’s hottest act’ Hollywood Reporter;‘Clean, charming, witty...above all funny’ Sunday Times. Aug 21-25 22.00 (23.50) £9.00 (£7.00)

IO BRAND. MARK LAMARRJEFF GREEN, RICHARD MORTON & ANDY ROBINSON OOQO

ALIBIS FOR LIFE BY SEAN HUGHES In this brand new show the 1990 Perrier Award Winner returns to the darker side of life. Join the maestro of merriment as he deviates from stand up to explore a narrative side. Aug 15-29 20.15 (21.30) £9.00 (£8.00)

Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

JIMEOIN

H8

■ KOYO YAMAMOTO IN ‘MADE IN JAPAN’ A mime genius with a multipersonality that stems from an insect to a human being. Guaranteed laughs. Unforgettable lesson in Japanese modern culture. Don’t miss it. Aug 17-30 21.00 (22.00) £5.00 (£4.00)

WANT TO BOY TICKETS IN PERSON? Details on page three

THE

MI2

THE MAGIC SHOW The tall half of Kendall Mitch Cake returns with this ambiguously titled mixture of magic and comedy ‘****„. highly entertaining... impressive magician’s skill’ The Scostman ‘Lanky’ The List. Guaranteed Checkov free zone, www.wing-it.demon.co.uk Aug 8-25,29,30 21.30 (22.30) £5.00 (£4.00)

1997 EDINBURGH FRINGE FESTIVAL SEES THE LAUNCH THE POLYGRAM VIDEO COMEDY AWARDS.

OF

THE AWARD WINNERS WILL BE DECIDED BY TTIE VOTE OF THE PAYING PUBLIC.

WHO'S THE FUNNIEST COMIC ON THE FRINGE? YOU DECIDE. SEE LOCAL PRESS FOR DETAILS ON HOW TO VOTE


KHUBLAI KHAN’S MONGOLIAN BBQ AND BAR OO©© Venue 186 - Khublai Khan’s Mongolian Restaurant, 43 Assembly Street, Leith Tickets 555 0005 c2o

;;

★ ■ KHUBLAI KHAN’S PRESENTS: JAMES JAMES -THE MAGIC OF... Reality and Illusion combine, to create an unforgettable evening.You will never look at playing cards, tissue paper, rope or money in the same way again.... ever! Miss it... miss out! Aug 10-30 (not Tues) 23.00 (00.15) £5.00 (£4.00)

— KISSING THE GOLDFISH

00@®

Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

I

LI4

■ KISSING THE GOLDFISH Following last year’s sell-out: another ‘wacky, witty, weird, and wonderful’ (Observer) extravaganza featuring gems from Bacharach to Bernstein, James Bond to acerbic original material. Raunchy jazz meets zany glamour:1**** First rate entertainment’ Scotsmon.‘Mesmerising’ Telegraph. ‘Brilliant’ Arthur Smith. Preview Aug 14 23.45 (00.45) £4.00 Aug 17,19-21,25-27,29,30 23.45 (00.45) £6.50 (£5.00) Aug 15,16,22-24 23.45 (00.45) £7.50 (£6.00)

KIT AND THE WIDOW

©O©©

Venue 47 - The Cafe Royal, 17 West Register Street Tickets 556 2549

112

★ KIT AND THE WIDOW’S NEW SHOW Edinburgh’s darlings, exiled for two years performing their last West End show, return panting to this elegant ex-bordello with a sneak preview of their next.‘Beyond cabaret, beyond superlative entertainment, they are a national treasure’ Scotsman. Aug 8-28 17.20 (18.20) £8.50 (£6.00) Aug 8-28 18.30 (19.30) £8.50

THE LABORATORY

©0©©

Venue 16 - Southside Courtyard, Davie St. Tickets 6672212

LI3

THE BEST REVUE SHOW IN TOWN...BE AMAZED’

SCIENCE MADE EASY School was never like this. Only in the laboratory could two university dropouts make science this easy. Aug 8-25,29,30 19.45 (20.45) £5.00 (£4.00)

Independent on Sunday

THE EXPERT AT THE CARD TABLE Incredible sleight of hand. ‘Fascinating... amazing’ The Scotsman ‘The ultimate card shark’ The Independent. Aug 8-25 21.00(22.00) £5.00 (£4.00)

PLEASANCE 0131

556 6550

D

pm

• Venue 33 6 - 30 August

Not Mondays 11 & 25 August

THE SPITE BOYS Fat Spite, Bald Spite and Old Spite tell you what they hate, what they really, really hate. 8-11,13-18,20-25,29,30 22.15 (23.30) £4.50 (£4.00) MITCH BENN Mitch is back! The barnstorming comedian and musician’s first solo show. Songs, stories and surprises! ‘Maim to get a ticket!’ Scotsman. Aug 8-30 22.30 (23.30) £5.00 (£4.00)

LA CANARIA

OO©©

Venue 143 - out of the blue,The Bongo Club, 14 New Street (off Royal Mile) Tickets 558 7604 JI4 ★ ■ UN VENTO IMPETUOSO The eternal struggle between order and chaos. In English, Spanish and Italian.‘A truly Mediterranean clown show; fresh and very funny’ El Po/s. Accessible to everyone. Collaborators Jos Houben, MichelineVandepoel (The Right Size,Theatre de Complicite). Aug 10-30 16.00 (17.00) £5.00 (£3.00)

LARRY TRAFALGAR PRESENTS

Spitting Image

McGowan is

®Q©©

Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212

Alictair TVS voices of

Ami 191 Cl 11

M12

★ COUNT ARTHUR STRONG’S DRAMA MASTERCLASS Using unparalleled techniques, Count Arthur takes us on a fabulous tour of the world of‘SHOW BUSINESS’. He’s off the drink and he knows things. A winning combination! Come witness this consummate performer dazzle! Aug 6-14,17-21,25-30 18.00 (19.00) £5.00 (£4.50) Aug 15,16,22,23,24 18.00(19.00) £5.50 (£5.00)

A/oving \he Goalposts "Superb impressionist" The Guardian

THE LEAGUE OF GENTLEMEN Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550

©O©© LI4

Eddie Izzard, Eric Cantona, Tony Blair and Jarvis Cocker all on the same bill?

THE LEAGUE OF GENTLEMEN The most exciting show on the Edinburgh Fringe’ Time Out follow up last year’s sell-out success with an allnew gallery of grotesque characters.‘Daring, startling, seriously funny’ Scotsman; ‘Cruelly intelligent; deeply hilarious; unmissably good’ Glasgow Herald. Preview Aug 7 17.30 (18.30) £4.50 Aug 8-10,12-14,17-21,25,27-30 17.30 (18.30) £7.50 (£6.50) Aug 15,16,22-24 17.30 (18.30) £8.50 (£7.50)

LEE AND HERRING -THIS MORNING WITH RICHARD, NOT JUDY II Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LEE AND HERRING - THIS MORNING WITH RICHARD NOT JUDY II BBC2 FIST OF FUN stars present the sequel to their 1994 hit chat-show featuring celebrity guests and big prizes. Courtyard Ticket Auction commences 12.10pm.‘Totally brilliant. Don’t miss this’ Guardian. COMPLETE SELL-OUT 1996. Previews Aug 6,7 12.30 (13.30) £4.00 Aug 8-11,13,14,17-21,25,27-30 12.30 (13.30) £8.00 (£7.00) Aug 15-16,22-24 12.30 (13.30) £8.50 (£7.50)

ate OaUp tSrlrgrtqjh

Pleasance (33) August 6-24 (not 11) 8.05pm 0131 556 6550

Vy

fe

25


STEWART LEE - KING DONG VS MOBY DICK ©Q©© Venue 33 - Pleasance, 60The Pleasance. Tickets 5S6 6550

PACIFIC RIM APOLOGISES FOR

LM

STEWART LEE - KING DONG VS MOBY DICK Star of the hit BBC2 series FIST OF FUN and ‘world class stand-up’ Sunday Times returns for his I Ith Fringe. Includes blasphemy, fighting, swearing and a dancing cock, literature, ten minutes of old material and a free sandwich.‘Always head-spinningly funny’ NME. Previews Aug 6,7 20.00 (21.00) £4.00 Aug 8-11,13,14,17-21,25,27-30 20.00 (21.00) £8.00 (£7.00) Aug 15,16,22-24 20.00(21.00) £8.50 (£7.50)

ANGIE LE MAR

©O©©

Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

l&rand Tow 13 SMS ONLY THE VERY WORST OF 1H95 AND 1096

Starring Matt Locas George Dawes in DBG TV’s “Shooting Stars’ and David Walliams

K12

THE ANGIE LE MAR SHOW At last one of Britain’s finest comediennes (‘Get Up, Stand Up’ and The Real McCoy’) unveils her long-awaited solo show. Sharp, funny and above all stylish. ‘Already some way out in front!’ The Scotsman. Aug 8-30 (not 11,18,28) 21.30 (22.30) £7.50 (£6.50)

LM MAGAZINE

00©0

Venue 158 -TheVenue, IS Gallon Road Tickets 557 3073

JI4

OFF THE FENCE COMEDY BENEFIT This year, the Campaign Against Militarism’s Benefit makes way for a benefit in aid of the free speech campaign ‘Off the Fence’. You are guaranteed a line-up of the best comedy acts at the Fringe. Aug 17 20.00 (midnight) £ 10.00 (£7.00)

SEAN LOCK

©O©©

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4

★ SEAN LOCK ‘A magnificently polished tale-spinner hiding behind a wilfully self deluded rock’n’ roll persona’ The Independent, comedy’s coolest lounge lizard was a total sell-out in ‘96 so BOOK EARLY.‘Punchy! Inventive! Superb!’ The Times. Previews Aug 6,7 21.25 (22.25) £4.00 Aug 8-1 1, 13,14,17-21,25,27-30 21.25 (22.25) £8.00 (£7.00) Aug 15,16,22-24 21.25 (22.25) £8.50 (£7.50)

L’ULTIMA RECITAL

©O©©

Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550

U4

■ L’ULTIMA RECITAL The mighty Diva and her envious pianist have battled with each other for 30 years; jousting with a barrage of sounds, dodging piano punches and falsetto fists, stripping life down to its bare instrumentals. This confrontation may well be the last... Aug 6-1 1,13,14,17,18,20,21,26-30 16.20 (17.20) £7.00 (£6.00) Aug 15,16,22-24 16.20(17.20) £8.00 (£7.00)

LWT COMEDY WRITING AWARD

OOO©

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LM

THE LWT COMEDY WRITING AWARD FORUM LWT’s new award to recognise comedy writing provides the spur and focus for a lively discussion with leading comedy writers, top telly people and tomorrow’s talent. Share the laughter, tears and unlimited refreshments. Aug 25 10.30 (11.45) Free

ALISTAIR MCGOWAN

©O©©

Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4

ALISTAIR MCGOWAN MOVING THE GOALPOSTS Jarvis Cocker, Eddie Izzard, Lee Hurst, Eric Cantona,Tony Blair and Jo Brand all on the same bill? Yes, McGowan (They Think It’s All Over’,‘Oddballs’,‘Only An Excuse’) is in Edinburgh at last voicing over videos and doing stand-up, PLUS Trevor Brooking playing Eric Satie. Book early. Previews Aug 6,7 20.05 (21.05) £5.00 Aug 8-10,12-14,17-21 20.05 (21.05) £7.00 (£6.00) Aug 15,16,22-24 20.15 (21.15) £8.00 (£7.00)

DONNA McPHAIL

00©0

Venue 38 -The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

KI2

★ ■ DONNA McPHAIL After a year in the wilderness the ‘Bower bird of comedy’ returns, airing her views on everything from politics to perversion and for 7 nights only she’ll also be doing a show.‘NOTHING SHOFT OF MAGIC Irish Independent. Aug 17-23 20.45 (21.45) £8.50 (£7.00)

MARK MAIER

©O©©

Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550

COMEDY

CHANNEL New British B#medy Every weeknight at 11pm

26

PLEASANCE 0131 556 6550

MARK MAIER He’s smoking like a runaway train and it has to stop. And it will. Probably at the beginning of September when this festival is over. In the meantime Mark is ‘Giving Up Giving Up’.‘Top laughtersmith’ The Herald. Preview Aug 6 22.15 (23.15) £5.00 Aug 7-10,12-14,17-21,25-27,29,30 22.15 (23.15) £7.00 (£6.00) Aug 15,16,22-24 22.15 (23.15) £8.00 (£7.00)

LI4


SHELAGH MARTIN Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 SHELAGH MARTIN EXPANDS A mindboggling half hour of pure ridiculousness and surrealism. Shelagh gleefully ignores the usual stand-up subjects in favour of more interesting topics including The Insect World, Furniture and Sub-Aquatic Lifeforms. ‘A joy of dry humour’ Oxford Times. Aug 8-30 (not 11,26) 16.00 (16.30) £3.50

DYLAN MORAN Venue 33 - Pleasance,60The Pleasance. Tickets 556 6550

MEL & SUE, GERALDINE MCNULTY AND EMMA KENNEDY OO©© Venue 33 - Pleasance, 60 The Pleasance. Tickets 556 6550

LI4

THE BIG SQUEEZE Mel and Sue (Channel 4’s ‘Light Lunch’). Geraldine MacNulty (‘Wildly funny’ Time Out) and Emma Kennedy (Brilliant’ The Scotsman) bring you a great big comedy concentrate.The Queens of character comedy squeeze into one enormous show. Aug 19-21,25-30 16.00(17.00) £7.00 (£6.00) Aug 22-24 16.00 (17.00) £8.00 (£7.00)

MERVYN STUTTER’S PICK OF THE FRINGE Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI

MERVYN STUTTER’S PICK OF THE FRINGE He is brilliant’ Guardian. ‘Just when you thought you’d had enough, Mervyn Stutter rekindles your enthusiasm with his vibrant and stimulating showcase of Fringe talent. Eight different comedy, theatre and music acts in 90 minutes’ Scotsman. Aug 9-14,19-21 13.00 (14.30) £7.00 (£6.00) Aug 15-17,22-25 13.00 (14.30) £7.50 (£6.50)

©o©o

BEN MOOR Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

LI4

★ A SUPERCOLLIDER FOR THE FAMILY A Beserk globe-trotting comedy safari from one of the Fringe’s most lanky performers. Strictly limited run! ‘Constantly inventive...deeply funny...oddly eloquent’ FIVE STARS Scotsman. ‘Deserved a Perrier nomination’ Finonc/o/Times.‘Captivating...hugely impressive’ The Stage. Preview Aug 6 16.00 (17.00) £5.00 Aug 7-10,12-14,17,18 16.00 (17.00) £6.00 (£5.00) Aug 15,16 16.00 (17.00) £7.00 (£6.00)

DYLAN MORAN - GURGLING FOR MONEY The 1996 Perrier Award Winner has re-formed especially for the Festival. Come, and feel the extraordinary experience of some people in a room.‘The best stand-up this country has ever produced’ Irish Times. Preview Aug 7 21.30 (22.25) £4.50 Aug 8-14,17-20 21.30 (22.25) £8.00 (£7.00) Aug 15,16,22-24 21.30 (22.25) £8.50 (£7.50)

BRUCE MORTON Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 ★ BRUCE MORTON This Fringe Programme listing cost the performer ' hat amount. Forty words at over £8 per word. Count the number of Somebody is making a buck. Help Bruce recoup his investment. Aug 8 21.30 (22.30) £5.00 Aug 9-30 (not 18,28) 21.30 (22.30) £8.50 (£7.50)

AL MURRAYTHE PUB LANDLORD - KING C BEERS Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550

NEPTUNE THEATRE LIVERPOOL Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151

WANT A SOUVENIR? t-shirts, posters Ft other goodies at the Fringe shop 180 High Street, Royal Mile

LI4

AL MURRAYTHE PUB LANDLORD - KING OF BEERS Following his Edinburgh ‘96 Perrier-nominated, sell-out success, comedy’s most original character comedian went on to win Time Out Magazine, Independent On Sunday Comedy Awards and The Beer Writers Guild Award.‘The funniest show at the Festival’ The Scotsman Previews Aug 6,7 21.30 (22.30) £4.00 Aug 8-11,13,14,17-21,25,27-30 21.30 (22.30) £8.00 (£7.00) Aug 15,16,22-24 21.30 (22.30) £8.50 (£7.50)

KI2

BUNTYTHE BOUNCER Bring your handbags, forget your knickers - you’re at Liverpool’s seediest nightclub, where ten revellers are about to meet their worst nightmare. She’s mean, she’s tough, she’s dog rough. Join Lynn Fitzgerald for a full body search.‘Brilliant’ Liverpool Echo. Aug 8-30 (not 12,26) 23.45 (00.45) £6.00 (£5.00) NEPTUNE THEATRE LIVERPOOL continues on next page

27


PERRIIRPICKOM THE FRINGE AWARD FOR COMEDY

Perrier Best Newcomer 1996

4 DATES YOU SHOULD REMEMBER: 1

AWARD SHORTLIST ANNOUNCED IN THE DAILY DIARY, WED 20TH AUGUST.

AWARD WINNER ANNOUNCED ON SAT 23RD AUGUST.

3 B.DOpm PlBasance (33) August B-30 [not 1UG] Tickets B131556 655B £Tht Oails Urirgraph

PERRIER 1"^ PICK OF •SETS' SELLOUT! THE FRINGE AWARD SHOWS WED 27TH, FRI 29TH, SAT 30TH AOG AT 10PM

ASSEMBLY ROOMS

0131 226 2428 I

ASSEMBLY + GILDED BALLOON + PLEASANCE

4 PERRIER PICK OF THE FRINGE SEASON IN LONDON’S WEST END. PHONE 0171 494 5558 FOR DATES AND DETAILS

28


NEPTUNE THEATRE LIVERPOOL continued CCMCDy & RCVUC TERRY TITTER’SisFULL LENGTHcomic Together with his curiously moustached sister, Renee,Terry the clapped-out that showbiz forgot. Includes songs, puppets and obscene phone calls to small children. The best new comedian I’ve seen 8-30 in years’ Aug (notHarry 12,26)Hill.midnight (01.00) £6.00 (£5.00) EARL OKIN Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 THE NEW JIM ROSE CIRCUS Venue 26 - The Palladium, Broughton Place Tickets 557 2100 (557 6969 pre August) G ■ STAR OF GERMAN COMEDY!!! How much longer will Earl’s unique voice,andsophisticated wit and irresistible sex-appealGermany. grace Edinburgh, now ■new-sure THE NEW ROSE Creatures CIRCUS ofThehorror FringeandMaster returns with an all velvet Fritz,Forget Heidi TV haveSeemade him EUROSTAR!!! famous throughout Forget standto with be JIM a hit-show. freaksalong include Women up. the tunnel. the real Sumo’s, men horns, Mexican transvestite wrestlers with all the Aug 8-14,17-21,26-30 family favourites. Every night Aug 15,16,22-25 20.10 20.10 (21.30)(21.30) £7.50 £7.00 (£5.50)(£5.00) Aug 9-30 (not Mons) 19.00 except (20.15) Mondays. £8.50 (£6.50) Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 NEWSREVUE STILL HORNYrepertoire. AFTER ALL THESE Both YEARS from the Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 I ■Edinburgh Unmissable! showsAnother sell out.sliceBook First‘Spiritof legend’s of the Fringe’ winner.‘Multi-talented musical supremo’ Timeearly! Out. ★satirically NEWSREVUE Britain’s best topical revue show.‘Slick and assured.... ‘Master the Art of Cabaret’ Russell Hunter. brilliant’ Guardian.‘A wisecracking, jumping cracker.... wittyTheandStage. Aug 9,15,16,22,25,29,30 16.10 (17.15) £6.50 (£5.00) effervescent, devastatingly acute’ Daily Telegraph. ‘Something special’ Aug 23,24 16.10(17.15) £7.00 (£5.50) Aug 8-30 (not Tues) 21.30 (22.35) £6.00 (£5.00) WHOOPS VICAR IS THAT YOUR DICK A revue. Witty, nasty, funny, OLE! libelous, hilarious. The funniest show this reviewer has seen on the Fringe Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 for an absolute scream’ (01.00) The Scotsman. Augyears... 8-30 (notTues) midnight £5.00 (£4.00) ■returns OLE!with TheaFlamenco Comedy Show.Thesuperbly mad Casablancan Paul Morocco spectacular new show....a funny celebration of flamenco with theGo.’subversive and surreal wit that is Ole! ‘One orange short of the fruit GLYNN NICHOLAS The Independent. Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 III basket. Aug 8-14,17-21,25-27,29,30 Aug 15,16,22-24 22.05 (23.20)22.05 £8.50(23.20) (£7.50)£7.50 (£6.50) GLYNNhurt NICHOLAS - CROSSING THE LINEleaveGlynn may behelpless bewildered, amused, and confused yet his unique stories audiences with laughter. Sharp, perceptive and verysatirist verysince funny,‘Glynn is simply brilliant... OMID DJALILI IS ETHNIC ®o©© most pertinent Australian social Barry Humphries’ Adelaide the Venue 2 - Fringe Club.Teviot Row, Bristo Sq. Tickets 226 5138 Advertiser Aug ★ OMID DJALILI IS ETHNIC Sell-out‘95,‘Short Fat Kebab-shop Aug 8-11,13,14,17-21,25-27,29,30 15,16,22-24 22.15 (23.15) £8.5022.15 (£7.50)(23.15) £7.50 (£6.50) Son’, 96‘Arab &The Jew’.This stand-up Djalili, painfully tackles thefunny,rootsOmidofOwner’s ethnicity and theThe mystery of Desyear,Lynam.‘Hilarious, Djalili is unmissable’ Independent. GRAHAM NORTON Preview Aug 8 21.20(22.20) £5.00 Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 IN Aug 9-2922.30 (not(23.30) 13,28) 21.20 (22.20) £7.00 (£6.00) GRAHAM NORTON Camp ramblings andandthinlyITV’sdisguised smut from the Aug Ticket30includes Fringe Club Membership for the evening man best known for Loose Ends, Father Ted spermfest‘Carnal Knowledge’. If youCOMIC haven’t GENIUS’ slept withThehimIndependent. then enjoyment is almost guaranteed. ‘Inspired lunacy... Aug 23.10(£7.50) (00.10) £7.50 (£6.50) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 23.10 (00.10) £8.50 Screaming Blue Murder is undoubtedly cabaret comedy entertainment at its very best. The Scotsman Venue 47 Early Cafe Royal 8-10pm 17 West Register Street John Gordillo Box office Carey Marx 0131 556 2549 Lee Mack Fringe box office Compere 0131 226 5138 Stephen K Amos the big value comedy shows 8-30 August (not 19 or 28) Late £6 10.30pm-12.30am Four top comedians, two intervals, Andrew Pipe a bar, a joke competition and a '2 for 1' beer Will Smith promotion, all for only £6. Dan Evans ' Compere Ben Norris four quality acts for the price of one The List top comedy, top value The List

(orisberti ICE BEER '2 fori' beer promotion


PLEASANCE COMEDY ®o©© coMZDy & Revue Venue 33 - Pleasance, 60 The Pleasance. Tickets 5S6 6550 LI4 PLEASANCE COMEDY Pleasance Upstairs, 1993, Coogan & Skinner - who?? you would have asked. Frank returns for a bit this year. Last year alone we had both Perrier winners. Just look at the Pleasance Comedy advert and see if you OWEN O’NEILL (DO©© can pick this year’s. Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 PORTEOUS & ARCHER ©O©© OWENareO’NEILL - OFF MY FACEdown.This O’Neill isshow tortured bythedemons, some of Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 whom normal and want to settle shines torch on the ■music PORTEOUS AND ARCHER EXPERIENCE A feast of comedy dark side of alcohol. Wear your shades and laugh if you dare. for ramblings. all tastes, Audience served withparticipation lashings of atcharm. An hour of nostalgia and and Aug 8-14,17-21 inventive its best. Aug 15,16,22-24 22.00 22.00(23.00) (23.00) £7.50 £8.50(£6.50) (£7.50) Aug 8-30 20.20 (21.20) £5.00 I 2 LOOK OUT 4 OO©© POULTER AND DUFF ©O©© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 K10 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 Iput2 together LOOK OUT 4 A group of students from Eton and Downe House have Venue A-Z OF TABOO Two Tw*ts & a Suitcase Full of Filth. From necrophilia to this original production of stand-up comedy, music and much shoplifting, surrender to an orgy of inch-perfect one-liners and satanic more.18-30 We guarantee you one the most entertaining lunchtimes of your life. improvisation. Featuring the Celebrity Shock Puppets! ‘MANIC AND NAUGHTY’. Aug 13.10 (14.00) £4.00of (£3.50) ‘Poulter and Duff are dangerous men20.55with(21.55) time on their hands’ Independent. PANTOMIME PRODS OO©© Aug Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 20.55 (21.55) £8.50 (£7.50) £7.50 (£6.50) Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 HIO ★Drugs? CHLOE POEMS UNIVERSAL RENTBOY Something to sell?sellsSex?it all. GREG PROOPS ®0@© Politics? The gayinPam gingham diva,of the global prostitute extraordinaire Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LI4 Gasp and guffaw as the Ayres chemical generation runs amok in a GREG PROOPSnowHelloandeverybody! Weofarethatveryold proud that you have a brand frock. ‘Perfectly timing’£6.00 Time(£3.00) Out. new government have got rid fascist bummer government. Aug 10-30 (notpointed, 17,24,25)impeccable 21.50 (22.50) I’m coming back to E-town, so let mirth and hilarity rule.‘Relentless narcissism’ The Scotsman. THE COMEDY CHANNEL PRESENTS Preview Aug 7 19.30 (20.30) £5.00 19.30 (20.30) £8.00 (£7.00) THE PARAMOUNT BRITCOM BENEFIT 00©0 Aug 8-10,12-14,17,19-21,26,27,29,30 15,16,22-24 19.30 (20.30) £8.50 (£7.50) Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 Aug THE BRITCOM BENEFIT TheBritish Paramount Comedy Channel presents a one Aug 25 21.00 (22.00) £8.00 (£7.00) off line-up of the cream of new Comedy some of the best of comedy’s young turks on a single bill. All profits will go to HIV / AIDS charities in PUNCHLINE PRODUCTIONS ®O0O Edinburgh. Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LI4 Aug 20 22.00(23.05) £ 10.00 (£8.00) RE-TUNE TO MURDER Madeleine Richards, Channel 5’s leggy daytime isnew charged withfrom shoplifting. But something deadly lurks- Out in thisto Lunch!’ PARSONS & NAYLOR ®G©© doyenne, comedy the writers of‘Lloyd Grossman Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LI4 exuberant ‘Unmissable’ Guardian Guide ‘Zany, clever, surprising and very funny’ Time Out. Preview Aug 9 13.20 (14.20) £5.00 PARSONS AND NAYLOR -THE MERRYyetONIONS OF DORKING All Aug 10,12-14,17-21 13.20 (14.20) £5.50 (4.50) the qualities of the best old-time double-acts their humour is very definitely late nineties’ofTime Soldcomedy’ Out‘93-’96. Fifth consecutive all-new show. The Aug 15,16,22,23 13.20 (14.20) £6.50 (£5.50) Godfathers newOut. sketch Independent. Preview Aug 6,7 21.20 (22.20) £4.50 “Highly original quite naughty Aug 8-10,12-14,17-21,25-27,29,30 Aug 15,16,22-24 21.20(22.20) £8.5021.20 (£7.50)(22.20) £7.50 (£6.50) and explosively funny” PEEPOLYKUS ®G©© SUNDAY TIMES Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LI4 7-30 August ★ ■ PEEPOLYKUS - I AM AlatestCOFFEE Movie maestro Jorgbyd’Offsock introduces highlights from his celluloid creation assisted two 10.30pm humanoids from the future.The best show I saw in Edinburgh’ The Independent / 996.‘Utterly original, utterly mad,£5.00utterly hilarious’ The Scotsman. Pleasance Preview Aug 7,8 17.15(18.25) Aug 17.15(£7.50) (18.25) £7.50 (£6.50) Box office Aug 9,10,12-14,17-21,25,27-30 15,16,22-24 17.15 (18.25) £8.50 0131 556 6550 PELLEW INTERNATIONAL ®0©© Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550 LI4 *some■ Aviolence. LITTLEIn FIGHT MUSIC Two men, one piano, some songs, some chat, the style of Flanders and Swann,Tom Lehrer and Coward, with a hintAugof Tarantino. All new,£5.00 all original, and all over in an hour. Preview 7 17.17.0055(18.05) Aug 8-14,17-21 (18.05) £6.00 (£5.00) Aug 15,16,22,23 17. 0 5 (18.05) £7.00 (£6.00) Aug Aug 2524 17.20(18.20) 17.20(18.20) £7.00 £6.00 (£6.00) (£5.00) A PERRET AND A WELL OILED LIMB ®0©© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★theMUSIC IN MY MOUTH Poems about love, oblivion and scalding pains in urethra songs about rats, Pitt the Elder and haemorrhoids, with personable poet14,28) Perret 20.15 and a (21.05) dishevelled well-oiled prosthetic Limb. Aug 6-30 (not £5.00but(£4.00) PERRIER PICK OF THE FRINGE OOO© Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 Kevin PERRIER PICK OF THE FRINGE AWARD SHOWS The winner and nominees of Britain’s No. I Live Comedy Award on one fabulous bill! This outstanding comedyforbillperformers show is guaranteed to makeandyourevue’ laugh.The highest accolade in Britain new cabaret Sunday Times. Aug 27,29,30 22.00 (23.15) £ 10.00of(£9.00) Gildea 30


PACIFIC RIM IN ASSOCIATION WITH DAWN SEDGWICK PRESENTS "So You Think You’re Funny” Award Winners -1996 'an incredible performer ... a'must see’ comedian for ’97”

"You are just blown away by the force of his talent and charisma” 8-30 AUG UENUE 38 9.15PM PolyGram Video

GILDED BALLOON 0131 226 2151

PACIFIC RIM IN ASSOCIATION WITH DAWN SEDGWICK PRESENTS

YOUNG,G FIEO I1! AND GGEEN THE BEST OF NEW IRISH COMEDY

MNIIBI

iHDlRSM

DHV

10m GILDED GAUOONN 8-30 MSI KHIE3G PolyGram Video 0131226 2151

COMCDJ & RCVUC *THE REGENCY ROOMS WITH LENNY BEIGE oo@© IMSiSlSVenue 87 - Famous Spiegeltent,Top ofWaverley Centre, Princes St Tlx 5S8 8010 JI2 ■happening THE REGENCY ROOMS WITH LENNY BEIGE London’s most cabaret’HandEvening to Edinburgh showorwith band The Fickle of noFate,Standard full castcomes of regular charactersin aandfull one two superstar guests. Strictly riff-raff. Aug 18-21,24,25 23.30 (01.00) £8.00 Aug 22 23.30 (02.00) £8.00 §L SHANE ST JAMES ©O©© TfiraCT^gj Venue 87 - Famous Spiegeltentjop ofWaverley Centre, Princes St Tix 558 8010 J12 ■magician SHANEandSTentertainer JAMES The world’s hippest, happening hypnotist, mindextraordinaire.‘Hilarious!’ BookAge,early and bring crowd! mesmerising... I what laughedmight ‘til I happen. wept’ The Australia. Lookainto hisPreviews eyes...‘Literally you never know quite Dangerous!! Aug 6,7 19.0020.30 (20.00)(21.30) £5.00£8.00 (£6.00) Aug Aug 8-19,22-26,29,30 20,21,28 17.00 (18.00) £8.00 (£6.00) S.A.S - A NEW FORCE IN COMEDY OO©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 6672212 MI2 TERRORIST TARTS UNDERCOVER New female comedy duo who have taken the London scene by storm, make their characters Edinburgh and debutsketches. launchingNON their multi-media revueWILL including a host ofBROCHURE original ATTENDANCE CAUSE THIS TO EXPLODE! Aug 17-30 (not 28) 19.15 (20.15) £5.00 (£4.50) SCARED WEIRD LITTLE GUYS ©O©© Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 SCARED WEIRD LITTLE GUYS Mindless stupidity for the thinking person!! ‘A rampantly talented pair of singer-songwriters who are equally dazzling their ownFinancial materialReview or doing hatchet jobs on other people’s not a dulldelivering second’ Australian Aug 19.30(£7.50) (20.35) £7.50 (£6.50) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 19.30 (20.35) £8.50 THE SCOTTISH THEATRE AND MUSIC SCHOOL ©O©© Venue 88 - St Stephen’s Centre, Foot of Howe Street Tickets 556 2661 FIO BACK 2 THE 60S High energy, singing, dancing comedy revue about the 60s. From Elvis to Mary Hopkins the hits just flow so loosen your corsets, throw off your suit, look out your 60s23.05gear(00.05) and come down. Aug 7-9,14-16,21-23,28-30 £6.00on(£5.00) SCREAMING BLUE MURDER COMEDY ©O©© Venue 47 - The Cafe Royal, 17 West Register Street Tickets 556 2549 112 THE BIG VALUE COMEDY SHOW... EARLY Offers two hours of comedy from John Gordillo, Lee Mack, Carey Marx and Stephen K. Amos, two intervals, a‘...cabaret bar, a joke competition and best’ a ‘2 for I ’ beer promotion, all for only £6! at its20.00 very Aug 8-30 comedy (not 19,28) (22.00)Scotsman £6.00 THEAndrew BIG VALUE COMEDY SHOW... two hours of comedy from Pipe, Will Smith, Dan Evans andLATE BenallOffers Norris, a bar, a joke competition and a ‘2 for I ’ beer promotion, for onlytwo£6!intervals, ‘Top comedy, top value’ The List. Aug 8-30 (not 19,28) 22.30 (00.30) £6.00 JUNIOR SIMPSON ©O©© Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550 LI4 JUNIOR SIMPSON works the hallway. Great cities produce great comedians. London, New York... Luton. Yes, that vibrant, exciting place, famous for its airport, brings you thiswatch incredible comicThein hisGuardian first solo show. Stylish, wicked, very funny.‘Hilarious... this £4.50 man’ Previews Aug 6,7 21.45 (22.45) Aug Aug 8-10,12-14,17-21,25-27,29,30 15,16 22-24 21.45 (22.45) £8.5021.45 (£7.50)(22.45) £7.50 (£6.50) SIR BERNARD CHUMLEY OO©© Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550 LI4 SIR BERNARD CHUMLEY’S GRAND TOUR MattandLucas (George Dawesyou intheShooting Stars) and David Walliams, with Tim Atack Paul Putner, bring of their 1995 andTimes 1996 shows. ‘Ludicrously brilliant... audiences are closeworst to devotional’ Sunday Aug 10-14,17,19-21 20.00 (21.00) (£7.00) Aug 15,16,22-24 20.00 (21.00) £8.50£8.00(£7.50)


FRANK SKINNER ®0©© Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LM FRANK SKINNER Don’t miss former Perrier winner try-out new stand-up material prior to his 100 date UK Autumn Tour.‘You could put Frank Skinner down in front at any time and he would have it in stiches’ Guardian. BOOKof any NOW.audience Aug 8-11,13,14,17-21 21.00 (22.00) Aug 15,16,22-24 21.00(22.00) £8.50£8.00 (£7.50)(£7.00) SLAP ME PRODUCTIONS PRESENTS KATE SHORTT oo@© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 HI0 ★Palladium ■ CAUGHTT SHORTT ‘Wacky and ebullient’ The Stage. London performer of thesongster year 1997. a cello contortionist off herIntimate rocker!confessions Not to be ofmissed. Aug 20-30 18.and45 comic (19.45) £5.00 (£4.00) SOYOUTHINKYOU’RE FUNNY? ©O©© Venue 72 - Queen’s Hall, Clerk Street. Tickets 668 2019 N13 I0YEARS OF ‘SO YOU THINK YOU’RE FUNNY’ In celebration of its all 10th anniversary the Gilded Balloon and Channel 4 Television bring together ten forMorton a night ofandmanic mayhem. The line up includes Rhona Cameron, Phil winners Kay, Aug 25 Bruce 19.30 (21.30) £9.00 Dylan (£8.00)Moran. Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 KI2 SO YOU THINK YOU’RE FUNNY? Experience theandhighly charged atmosphere as comedy hopefuls battle it out for fame fortune in this sell-out competition’s Anniversary sponsored by Channel Four Television. winners10thinclude Phil Kay,year, DylanagainMoran, Bruce Morton. Heats: AugPast Final: Aug 2410-12,17-20 20.45 (22.45)22.15£8.50(23.45) (£7.50)£6.50 (£5.50) BEST OF SO YOU THINK YOU’RE FUNNY? TheBalloon formerhave comedy newcomers whotheir cuttalent their comedy teethgiants at theof the Gilded matured and developed to become circuit.The comedy elite include Lee Mack and Martin Trenaman. Aug 8,9,13-16,21-24,26-30 22.15 (23.45) £7.00 (£6.00) SPONTANEOUS COMBUSTION ®Q©© Venue 3 - Assembly Rooms, 54 George Street Tickets 226 2428 111 SUB-POST OFFICE OF DEATH What has Farmer Woodhatch got a beef about? Four hostages, abreathtaking finger on theimpro triggerplusandjokesan that unfinished Spontaneous stay thescript. same every day. Guardian DarkCombustion’s secrets, big guns, crop rotation. ‘Exceptional comedy’ Scotsman ‘Dazzling’ Preview Aug 8 18.00(19.15) £5.00 Aug 00 (19.15) Aug 9-14,17-21,25-30 15,16,22-24 18.00 18.(19.15) £8.50 £7.50 (£7.50)(£6.50) THE STAND COMEDY CLUB ®0©© Venue 9 - Iron Ceilidh House, 9 Hunter Square, High St. Tickets 220 1550 K12 HOVIS PRESLEY:WHEREVER I LAY MY HAT..THAT’S MY HAT Last year’s sell-out success digitally remithered. Comedy, poetry, drink interval. Ventilated venue, verifiable value.‘Never stops being funny’ Guardian.‘Go and see him, he’s brilliant’ Mark Radcliffe. Preview Aug I 16. 0 0 (17.00) £2.00 Aug 8-24 16.00(17.00) £4.00 (£3.00)

LUMBERJACKS ON ICE: Craig COMEDY FROM THEFrancis COLONYspecial Allow | favouriteinto stand-ups Campbell, Stewart toCanada’s skateSmiles laughter your heartsfaces while courageously jugglingand beavers andguests j moose. will stick to your like maple syrup. Previews 17.30 £4.00 (18.40)(£3.00) £2.00 Aug 7-30 Aug 17.303,4(18.40) I Venue 106-Wj Christie’s, 27-31 West Port, Grassmarket Tickets 229 4553 KIO j,C JOHN GILLICK: ISA MANDATORY Bitingly sarky show packs awfulGENDER lottheof Bigmaterial 50 minutes... FIELD proveswith that comedy existsan outside Three’into Scotsmen.‘Glaswegian atop-calibre big heart...wonderful...universal humour’ Stage. Preview 20.00 (20.50) £2.00 Aug 7-24Aug20.002 (20.50) £4.00 (£3.00) SCARLET HARLOTS Mary ‘banjo strummingthatstrumpet, lovingly vulgar’ LiUnfaithful fe. Susan Morrison aresharp and genuinely funnyListManchester people still City around’ Aberdeen Evening‘proof Express. JanethereMackay ‘scathing wit’ and ‘in-yer-face’ Guardian. Previews 21.10 £4.00 (22.10)(£3.00) £2.00 Aug 7-24 Aug 21.103,4(22.10) THE STAND Five acts for a fiver at Scotland’sis even year-round comedy club.The surroundings arecharged’ good, but the programming smarter’ Stage ‘intimate, crowded, fully Scotland on Sundoy.‘Comedy was born in places like it now’21.30 List. (23.30) £5.00 (£4.00) Julthis...discover 2,29,30 Aug31,Aug 7-24 22.30 (00.30) £5.00 (£4.00) STAND UP STRAIGHT ®Q©0 Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 !j STAND UP STRAIGHT An hour of hard hitting observational comedy in jl| the company of Edinburgh’s own Gordon Brunton‘Dry, ‘Confident ease of Hull manner’ Scotland on Sunday and Englishman Davelaughter. Williams sharp, likeable’ Evening Times. No gimmicks. Loads of Aug 6-23 19.05 (20.05) £5.00 (£4.00) THEATRE WORKS ®0©0 Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 ★career ■ WOMEN OF A CERTAIN AGE by David Simons. Hilarious comedy of women in their 30s/40s who can’t find mates. Superbly acted after extensive rehearsal, the audience is treated to a Feydeau-like farce. Guaranteed quality8-23show. Unmissable! Aug 13.40 (15.00) £5.00 £4.00) Aug 8-16 21.00(22.10) Aug 16-22 18.15 (19.30) MARK THOMAS OOO© Venue 72 - Queen’s Hall, Clerk Street. Tickets 668 2019 N13 MARK THOMAS ONE NIGHT ONLY! Mark is back in Edinburgh for just one show. Special guest star Norman Lovett. BOOK EARLY! ‘Seditious genius’ Melody Aug 24Maker. 19.30 (21.30) £10.00 THREE ®G©© Venue 47 - The Cafe Royal, 17 West Register Street Tickets 556 2549 112 THREE Three diverse and unorthodox comedians in ninety minutes. Martin Bigpig ‘explosive visual comedian who should carry a government health warning’ Lucy Porter ‘Manchester’s leading gag mistress’Comedy Review, Robin8-30 InceCity(not ‘ALife, rising Aug 18,28)star’19.The15 Guardian. (20.45) £6.00 (£4.50) WRITE YOUR OWN REVIEW onhttp://www.edfringe.com the Fringe web site


3 MEN AND 2 DOGS Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 3Make MENMeAND 2Award DOGS‘96),Australia’s funniest(two-time newcomerfinalist) Dave Williams (winner, Laugh Gary Bradbury and national radio personalitysubstitutes’ Adam Hills Rippresent aMag ‘f***in’ funny evening of stand-up comedy accept Aug 8-30no (not Tubs) 19.30It Up(20.30) £5.00 (£4.00) TINY MO’S (DO©© Venue 99 - Tiny Mo’s Speakeasy, 60 The Pleasance L14 BRAND X PRESENTS TINY MO’S BIG TIME CABARET GAMBLING! LIQUOR! BROADS! The creators of I996’s cult hit‘Gawk!’ (‘a truly alternative act’ bringkneecaps! you a big night out every ten minutes! Different bills nightly. HoldThe6-30 on Ust) to20.00(20.30) your Aug £2.00 TOMMYTIERNAN & JASON BYRNE ®0©© Venue 38 -The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 KI2 TOMMY TIERNAN & JASON BYRNE 1996’s So You Think You’re Funny’ award are theshow hottest- ‘You comedians Performing individual extendedwinners sets in- they this unique are just working. blown away by the force of the Augcharisma 8-30 (notand28)talent’ 21.15Sunday (22.30)Independent. £7.50 (£6.50) THE TOPP TWINS ®0@© Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 Ii I ■character THE TOPP TWINS New Zealand’s cultural icons andparticipation. TV stars present comedy, original music, zany wit and audience ‘NZ’s finest artistic The Herald ‘Comic heavyweights’ Financial Timesexport since lamb cutlets’ Aug 8-10,12-14,17,19-21,26-30 20.00 (21.25) Aug 15,16,22-24 20.00 (21.25) £8.50 (£7.50) £7.50 (£6.50) JOHNNYVEGAS ®0©@ Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 K12 THE JOHNNYVEGAS SHOW He’s the size of a cow and twice as mad! to Awhatpintheanddoesa potter’s wheel make a dangerous combination as Johnny returns - entertaining! Comedy’s Aug 8-30 (notbest11,18,28) 22.45 (23.45) £7.50a campfire (£6.50) - come and be warmed! LIZ WEBB ©O©© Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550 LI4 THE ITSY BITSY LIZ WEBB SHOW A half hour slice of stand up comedy from a bright-eyed, orangevividbombshell.‘Women’s humour is alive, well and kicking’ Thebushy-haired Scotsman,‘kooky, and rousing’ The Stoge,‘Inspired dippiness’ The 7List.18.30 Preview Aug (19.00) £2.00 Aug 8-30 18.30 (19.00) £3.00 YLLANA OO©© Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 Kl 2 ★Award ■ GLUB GLUB! Returning to Edinburgh following world wide success. winning Spanish comedy troupe are second to none. A reckless, crazy show, hotwhen stuff,you will leave’ have you rollingNews.in the aisles.‘Hilarious... you’ll still be laughing15-23 Evening Aug 14.15(15.15) £7.00 Aug 24-30 16.30 (17.30) (£6.00)

Dattf CTeleBrcpft can help... Especially for our readers we have reserved some tickets for the shows that form part of The Daily Telegraph Comedy Festival. On the date of the performance take that day’s Daily Telegraph along to the venue box office to be eligible to buy a ] ^ QTdcflrajjh _ ticket. The limited iEhc Oatlp

Vy fe%

Greg Proops Mel, Sue, Gerry and Emma Milton Jones Scott Capurro Alistair McGowan Ben Moor Adam Bloom Mark Maier Angie Le Mar Ed Byrne Ed Byrne & Brendan Burns in ‘The Act’ Shelagh Martin Johnny Vegas Bob Downe Big Top Extravaganza

http://www.telegraph.co.uk

YOUNG, GIFTED & GREEN ©O©© Venue 36 - Gilded Balloon I , People’s Palace, Old Fishmarket Close Tickets 226 2151 K12 YOUNG, GIFTED AND GREEN Best of Irish Comedy Part 3. Continuing itsnewtradition of showcasing the best Dublin comedy,YG&G returns with a brand (EddieIrishBannen, Mark Doherty, John Henderson) to deliver‘Comedy Heavenline-up accent’.(23.15) Aug 8-30with(notan 28) 22.00 £7.50 (£6.50) PAUL ZENON ®0@© Venue 87 - Famous Spiegeltent,Top ofWaverley Centre, Princes St Tix 558 8010 JI2 PAUL ZENON Con-man, comic and maverick magician Paul Zenon will take you a ride. Trustfunny him.’Gloves-off andYorkstreetwise - superb stuff’Copperfield. NM£.‘King ofPreview thefortricksters... as hell!’ New Times.‘Bastard’ David 22.00 (23.00) £4.00 £7.50 (£6.50) Aug 9-30Aug (not8 23,28) 22.00 (23.00)

THE WORLD’S HIPPEST, HAPPENING HYPNOTIST...DANGEROUS!!! “Literally mesmerising. The man’s a magician.. .1 laughed till I wept. Don’t miss this amazing show” the age, Melbourne “Fantastic show. I’ve never laughed so hard for so long”” express Taiwan “I pissed myself” kylie LOOK lOTO mV EVES. . V0U 0EUER KOOUJ LUHOT OUGHT HOPPER! BECK’S FAMOUS SPIEGELTENT (VENUE 87), waverley centre, princes street, Edinburgh (5PM) 6,7,20,21,28 AUGUST • (8 30PM) 8 to 19,22 to 26,29,30 AUGUST TICKETS: 0131 226 5138 (558 8010 FROM AUGUST) BOOK EARLY AND COME WITH A CROWD!


COMPAGNIE YVETTE BOZSIK O Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 ■& professional HOMMAGEdevelopment, A MARYWIGMAN Solo piece depicting Wigman’s person? struggle withfamily the scenes demonduring & the acrystallisation of [ri :' her ideas.THE WEDDING grotesque country gipsy wedding.The choreography combines folk, contemporary dance & Bozsik’s lUl ASSEMBLY ROOMS ®0©© Aug unique20-30 style. 15.15 (16.25) £7.00 (£5.00) Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 ■by TBILISI BALLET, GEORGIA Symphonic Dances: twelve exciting works ©O©^ i George Alexidze,and oneContemporary of the greatestform, choreographers in the Former Soviet CONTINENTAL SHIFTS AT ST BRIDE’S Union. Neoclassical 16 soloistBerg,dancers from Roberts Georgia. Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 W Music by Purcell, Marcello, Mozart, Britten, Stravinsky, Kantcheli, ‘The best movement based programme tostrength be seenwithon the the best Fringe’in dance, The List. 1 and Anon. Continental Shifts goes from strength to Aug 10-12 13. 3 0 (15.45) £9.00 (£8.00) physical andblast visualoftheatre from nine countriesatworldwide. Prepare for an Houses ; Aug 15,16 14,17,1811.311.0 (12.45) 30 (12.45)£ 10.£9.00 (£8.00) electrifying international proportions St Bride’s and Springwell Aug 00 (£9.00) ★acrobats ■ ACROBAT Reared on ‘attention deficit culture’ these insanely skilled DEMARCO EUROPEAN ART FOUNDATION 00©3 i shamelessly rehash video clips, trashyslathered films and cultsensuality. bands. Mad malevolentwith momentum. Apocalyptic humour worship this breathtaking combination of STOMP,with Circus Oz and Come Leaping Venue 7330 22 - Demarco European Art Foundation, St Mary’s School,York Lane/Albany St Tickets 558Hlj .-jI Loonies. ■ FUTURE STAR’S MAGIC The Dance Theatre Impuls Aug 22.00(23.05) (23.05)£ 10.00 £9.00(£8.00) (£7.00) the Ukraine, presented by Olgadancing, andDANCING Vladimir Rozhok, returns to the Fringefrom with Aug 8-14,21,25 22,23,24 22.00 aa new show mixing ballroom extravagant costumes and rock’n’roll into' i rousing performance. BODIES ELECTRIC OOOO Aug 11-16 13.00 (14.15) £4.00 (£2.00) Venue 37 - George Square Theatre, George Square. Tickets 650 2001 (pre 6 Aug 651 1332 MI2 ★ ■ YOU ONLY MISS THE WATER WHEN THE WELL RUNS DRY 10am-5pm) Muzikansky presents a shortEastcafeofspace performance sink drama from South England. Supportedpiece. by A4E,Genre: Southfitted Eastkitchen Water s ■ BODIES ELECTRIC Allshowcase the waywith fromsizzling sunny performances California comes a the highand Tunbridge Wellsthe(19.15) Borough Council. voltage jazz and tap dance from Aug 11-16 19.00 Free (donations accepted) 25Augyoung members of this multi award winning company. ; 15,16 12.30 (13.30) £5.00 (£3.00) ★ ■ THE LOLLIPOP FOUNDATION ‘Blue Bikini’: Fourtofemales, indulging themselves in movies, experience transformations from shy bold, slobs to Followed by‘INtrigue INtoconstraints INfinity’: video installation fusing the fluidity i: [ BURKLYN YOUTH BALLET ©OOO stars. of the18-23 live body with(14.00) the static of modern technology. Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 Aug 13.00 £4.00 (£2.00) ★ ■ DOROTHY OF&OZ Dorothy & Friends danceof intheanRainbow.‘This exciting tale with ★ ■ LABYRINTH Butohusinginterprets the myth of the Lions, Dragons, Fairies Witches on the other side sound, silenceonKAGAMI andthemotion images from nature and labyrinth universal fllJm talented American Company’(Edinburgh Evening News Aug 1996) return to very charm through spiritual meditations Path... in the beginning... in the middle... at the end. audiences of all ages. Aug 18-23 17.30 (18.40) £5.00 (£3.00) :!, Aug 9-16 18.45 (19.45) £5.00 (£4.00) BOSNIAprize FUTURE Double billplaysof Bosnian artists:andDejan Ivanovic, classical winner in Rome, Bach, Pouce others; Samir Mehanovic CIRQUE DIESAL OO0O guitarist, his solo pieceon‘Vivus Figurae’. ‘Breathtaking resourcefulness of the j Venue 164 -Wango’s Big Top,The Meadows Ml I performs human18-23 spirit’ Scotland Sunday. Aug 23.00 (23.50) £5.00 ■show. CRASH POSITIONS! unmissable, dub, with funk, apunk, stunttwist. circus Aug 18-23 midnight (00.50) (£3.00) It’swillaction packed,comedy toe Seriously tapping, riband tickling circus peculiar Illusions confuse, amuse, stunts astound.With live music you Double-bill price for both shows on same night £8.00 (£4.00) definitely and visuals£7.50 that glow! Aug 14-23know19.00(21.00) (£5.00) NEED MORE INFORMATION ? RING THE FRINGE ON 0131-226 5257 or 5259 Kosh Kabaret in Presents

Gilded Balloon Productions

Three Point Turn starring The Strange Twins and Williams Europe’s greatest eccentric dancers Gilded Balloon at George Square Theatre 20-29 August Gilded Balloon Box Office 0131 226 2151 6;30pm George Square Theatre Box Office 0131 650 2001 34

Gilded Balloon Productions Presents WINNERS OF THE CRITICS CHOICE AWARD AND PERRIER NOMINEES |

George Square Theatre 9:30pm • 8-17 August Gilded Balloon Box Office 0131 226 2151 George Square Theatre Box Office 0131 650 2001


★ ■ PHANTARCH IN ALBA A song cycleandspiralling throughIf youeternity, in poetry, inspiration. in love in Scotland. dream tostory land,andcome and landFocused it here with us ...Presented by Miraclehave a Production. Aug 18-23 midnight (01.00) £5.00 (£3.00) ★Dimensione ■ NOTTURNO (CREPUSCOLO & RESURREZIONE) Gruppo Art & Candeloro Scena returnstarsto the Fringe with a and newrenewal, and acclaimed performance.Toni in a tale of death day andThenight. Choreographed by Anna Cuocolo.‘Athletic, graceful, technically adroit’ Scotsman. Aug 25-30 21.00 (22.00) £5.00 (£3.00) become an 'it'

DEVAYANI OO©© Venue 90 - Graffiti,Corner Broughton and East London Streets Tickets 557 8330 GI3 ■of LIKE A GODDESS BHARATA NATYAM DANCE Prima ballerina India performs this increasingly popular dance style. Devayani’s ‘Undisputed talent...Unprecedented mastery...Powerful the music and captivating make(£5.00) each showcommand a uniqueofexperience. Aug 25-30 stage 18.00presence’ (19.15) £6.00 ■ DEVADASI Devayani combines thedance best ofworkshops classical andsuitable contemporary i genres a series of Indo-Jazz for enthusiasts of all 18-21 agesto present interested in a unique and universal dance expression. Aug 14.30 (15.30) £4.00 (£3.00) DIAKONOS PHYSICAL THEATRE ©o©o Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 KI2 ★exposes ■ LAthe VIE3-dimensional SIMPLE Thisstates uniqueof and penetrative piece of physical theatre man mental, physical and spiritual exploring tensions from lack of harmony between the three. AAug paradoxical look resulting at human 9-18 15.30(16.15) £6.00existence...a (£4.00) revolutionary piece of physical theatre. FULL FIGURE THEATRE COMPANY Venue 117 -Viewforth Centre, 104 Gilmore Place Tickets 229 7659 M6 WUMPA ...AN ADVENTURE From the creators ofthelastadventure year’s FringeofTesse sellouts, WAY TOO BLONDE & THE‘F’WORD, comes who caught up crafted in a circus of black comedy. harmonies & myth creategets‘a beautifully & innovatively stagedAcrobatics, work’, Adelaide Advertiser, Australia Aug 7,9,12,14,16,18,20,22,25,27,29 18.00 (18.50) £6.00 (£4.00) Aug 8,11,13,15,19,21,23,26,28,30 19.00 (19.50) GANDINI JUGGLING PROJECT OO©© Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 K5 ■ SEPTET Ingenious combination of original juggling and dance brilliant, from award-winning Fringe favourites. Director Gill Clarke.‘Technically philosophically deep, visually captivating.’ impressive... The List ‘Takespoetry jugglingin motion.’ into new realms.’ The Guardian ‘Physically and aesthetically j v Aug The Independent 18-20,25-27 18.00 18.00 (19.10) (19.10) £7.00 £6.00 (£5.00) (£4.00) Aug 21-23,28,29 GILDED BALLOON Venue 36 - Gilded Balloon I , People’s Palace, Old Fishmarket Close Tickets 226 2151 ■ DE MOROCHAS, Y ABACANADAS story ! ofTango told through thePELANDRUNAS eyes ofthea woman Morocha).during It coverstheIs the amilitary history ofdictatorship Tango from itstheorigin, through years ofand(Laprohibition, to present day. Live music dancing. Aug 8-30 13.00 (14.00) £6.00 (£5.00) Venue 37 - George Square Theatre, George Square. Tickets 650 2001 (pre 6 Aug 651 1332 MI2 10am-5pm) ■Strange KOSHTwinsKABARET PRESENT THREE POINT TURN starring The and songs Williams, dancers.sound An evening offantastic exotica,Fuel.jagged and Europe’s fracturedgreatest dances, eccentric to the haunting of the Aug 20-29 18.30 (19.40) £8.00 (£6.00) INDIAN DANCE SOCIETY IN ASSOCIATION WITH ROMANSKA OOO© Venue 62 - Continental Shifts at St Bride's, 10 Orwell Terr Tickets 346 1405 K5 ★ ■ BEING AND BONDAGE challenging interplay of ballet, : • Bharatanatyam and multimedia with music of Holst & Villa-Lobos.‘Innocence Redeemed’; - inspiredcrossover by statuesque Georgian i' chants. ABILL. colourful finale ofdances virtuosoof Caucasus, footwork set andtoflashing turns. TRIPLE Aug 25-30 21.00 (22.30) £6.00 (£4.00)

t Portrait of a Lady: Sargent and Lady Agnew at the National Gallery of Scotland, The Mound, Edinburgh. 8 August - 19 October 1997. Admission £3, concessions £2. Monday - Saturday 10am - 5pm. Sunday 2 - 5pm. Opening hours extended during the Edinburgh Festival.

EXHIBITION SPONSORED OY OREAT NORTH EASTERN RAILWAY AND ORIENT-EXPRESS HOTELS 35


THE LABORATORY oo©< DANCC & PHySICAL THCATRC Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 ■explore PORTRAIT GAME by the faces writingsin this of Turgenev, threephysical characters of theirInspired hand(£4.00) drawn darkly comic piece. Aug 10-23the worlds 11.30 (12.30) £4.50 JAPAN EXPERIENCE OO©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 Venue 55 - Randolph Studio, Inst. Francais d’Ecosse, 13 Randolph Ores. Tix 225 5366 H8 ★ ■ WIRED A physical exploration... at the point where television and reality meet 10-14,18-21 - obsession lies.16.15 (17.10) £5.00 (£4.50) ■HerETOKO DANCEallCOMPANY in ‘SEITAIGO’, the ruinedovercome country’sthat witch.she Aug power terrified but she was filled with loneliness.To Aug 24-30 19.10 (20.00) £5.00 (£4.50) exerts more power and cruelty.‘No-one believes in me. I’m alive, covered in blood10-16 - in hell.19.10 ’ Seitaigo Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 Aug (20.10) £5.00 (£4.00) Aug 17-23 18.30 (19.30) ■Egyptian A MIDSUMMER NIGHTSFemale DREAM A Mermaids & Larger explored than Fyfe bonding & Metamorphosis, ■ tale EGIKU HANAYAGI -theCONTEMPORARY JAPANESE DANCES against a Dance hypnoticExtravaganza! musical backdrop. Afeathers ofand a crane, who, for love of the man who saved her, plucks her Aug 24-26,29,30 11.00 (13.40) £5.00 (£4.50) weaves him a robe. She gave and gave till she had nothing left toAuggive10-16 anymore. (15.20) £5.00 (£4.00) LUSTY JUVENTUS 00©0 Aug 17-23 15.14.1300 (16.00) Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 ■presented AKI SATO SOLO DANCE PERFORMANCE Seven solos of simplicity •kRoberts’ ■ CEREMONIAL KISSES Bodieshypocrisy fall, resistandandthevibrate in Christine by a wanderer who needs little more than her own considerable gifts new play about guilt, desire, Catholic Church.‘A to create the many small journey worlds shebegins. embodies’ New Vbrk Times,‘extremely risque, off-the-rubber-wall dance/theatre spectacular’ Ian Shuttleworth, Financial graceful...’ Downtown.The Times.15,16,18-23 Aug 24,26,28,30 11.30 (12.30) £5.00 (£4.00) Aug 21.10 (22.25) £5.50 (£3.50) ■MORISHIGE BUTOH DANCE BY ‘It’s IMREtheTHORMAN WITH YASUMUNE (CELLO) body that counts with its amateurish-simple feelings, which I takehonour’...shockingly utmost seriously.Thebeautiful. body whose flesh I don’t deny, on the contrary, Aug 24-30I do19.it3all0 (20.30) £5.00 (£4.00) KRONIS & ALGER (USA) OO©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 H10 CREDIT CARD SALES ★yourself ■ CORNOGRAPHY Break the language barrier, crack smiles, and nourish RING 0131-226 5138 (10 lines) with American CORN. Advertising, travel, and cloning are dealt a Open 10am-6pm satirical blow through touching tales of relationships via Physical 9am-9pm (during (June August)Et July) It’s a personal an impersonal world. Theatre. Aug 10-30 (notstruggle 17) 18.to00communicate (18.50) £6.00in(£4.00 iP "^"APAN

36

EXPERIENCE


MAMELODI THEATRE ORGANISATION 00©0 Venue 143 - out of the blue,The Bongo Club, 14 New Street (off Royal Mile) Tickets 558 7604 J14 ■withMALOPO AFRICAN DANCE & POETRY A sangoma way of connecting Poetry,Highdance, drumming and songs presented nationstheofuniverse. South Africa. energy dancesong. from Zulu, asSotho, Xhosa byandthe inspirational and educational poetry and Aug 10-23 19.30 (20.30) £5.00 (£4.00) MARIA CARDONA DANCE (SPAIN) OO©© Venue Shifts at Springwell House.Ardmillan Terrace, off Gorgie Rd. Tickets32346- Continental 1405 (St Brides) 13 ■Cardona MARIAbrings CARDONA DANCE (SPAIN) Big success at 1996 Fringe, Maria new powerful programme contemporary dance, performed M with passionate abeauty and fire.hands’ Live virtuosoofguitarist.‘Cardona conjures witty statements dancers’ Aug 18-23 with 19.45her(20.40) £5.00 (£3.00)The Scotsman. Don’t miss. Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 K5 ■Cardona MARIAbrings CARDONA DANCE (SPAIN)ofBigcontemporary success at 1996 Fringe, Maria a new powerful programme dance, performed with passionate beauty and fire.hands’ Live virtuoso guitarist.‘Cardona conjures witty statements dancers’ Aug 25-30 with 19.45her(20.40) £5.00 (£3.00)The Scotsman. Don’t miss. MOMENTARY FUSION OO©© Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 KS ■highSTUNG Startlingly high-powered anti-gravity dance theatre, performed on ropes withinextreme athletic drive, live drummingIndependent and original soundscapes. ‘stars...packing thousands’ Telegraph,‘Riveting’ ‘Refreshing originality. Not16.00 toDaily be(17.05) missed.****’ Sunday Express. on Sunday, Aug 11 -13,18-20,25-27 £6.00 (£4.00) Aug 14-16,21-23,28-30 16.00 (17.05) £7.00 (£5.00) NND NGARINDJERI - NARUNGGA DREAMING O Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 K5 ★styles■ NUKANYA DREAMING Depicts the traditional Australian Aboriginal of song, music and dance.The content of the performance has an effective and exciting formula, that allowsandtheFuture. audience to journey through three phases of Aboriginality: Aug I 1-23 (notPast, 17) Present 21.30 (22.45) £6.00 (£4.00) PIA FRAUSTHEATRE COMPANY oo©o Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 ★by ■theFLOR DE OBESESSAO Obsession! The weird side of mankind aswithseen playwright Nelson Rodrigues. Three Men, life. withNoandtext. without masks, dolls and figures, perform the ritual of everyday Pure physical theatre in 5014.00 minutes. Aug 18-23 (14.50) £5.00 (£3.00)

DANCe & PHYSICAL TH8ATRC Venue Shifts at Springwell House.ArdmillanTerrace, off Gorgie Rd. Tickets32346- Continental 1405 (St Brides) L3 ★More■ DEPARTED SOUL Simple version (re-made to be fitwillforseesmaller stage). physical! Showing the disabled bodies eloquently.You their distorted bodies and movements,‘normally’ regarded as ungainly, transformed into a18,19,21,22 compelling beauty. Aug 16.00 (17.00) £5.00 (£3.00) WILL GAINES - JAZZ HOOFER ©O©© Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 G13 ■unique, WILLinventive, GAINESdelightful, - JAZZfast,HOOFER Extraordinary America tap dancer furious, charming, humorous,guest slow, lyrical marvellous varietyJack- always a celebration EdEngland. CrowSurprises! - USA. Duff. Lindsay Cooperof-life.Various Edinburgh. top Charlotte musicians. Glasson Aug 7-30 (not Mons) 17.45 (19.00) £5.50 (£4.00) ZENDO MARTIAL ART SHOW 00©0 Venue 48 - Bennington Resource Centre,200 Bennington Road Cl6 ★2nd■Fringe WAR!presenting‘War!’. - WHAT IS IT Zendo GOODperforms FOR? Martial arts and music(thecombine for action fromWWI Angel of Mons);WW2 pilot);Vietnam (the End); Northern Ireland (Belfast Child). Good 17.00 car(kamikaze parking, minutes Aug 19-21 (18.30) 10£4.00 (£2.00)walk from centre. PG required. Strobe used. DIY DIARIES use the Fringe web site to create your own daily timetable http://www.edfringe.com

SCOTTISH-AMERICAN BALLET ©ooo Venue Square6 Aug Theatre, Square.-5pm) Tickets37650- George 2001 (pre 651 George 1332 10am _ SCOTTISH-AMERICAN BALLETballet. A dyExnamic ofALEXANDER young American !]■■ dancers presents classical and modern Royalgroup BalletFOKINE’S BENNETT guests in COPPELIA ACT I with excerpts from CARNAVAL and new work by BENJAMIN HOUK to songs of ROY ORBISON i featuring (JULIE GUTTAS). Aug 9-14SPRINGFIELD 20.15 (21.20) BALLET £6.50 (£5.00) SHAKTI i Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 G13 ■ SHAKTI IN TIBETAN BOOK OF THE DEAD Passage from death to || oblivious life,‘Blue death’ = paradise.‘Red death’battlefield = infernoof and rebirth.‘She writhes in voluptuousness acrossmovement’ the displaying ; aAugprowess in22.00 pure(23.00) eroticised What’s-On,pornography London. Sell and out art94,95,96. 8-14 £6.00 (£5.00) Aug 15-30 22.00 (23.00) £7.00 (£6.00) STRICTLY SCOTTISH OOOO Venue 111 - St Andrew’s & St George’s Church, 13 George Street. Tickets 225 3847 H11 STRICTLY SCOTTISH Elegant and lively Scottish Country dancing, fine 'sspectacle, inging andirresistible witty versemusic’,‘an in a beautiful Adam setting.‘highly polished, splendid air of happy conviviality’, 5-star Scotsman 1995 and£6.00 1996.infectious Aug 10-16reviews, 19.30 (21.30) (£5.00) TAIHEN (JAPAN) 00©0 Yenue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 K5 ★ ■ DEPARTED SOUL The amusement of life is an offering to the invisible. J;r electrifying’ Six disabled performance performers play around with this concept.Their‘absolutely ‘challenge and disturb its audience, questioning our definitions art will of£5.00 movement’ Aug 11-16 11.of00 the (12.00) (£3.00) The Stage. 37


MUSIC ABRACADABARETS 00©0 Venue 195 - Royal College of Physicians, 9 Queen Street H11 ■NewGERARD KENNY AND ABRACADABARETS AT THE COLLEGE York hits the New Town as stunning pianoman Gerard Kenny, composer of worldwide hits andNimmo Ivor Novell© awardandwinner, Jim for songs laughter.joins hilarious Fringe veterans AugDrife 16-20and19.Walter 30 (21.00) £10.00

'Hsongs ugely and entertaining stories" Evening Newsjjjjj^. || i

ABSOLUTE BLUES AND MORE OO©© Venue 9 -Iron Ceilidh House,9 Hunter Square, High St.Tickets 220 1550 KI2 ■bluesman ABSOLUTE BLUES AND MORE Tam White Europe’s foremost celtic returns to the Tron cellar bar with the celebrated Shoestring Band for to be one£6.00more non-stop-no-holds-barred Blues Blues Blues. Augwhat 17-24promises 22.30 (00.15) (£5.00) ALBORADA PRODUCTIONS ®0@© Venue 47 -The Cafe Royal, l7West Register Street Tickets 556 2549 112 ■Fringe ECLECTIC GUITAR WITH JONATHAN PRAG :’..enchanting’ Buxton Newsa 1996 classical acoustic guitarSorsounds from a Piazzola man whoandloves hisPlanxty music., delight’‘sweet Thefeast Scotsman 1996:lovers. mixing and Samba, guaranteed guitar Aug 9-30in a14.00(14.55) £5.00for(£4.00) ANGELIC VOICES 00©0 Venue 126 - C cubed, St John’s Hall, West End Princes Street Tickets 225 5105 19 ★International ■ MACBETH - SHAKESPEARE’S TEXTSegal & VERDI’S MUSIC Jonathan dramatic soprano Marie Hayward and bass baritone Finney joinandforces for World a crescendo of treachery, murderfusion and ofrevenge; blood, thunder lightning. premiere of this unique great theatre and Augmagnificent 17-23 15.4opera. 5 (17.15) £5.00 (£4.00) ■Hayward COMESegal ON returns EVERYBODY, ThisLastenergetic workshop withwere Marie by popularandSING! demand. year’sRussia masterclasses acclaimed **** by the Scotman beamed across to millions of For beginners and the experienced alike, from 4 years old to 100! viewers. Aug 18-23 11.15(12.15) £4.50 (£3.50) ANTONIO FORCIONE & NEIL STACEY OO©© Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 GI3 ■improvisers, ACOUSTIC MANIA This is anEurope’s leading guitarandduo.exotic Fast sound and furious they have developed exciting, powerful full of humour with Jazz. its roots in jazz, classical, Brazilian and flamenco.‘A union made in heaven’13-17 String Aug 20.30 (21.30)£6.00£7.00(£5.00) (£6.00) Aug 16 14.30 (15.30) ■unsurpassed ANTONIOdynamism FORCIONE TRIO A world class and guitarspectacular led trio oftechnique. with melodies With the renowned Edlevel.‘Astonishing Jonesmesmerising on sax andmusical Davide Mantovani on bass. Inspiring music at the highest personality’ Audiophile. Aug 19-22 20.30 (21.30) £6.00 £7.00 (£5.00) (£6.00) Aug 23,24 14.30 (15.30)

'A gem in the heart of The theScotsman Fringe" "Wonderful madness" The Stage 'Majesty and wit ... adventurous musicianship" "Weird and wonderful music" STVTime Out

APU - DANCING WITH THE INCA OO©© Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 G13 ■innovative APU - Andean DANCING WITH THE INCA Simply the best and most band around. Powerful and exciting mix of traditional/modern compositions combine breathtaking pipe &&flute skills over searing Latin American rhythms inspiring Aug 14-17,21-24 18.producing 00 (19.45)an £6.00 (£5.00)hauntingly beautiful experience. PAOLO ARAGONA OOO© Venue 31 - St Cecilia’s Hall, cnr Niddry Street & Cowgate. Tickets 650 2805 Kl 3 ■Tedesco, PAOLOBrouwer ARAGONA Guitar plays: Carlevaro,Villa Lobos, CastelnuovoBarrios, Piazzolla.This concert is designed to traverse modern and contemporary guitar musicinofEdinburgh. the twentieth century. With the support Aug 25,27of the15.0Italian 0 (16.00)Cultural £4.00Institute (£3.00) HELP & INFORMATION RING THE FRINGE(June ON 0131-226 Open 10am-6pm ft July) 5257 or 5259 and 10am-7pm (during August) 38

with RAINER HERSCH Assembly Rooms 0131 2262428 8th-30th August - 4pm “not since Victor Borge has a musician-comic raised the roof with such continuous laughter” The Sunday Post


MUSIC

Presents

MUflC On The

FRJNCe Thursdays, Fridays, Saturdays & Sundays will offer an escape into musical pleasure on Edinburgh's Glorious Meadows look out for a full programme of our Big Top presentations in The Festival listings for each weekend of The Fringe

OR CALL 0181 963 0940 for further information

ARBOREA MUSICA AND FRIENDS OO©© Venue 127 - St John’s Church, West End, Princes Street 19 ■ensemble ARBOREA MUSIC AND FRIENDS The acclaimed period instrument makes a welcome return to the Fringe with three excitingly contrasted programmes.‘A sensitive and dynamic’ Scotsmon. Winners of the Radio Forthbalance Award.of5 colour times Scotsman ‘Pick The of the day’. ■oboes MASTERS OF THE CONCERTO TheVivaldi, contrasting sonorities of flute, and recorders, in virtuoso works by Telemann and Corelli; also Bach’s masterpiece for solo harpsichord, the Italian Concerto.‘Breathtaking’ The Scotsman. Aug 11-15 17.30 (18.30) £6.00 (£4.00) ■pleasLOKI - CRUDELTIRANNO AMOR A lover’sCantatas impassioned set and toENSEMBLE Handel’s ravishing music(recorder, - an unbeatable combination! for soprano obbligato instruments oboe, harpsichord) sung byTheHeidi Pegler, plus some instrumental favourites. ‘Sense of partnership and joy’ Scotsman Aug 18-20,22 17.30 (18.30) £6.00 (£4.00) ■ the HIS300th MAJESTY COMMANDS yourMusikmeister presence atHerr a concert in featuring celebration ofworks birthday of his illustrious Quantz:Frederik by the Bachs,Telemann, Quantz and His Majesty Himself, the Great of Prussia. Aug 25-29 17.30 (18.30) £6.00 (£4.00) ASSEMBLY ROOMS ©O©© suf Venue 3-Assembly Rooms, 54 George Street. Tickets 226 2428 III ■Scotland. MIKA Sensationally New Zealand’sentertaining, master of flamboyant, cabaret performs for theandfirstglitzy,time ever in glamorous irrepressibly drop dead gorgeous to boot.Touring with him are brimming his UhuRa’s,withtheenergy Maoriandequivalent of Bette Midler’s Harlettes. Aug Aug 8-14,17-21,25-30 15,16,22-24 23.50 23.50 (01.15)(01.15) £9.00 £8.00 (£8.00)(£7.00) ■spoken RAYword.There DAVIES:THE STORYTELLER Chroniclesrun-ins his lifewith in songs and are anecdotes aplenty, including the Beatles, American gangsters, managers and groupies. ‘Unplugged and unmissable’ Daily Telegraph. Aug 17-21,25-30 23.45 (01.15) Aug 22-24 23.45 (01.15) £ 12.50 £(£11.00 10.00)(£9.00) ■ CLUB LATINOexponents AND ‘SONORA LA CALLE’ Cuba, the award-winning of Cuban salsa perform atFromClubSantiago Latino deand also during the week. Their exuberant style provokes a rhythmic eruption that does not soOffice muchforinvite as command you to dance! Line up varies - call Assembly Box details. Aug 8,29,30 midnight (03.30) £5.00 (£4.00) Aug 915,16,24 midnightmidnight (03.30) (03.30) £4.00 (£3.00) Aug £8.00£7.00 (£6.00) Aug 17-21,25-28 midnight (£5.00) Aug 22,23 midnight (03.30) (03.30) £9.00 (£7.00) ■of STEVE HARLEY After a major tour of the UK to accompany release a newtoalbum, 70s cult - Cockney Rebel,favourites oncetheagain returns the stage withsuccess a mixture- whisper of new itsongs and a few from older albums. Aug (21.35)£ 10.£9.00 (£8.00) Aug 25-30 24 20.2520.25(21.35) 00 (£9.00) ■manyPAUL BRADY: SOLO IN CONCERT songs been coveredthatby he artists ofWith international toHishisfeelings first have love, performing, always returns. real songsrepute, born butoutitofis real and sung with a passion few singers can match. Aug 15,16 23.45 (01.15) £ 11.00 (£ 10.00) ■Connections SHARONFestival, SHANNON After a storming success at the Sharon’s Celtic the ex-Waterboy universal and song.breadth She supplies the music imagination. andtakesthethelyricsstageareagain. limited only byis thea strength of the listener’s Aug 8,9 23.45 (01.15) £ 10.00 (£9.00) ■operetta OPERAstaged CIRCUS - SHAMELESS! directed by Brecht David Glass.‘a bawdy withirreverently consummate skill’ Independent. stories, Grosz’s imagery and opera reworked in this saucy satire that has seduced audiences to Lithuania.‘It’s Aug 26-28from17.0Lima 0 (18.00) £8.50 (£7.50)just absolutely brilliant’ BBC Radio Scotland ■directed OPERAby David CIRCUS - KINGabsolute STAGtriumph.’ The second of two Edward stunningScissorhands shows Glass.‘An The Herald. meets theAddams familya total in thistheatre unforgettable, screwball tale.‘This inspired company have created experience... be there.* Aug 29,30 16.40 (18.25) £9.50 (£8.50) ■ JOBURG Drumand‘n’ dancers bass meets South marimba streets jive in of Joburg Streets.STREETS musicians play African marimbas Johannesburg andFour Cape Town are joining withwhoBritish musicians inandthea techno DJ toAugreinvent the club mix, live. 8-14,17-21,25-30 23.30 (01.00) £7.50 (£6.50) Aug 15,16,22-24 23.30 (01.00) £8.50 (£7.50) ASSEMBLY ROOMS continues on next page 39


ASSEMBLY ROOMS continued ■ LOYKOTHE RUSSIAN BAND Twoeverywhere! violins, one ‘Ifguitar, three voices thatthen amazes andGYPSY enchants audiences hitting -themusic floor, theyyou’re were shouting encouragement at some ofjawstheweren’t most astonishing musicianship likely to hear’ Scotland on Sunday Aug 15-19 22.00 (23.05) £8.00 (£6.00) AZABACHE: CUADRO FLAMENCO DE DIEGO ®0©© MORA BOOTHBY Venue 90 - Graffiti,Corner Broughton and East London Streets Tickets 557 8330 GI3 it ■ FLAMENCO PURO GypsyLastguitarist Diego Mora’s latestunique groupatmosphere featuring Andalucian dancer Tote Conte. year’s sellout set in the ofseductive Cafe Graffiti.‘Demands surrender to your senses... a compelling | display’ The List.19.you Aug 8-30 (not 11,18) 15 (20.30) £6.00 (£5.00) Aug 16,17,23,24 16.00 (17.15) GRAFFOE BATTLEFIELD BAND oo©o Venue 72 - Queen’s Hall, Clerk Street. Tickets 668 2019 NI3 Revelation: 22 Mark: 13 ■unique BATTLEFIELD BANDScottish IN CONCERT World and travellers playing their blend of traditional music on ancient modern instruments. Verse 20 Verses 1 - 2 Amusic, rare generously opportunityandto joyously see them on their home ground.‘inspired, invigorating Aug 17,18 20.00 (22.00) £8.50performed’ (£6.50) Adelaide Advertiser. BBC RADIO SCOTLAND 00©0 1 Venue 57 - BBC Scotland, Studio One, 5 Queen Street. H11 j [ ■features MR ANDERSON’S FINE TUNES This popular, award-winning show a live and unique blend of classical and Celtic music highlighting the best of19-21 the festival. Aug 14.00 (16.00) Free ■BrianBRIAN KAY’S aSUNDAY MORNING Radio 3’s award-winning presenter Kay presents liveFestival editionmusicians. of his popular Sunday complete with visiting Admission free,morning nopapers! ticketsprogramme needed. Come and go as you please. Free BBC coffee! Free Sunday Aug 17 09.00(12.15) Free JANE BOM-BANE (DO©© Venue 90 - Graffiti,Corner Broughton and East London Streets Tickets 557 8330 GI3 ■andJANE BOM-BANE returns in her irridescent underwonderworld of. andhats harmoniums, sea-songs, rum-rhymes, watery scales and fishy tales . other surprises (featured*****’ on Edinburgh Nights and BBC off-beat’ Radio 1996).‘Gloriously eccentric. Unmissable Evening News,‘Blisteringly Daily Telegraph, ‘Bom-shell!’ Scotsman. Aug 6-30 16.00 (17.00) £5.00 (£2.50) CAFE GRAFFITI ©O©© Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 G13 ! CLUB GRAFFITI Complete with exotic barbeque garden and tropical interiorhours we provide a delightful late bars, nightwild rendezvous forandalldancing! ages and tastes. Three of live and DJ’d music, romance Aug (03.00)(£5.00) £5.00 (£4.00) Aug 3,5-7,10,12-14,17,19-21,24-28 1,2,8,9,15,16,22,29,30 midnight midnight (03.00) £6.00 GRAND GRAFFITI lavish four celestialandDream celebrations. Wild around. music,Nine spectacle, magichourromance dancingPalace toeveryone. the best dance bands Civilised, eccentric, unforgettable...for Aug 8,9,15,16,29,30 23.15 (03.00) £8.00 (£7.00) Aug 21,22,24 23.15 (03.00) £ 10.00 (£8.00) AVALON PROMOTIONS PRESENTS

Timothy: 3 Verse 1

Hebrews: 13 Verse 25

10% Discount For Nuns

40

CALEDONIAN BREWERY ©O©© Venue 183 - Caledonian Brewery, 42 Slateford Road M2 j ■brewing CALEDONIAN BEER FESTIVAL The only brewery using traditional will befrom ableScottish to tasteceilidh all our cask ales. Every evening there willtechniques.You be great live music, Aug 8-10,15-17,22-24,29,30 11.00(23.00) £3.00 to great jazz and blues. CALEDONIAN FOLK AT THE GUILDFORD 00©0 Venue 107 - Guildford Arms, I West Register St(off East End Princes St) Tix 556 4312 112 ■hosted Famous ales from Edinburgh’s unique Caledonian Brewery great music by top local acoustic band YARDandOFLyle.Ten ALE withnights songsail from the Dubliners, Garfunkel to Gallagher free. Dylan to ■bluegrass SCALDED CATS Talented duo from the Kingdom of Fife. speed banjo - cajun fiddle and accordion. Weel Kent songs - High and much more!! Aug 14,22 20.00 (midnight) Free ■Stuart TANDEM Traditional and contemporary folkthrough duo Derek provide a rich toandtheir diverse sound ranging theirRichardson adaptation and of Pat slow airs and ballads fast, exciting jigs and reels. Multi-instrumental. Aug 15 20.00 (midnight) Free ■ WAYKIS That‘condor’ - experience enchanting Andean music. Tap dance - moment Peru Augfeet, 16,21move20.00hips,(midnight) Free is here!


■ MIKEWHELLANS from byhis blues Danishfans,domicile, Scots borderer Whellans is definitely notOntoFounder betourmissed guitar of wild wailing harmonicas. member of Boys of thefreaks Loughand and lovers Vindscreen Vipers Skiffle Band. Aug 17,23 20.00 (midnight) Free ■songs STEPHEN CARROLL from Ireland - old and new with a20.00 Celtic flavour andSinger/SongWriter Aug 18,20 (midnight) Freea touch of the Blarney - a real entertainer! ■duo,HOLYROOD SLIMdrawn AND from GUITAR JUNIOR Edinburgh'sandpopular blues playJames.The acoustic blues the likes of Broonzy,Terry McGhee, Elmore songs range from waaaay-back to self-penned 1990s blues with and evocative Aug harmonica 19 20.00 (midnight) Free electric slide-guitar. CHRYSALIS 00©0 Venue 91 - St Mary’s Cathedral, Palmerston Race J7 ■Christian CHRYSALIS THE CATHEDRAL CONCERT Scotland’s finest band in music concertandin stunning Edinburgh’s magnificent cathedral. Chrysalis’ Celtic-influenced Chrysalis are also at 01835 historic823763). Melrosevisuals Abbey combine on Augustin 16a wonderful experience. (information/tickets: Aug 23 20.00 (22.00) £4.00 (£2.00) THE CLARSACH (SCOTTISH HARP) SOCIETYOO©© Venue 111 - St Andrew’s & St George’s Church, 13 George Street. Tickets 225 3847 H11 ■HarpFESTIVAL CEILIDH An evening ofsupporting delights featuring Scotland’s unique Orchestra na Clarsairean plus a programme of their guests. Tempting toe-tapping music and audience participation but alas no room to dance. Aug 18 19.00 (22.00) £7.00 (£6.00) ■Featuring CALLUNA Scottishondance tunes,vocals, originalCharlotte compositions and onGaelic song. AnnaStevenson Murray clarsach, Anna-Wendy onpipes fiddleandandand Rebecca Knorr onPetersen flute.‘a lovely, evocative balance between wildness containment’ The Scotsman. Aug 19 19.30 (21.30) £6.00 (£5.00) ■ CATRIONA MCKAY (CLARSACH) AND CHRIS (FIDDLE) Top youngtoScottish musicians indistinctive perfect partnership combineSTOUT individual virtuosity create their own style of traditional music. They have delighted audiences Aug 20 19.30 (21.30)from£6.00Shetland (£5.00)to Seattle with fiery reels and icy airs.

MUSIC ■ WENDY AND THE LOST BOYSWendy UsingStewart, traditionalGaryharp, guitar, concertina, & keyboard, Westsmall andpipes, Colin Matheson presentwhistle anas interesting programme of Gaelicsort. and Scots songs which could be described ‘Chamber Folk’ of the highest Aug 21 19.30 (21.30) £6.00 (£5.00) ■another FIDDLE,their HARP ANDprogrammes VOICE Isobel Jim Fergusonsongs, return with popular of firstMieras classandScottish haunting oflaments andtunes.stirring Jacobite tales mingled with greatmusic: fiddle musicstories, and toe-tapping dance Aug 22 19.30 (21.30) £6.00 (£5.00) Venue 185 - The Magdalen Chapel, 41 Cowgate Info 220 1450 Kll ■programme ISOBEL ofMIERAS presents‘Big Ballads and Small Songs’. An entertaining mainly Scottish great Scottish nursery rhymes,forlullabies, songs Burnsmusic and featuring his contemporaries and ballads, 20th century music voice.by £6.00 Aug 13,15harp20.00and(21.45) (£5.00) ■Rosemary A SCOTS MEASURE the setting ofprogramme the MagdalenforChapel, McKerchar andSongs IanIn and Inglishistoric presentfrom a lively recorders and clarsach. dances the Scottish court andvoice, traditional music from Shetlands to the Borders. Aug 14,16 20.00 (21.45) £6.00 (£5.00) ■andAPaolo MUSICAL TOURAAROUND Cristina Blarzino (harp) Italy, Caleffi duo withthrough a EUROPE classical background presents anations. musical(flute). tour, travelling five centuries of from musicalModena, history and four Aug 25 20.00 (21.45) £6.00 (£5.00) CUBA LIBREBENEFIT SCOTTISH CUBA DEFENCE oooo CAMPAIGN Venue 26 - The Palladium, Broughton Place Tickets 557 2100 (557 6969 pre August) G14 ■ CUBA LIBRE AT- a THE PALLADIUM - a Club Cubana special. Forget the commercialism spectacular lastsurprises night out fortheinternational solidarity and celebration. First mucho Latino with best comedy names onAugthe31 Fringe, to Cuba’s SONORA LA CALLE. 22.00 then (00.30)salsa£ 10.in 0style 0 (£8.00) JOHim

emeus as seenX-FlLESj on the 1 THE FRINGE WASTER RETURNS

Margarita J/acatan

Tickets £3.50 (£b STARTS FWOAVI AUGUST

CLf ..W|rn V£ JAMES j ^2°*L2*rir”

PALLHHD1UM 1

Sl

return o» »«• THEHtRAl0 PM MONDAY f Tickets £T0 (£8)AT 7t !

* acts for the price of one

fill be regular )’gomg , Night’ live from the best nuc-ail thats missing »s the best audience. TICKETS FROM i FRINGE BOX OFFICE 0131 226 5138 For details and T0CTA FREE tickets 1 HOTLINE 0131 557CREDIT 6969CARO (10-6 MON-SAT) VIRGIN & RIPPING call 0131 557 2100 1 VENUE BOX OFFICE 0131 / (DURING FRINGE) 557 2100 THE PALLADIUM IS A ©HBOUmR MUSIC VENTURE


Ml/S/C

5 SHOWS ONLY!!

DAVID A HALL WHITBURN BAND OOOO Venue 8 - Reid Concert Hall, Bristo Square LI I ■of ABrass’ FESTIVAL OFguests, BRASSJames DavidGourlay A Hall (tuba) Whitburn Band present‘A Festival with special and Angela Whelan (trumpet) insupported associationby Yamaha with Punter Southall Musicand(UK)Co.Ltd.(Consulting Actuaries) and Aug IS 19.30 (21.45) Kemble £8.00 (£6.00) DOM FESTIVAL OF ART, MUSIC AND ANIMATION OO0© Venue IS2 - Augustine United Church, George IV Bridge Tickets 226 7246 Kl I ■fitting THEatmosphere DOM CONCERTS Sculpture, glassworks and paintings create aof for many works of eternal beauty, performed by some Europe’s finest classical musicians. Recitals also during workshops homeless. Scotland.day. Proceeds to craft Aug 11-30 for (nottheSuns) 20.00 Details: (21.15) Big£5.50Issue, (£2.50) EDINBURGH ACTING SCHOOL OOOO Venue 177 - YMCA, 73 Ferry Road BI7 ■nostalgic GROOVY GENERATIONS Thein songs, hip-swinging, flare-shaking, fast-paced revue of the 60’s and 70’s dances and sketches is back, bigger, brighter11 -13and 19.00 funkier(21.15) than ever.‘...highly Aug £5.50 (£4.50) enjoyable’ Scotsman ‘96 - four star rating. Aug 14-16 22.00(23.15)

l (f

!

EDINBURGH FESTIVAL OF YOUTH CHAMBEROOO© CHOIRS Venue 140 - Stockbridge Parish Church, 7B Saxe Coburg Street Info 332 0122 EI0 ■ CHAMBER MUSIC CONCERTS SUNG BY YOUNGof young PEOPLE This new festival brings together the voices and enthusiasm choirs with the expertiseexcellent of MusicalmusicDirector, Ben Parryforin all.the elegance of Stockbridge Church, and enjoyment Aug 25-30creating 19.10 (21.15) £5.00 (£4.00) EDINBURGH RENAISSANCE BAND OO0O Venue 31 - St Cecilia’s Hall, cnr Niddry Street & Cowgate. Tickets 650 2805 K13 ■andCASTLE TO COWGATE A spirited and spectacular pageant of medieval renaissance music and dance from court and closes of historic Edinburgh. Performed bydance the group City’s Renaissance Band, the Edinburgh Early dancers and the English Aug 15,16 20.00 (22.00)Polyhymnia. £6.00 (£4.50) Aug 16 10. 3 0 (12.30) Aug 23 19.00 (21.00) EDINBURGH ROYAL CHORAL UNION OOOO Venue 122 - St Cuthbert’s Parish Church, 5 Lothian Road J9 ■Mystical CHORAL CONCERT Performances of Missa Brevis (Kodaly) and Five Songs (Vaughan Williams) featuring Ivor Klayman (Baritone) conducted by John10 Grundy together£5.00with(£4.00 organSUOD) music (£2.50 playedC)by Morley Whitehead. Aug 18.00 (19.00) EX COLLEGIO CANTABRIGIENSI OOOO Venue 131 - Greyfriars Kirk,Greyfriars Place,Candlemaker Row.Tickets 225 1900 Kl I ■scholars CHORAL MASTERPIECES OF FIVE CENTURIES Forty choral of Cambridge University perform some of the most sublime music from of theClimax last fiveincludes centuries. Rare opportunity to hear Tallis’ 40 part ‘Spem16each in Alium’. Aug 20.30 (22.00) £5.00 (£2.50)Barber’s ‘Agnus Dei’.

EDINBURGH INTERNATIONAL FESTIVAL CRITICS COMEDY AWARD

THE FABULOUS FOURMEL’DYHIDES ©0©0 Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 K10 ■STYLE AMERICA’S GOLDEN AGE OF ROCK’N’ROLL A CAPPELLA American hits of the 50’s and 60’s performed ‘street corner’ style in a‘Boardwalk’,‘Unchained rich blend of harmony & rhythmandincluding‘Blue Moon’,‘At the Hop’, Aug 8-22 22.30 (23.30) Melody’ £6.00 (£5.00)many more.

THU21-MON25 AUGUST

“Comedy of the highest order... inspired ramblings” INDEPENDENT “He’s clean, charming and above all funny” TIm,s “Jimeoin is a crack artist With Wings” SCOTSMAN

QUEENS HALL 22 & SATFOR23 DEAF SHOWSPEOPLE WILL rM BEFRISIGNED <iP 10pm FRINGE BOX OFFICE I VENUE BOX OFFICE 226 51381668 2019

42


MUSIC + THE MERRY URIAHS If RURKIRG

DIRECT FROM A SELL-OUT LONDON SEASON

“1997\s ^ CULTEST1 CABARET LOUNGE” THE SUNDAY TIMES D.inrinpi ’tii late Venues? 18-25 AUG BECK'S FAMOUS : '' SPIEGELTENT 0131 226 5138 0131 558 8010 (Augo*i>

THE FAMOUS GROUSE HOUSE - SCOTTISH INTERNATIONAL PRESENTS Venue 34 - The Famous Grouse House, S Chambers St Tickets 220 5606 KEEP toIT put UP!realGroup of exceptionally young musicians with a■Augmission Scottish music on thetalented global stage 9 19.30(21.15) £7.00 (£5.00) ■ DEAF Talented band who set thebodhran musical and spiritstunning of Scotland aglow withSHEPHERD pipes,(23.30) whistles,£7.00 fiddles, guitar, bouzouki, vocals. Aug 9,16 21.45 (£5.00) ■latest SALSA VIVA High quality Latin music from old classics to the hottest and releases salsa, cumbia, merengue and mucho mas! Aug 9,10 23.30in (03.00) £5.00 (£4.00) ■(Hamish ELLAMacBeth) FITZERALD ATRIBUTE ‘Big Bandnumbers; Sound’favourites with LaurasuchKelman singingFace Ella’sthemost popular ‘AAn Fine Romance’,‘Lets Music and Dance’,‘The Lady is a Tramp’.as experience not to be missed.. Aug 9,10,13-17,20-24,27-30 00.15 (01.15) £7.00 (£5.00) ■Groove LORNA BROOKS 1997 sees the release of Lorna’s debut album Kowtow. songs, with Aug 10 based 19.30(21.15) £7.00comparisons (£5.00) being made to Sheryl Crow. ■organ DONALD BLACK ANDfull MALCOLM JONES Donald’s unique Malcolm mouth playinghimdraws on the spectrum of Scotland’s music. Runrig’s Jones joins on guitar and accordian. Aug 10 21.45 (23.30) £6.00 (£4.00) ■Folk’THEScotsman. CASTEngaging, ‘Mairi Campbell’s voice is one of the great sounds of Scottish intimate Aug II 19.30(21.15) £7.00 (£5.00)and atmospheric. ■ DAVEsings WHITE ANDwitty DONNY Waiting to be wise founder the warm, lyrics ofO’ROURKE one of Scotland’s foremost poets.Ceolbeg Beguiling! Aug 11 21.45 (23.30) £6.00 (£4.00) ■Classical IAN CARR (PIANO-ACCORDIAN) brilliance(GUITAR) combined &withKAREN off theTWEED wall arrangements of the finest tunes. Wonderful! Aug 13 19.30(21.15) £7.00 (£5.00) ■ ANAM distinctiveandcontemporary Celtic folk, forging a link between the past and passion’ Augpresent.‘Energy 13 21.45 (23.30) £7.00 (£5.00)Irish Post ■Sheena THEWellington FOLK DIVAS 1995Henderson Celtic Connections and Ingrid (clarsach)Winners, tantalise Ishbel with anMacAskill, internationally Aug 14,17 19.30acclaimed (21.15) celebration £7.00 (£5.00)of Scotland’s music. ■ballads, TANmouth NAS Back a newdance line-up,to.based on Gaelic music, passionate music,withtunes Aug 14 21.45 (23.30) £7.00to(£5.00) ■unique MYSTERY ‘Edinburgh’s grubbytunes. edged cool.’ Creating aAug blend JUICE of (01.30) hip-hop, blues(£5.00) andambassadors home-grownoffiddle 14 midnight £7.00 ■ WHOSE SOLO IS ITmusicians ANYWAY? Ridiculousandmusical challenges... the wildest jazz/folk/pop frommayhem’The Scotland Europe... Audience participation...‘Hysterical, exhilerating Herald. 1996 sell-out! Devised by Tom Bancroft. Compere John Rae.Team captains Billy Jenkins and Joost Buis. Aug 14-17,21-24 23.15 (00.15) £6.00 (£4.00) ■20 MCCALMANS 1996spareconcert sold Scottish, new, old, CDs, reconditioned- every engine, tyres.(£4.00) Mustout.be Acoustic, seen. Offers! Aug 15,16,21,22,23 19.30 (21.15) £7.00 ■ THE BIG pipers. SPREE Scotland’s newestandSupergroup. Seven-piece, fronted by three power passion. Not to be missed! Aug 15leading 21.45 (23.30)Music £8.00with (£6.00) ■ THE Orcadian WRIGLEYsisters SISTERS a successful tour you the awardwinning are (£5.00) homeFollowing with fiddle and guitarworld to make bounce. Aug 17 21.45 (23.30) £7.00 ■returns MICHAEL MARRA Sold out last year. Marra, that doyen of song-writers, with his19.30 piano(21.15) with old£7.00songs(£5.00) and new. Aug 18,19,20 ■stopSEELYHOO Rising young Scots traditional six-piece band guaranteed to Songs£7.00 in Gaelic Aug you 18,19sitting 21.45still.(23.30) (£4.00)and English. ■ MAD PUDDING Celtic Folk Rock Funk Crossover set to NewWave Old Time Tunes...The Aug 19Fiddlemidnight (01.30) New £7.00Canadian (£5.00) Celtic Sensation.

43


■IrishTHE BARRA MCNEILS presentwith Capea real Breton and Scottish music - performed kick!tunes and songs mixed with • 27 19.30 (21.15) £8.00 (£6.00) MUSIC Aug Aug 27 midnight (01.30) ■PENTANGLE JOHN RENBOURNEa Inspirational and repertoire co-founderofofFolk and solo set fromguitarist his diverse Blues.27 21.45 performing ■to JOCKTAMSON’S BAIRNS The most esteemed and influential band ever Aug (23.30) £7.00 (£5.00) traditional paced’ Scotsman ‘Superb’ Herald. ■ NORTHLANDS FESTIVAL Resident ensemble LYS; virtuosi from Britain, Augplay20Scottish 21.45 (23.30) £7.00music.‘Beautifully (£5.00) and NordicJesper countries including Malin Broman (violin), Simon Crawford■keepBURACH Boogie. Don’t sit down! Not allowed! Philipsthe27,28 (piano), Svedberg up the midnight pace - superbly instrumentals plusThese vocals.Scots folk-rockers Aug 12.30 (13.30) £6.00 (cello). (£4.00) Aug 20,21 (01.30) played £7.00 (£5.00) ■playing BERTsinceJANSCH Synonymous with modern acoustic finger style guitar ■thisDUNCAN CHISHOLM & IVAN DREVER After touring with Wolfstone, the 1960s. First ever formidable partnership will blow you away with beautiful fiddle tunes and Aug 28 19.30 (21.15) £7.00 (£5.00)Fringe appearance! stunning songs. Aug 21 21.45 (23.30) £7.00 (£5.00) ■ INNER SENSElatin-beat PERCUSSION ORCHESTRA Definitely a dancing event ■of JACKIE LEVEN ‘Athese songwriter of rareevergifts,produced.’ a guitaristStuart of great lyricism, one with Aug this 28,29rhythmic, 21.45 (23.30) £8.00nine-piece (£6.00) groove unit.You can’t sit still - so don’t! the greatest voices islands have Maconie Aug 22 21.45 (23.30) £7.00 (£5.00) ■ DROP THE BOX Five-piecegrooves acoustic band from Shetland serving a funky ■ TONY MCMANUS Aaround rare chance to catch this virtuosic Scottish guitarist fusion Aug 28ofWorld, midnightIndie, (01.30)Reggae £7.00 (£5.00) and explosive Folk. weave his magical fingers music from the Celtic nations. Aug 24 19.30 (21.15) £6.00 (£4.00) ■ THE MUCKLE - THEballads. LIVING TRADITION A celebration traditionSANGS of Scottish An opportunity to hear an art formof -il ■ SGATHACH Brilliantly individual, this nine-piece ensemble will entertain the uniqueunbroken in 19.30 Europe. you with their unique blend of Gaelic song and music. Aug 29 (21.15) £7.00 (£5.00) Aug 24 21.45 (23.30) £7.00 (£5.00) ■ THEScotland’s FINESTmost ACOUSTIC MUSIC SESSIONS in the Fringe! Join and ■album JUNE- Huw TABOR ‘First Lady Emerson. of Folk’ performing material from her latest enjoy accomplished musicians Aug 8-10,13-17,20-24,27-30 21.30 (03.00) Freein the cafe-bar. | Aug 25,26 19.Warren 30 (21.15)& Mark £8.00 (£6.00) ■ CEILIDHS Jiggle and(16,reel17).to BELLA MCNABS (24); shoogle and shake with | ■perform THE SANDY BRECHIN BAND Enjoy Sandy and the band as they THE YOUNG HOODS ‘the most imaginative, innovative and enjoyable accordian music Aug 16,17,24 midnight (03.00) £6.00 (£4.00) around.’ ! Aug 25 21.45 (23.30) £7.00 (£5.00) ■ CEILIDHS Birling ceilidh Runrig’s with THEMalcom YAK HUNTERS (22); lively the MARWICKS (15,23,29). Jones features in bothdancing bands.with ■Chaisson RICHARD WOOD Amazing Canadian fiddler with attitude. With Darla Aug 15,22,23,29 midnight (03.00) £6.00 (£4.00) (piano) and Gordon Belsher (guitar, vocals, bodhran) - in your face music!26 21.45 Aug (23.30) £7.00 (£5.00) CREDIT CARD SALES ■energy, FLOOK! Three fineglorious flautists.soaring An adrenaline-jolting headrush... packed with RING 0131-226 lines) trills, Aug 26stuttering midnight (01.30) £7.00 (£5.00) flights and some goddam fine tunes. Open 10am-6pm 5138 (June (10a July) 9am-9pm (during August) !T;

SOUTHSIDE COURTYARD SOUTHSIDE MORAY HOUSE THEATRE Barrie Realistic Theatre Company of MUSIC Edinburgh 4:10pm Gareth Hedges 2:15pm the Road 6:40pm Stil Horny After All These Years Earl On Company Cambridge University ADC Okin 4:10pm 8:15pm Star of German Comedy Earl Okin Let It Be - The Musical 9:15pm 8:10pm Gangsters No. I Blacklight 9:50pm POETRY Birth of a Man Edinburgh Footlights Big Word Performance Poetry 6:00pm 10:15pm

OPERA The Bear 6:00pm & The Dinner Engagement 6:00pm Cambridge Opera Group MUSICALS Cabaret 12:1 Sam The Time Machine 2:10pm A Slice of Saturday Night 6:15pm

PSM PERFORMERS AND SHOWS LAST YEAR WON 2 Fringe Firsts ■ BBC Open Mic Award for Comedy ■ The Guardian Student Drama Award ■ Radio Five Best Actress of the Fringe ■ Guardian Award runnerup ■ PREVIOUS YEARS ■ Spirit of the Fringe Award ■ The Sunday Times Playwriting Award ■ Guardian Student Drama Award ■ Perrier Best Newcomer

0131 667 2212 44

THE LEGENDARY

Every I Also... STILL HORNY AFTER ALL THESE YEARS Selected afternoons 4.10pm at Venue 82 SOUTHSIDE , Tvcilobjl

SOUTHSIDE n COURTYARD m


■COMPLETE SELL-OUT 1996 1 1996 PERRIER AWARD NOMINEE I 1996 FESTIVAL CRITICS AWARD WINNER ■ 1995 TIME OUT AWARD WINNER

MUSIC

FESTIVAL OF BRITISH YOUTH ORCHESTRAS ©Q©© Venue 100 - Central Hall,West Tollcross. Tickets 229 7937 L8 ■playFESTIVAL OF BRITISHbaroque/band YOUTH ORCHESTRAS Top youth orchestras classical/contemporary, music. Presented with support from The Lewis Partnership Standard Life.staff, students, unemployed, FreeJohn for school pupils and and accompanying disabled and children. ‘hilarious, unmissable genius ■ JEUGDORKEST NEDERLAND Conductor: Roland Kieft. Enigma Variations: Elgar. Square (1993): van Oosten. Firebird Suite (1919): ...leaves you gasping Stravinsky. ofThe£6.00 Big (£3.00 IssueRoelinGAP Scotland. SUNDAY TIMES Aug 9 19.30In aid(21.30) & Stage Pass) (Free SUDC) ■ SOUTHAMPTON UNIVERSITY CHAMBER CHOIR Conductor: “Victor Borge Adrian Bautrie. Songs of Farewell: Parry Hymn to St Cecilia: Britten Mass: Frank Martin Aug I I 12.30 (13.30) £3.00 (£1.00 OAP & Stage Pass) (Free SUDC) in a leather jacket” DAILY EXPRESS ■Conductor: SOUTHAMPTON UNIVERSITY CHAMBER ORCHESTRA Paul Ingram. Overture - Siegfried Coriolan: Beethoven. Symphony No 2: Beethoven. Wind Serenade: Wagner. “musical gag-meister, Aug I I 19.30 (21.30) £6.00Strauss. (£3.00 OAP & StageIdyll:Pass) (Free SUDC) ■Danson. BARNET SCHOOLS SYMPHONY bonsai Meatloaf, Overture - The Magic Flute: Mozart.ORCHESTRA Alegrias: RobertoConductor: Gerhard.Alan Symphony No 5: Beethoven. Aug 12 12.30 (13.30) £3.00 (£1.00 OAP & Stage Pass) (Free SUDC) king of popular culture’ ■Danson. BARNET SCHOOLS SYMPHONY AUSTRALIAN HERALD SUN Overture Marriage of Figaro:ORCHESTRA Mozart. Alegrias:Conductor:Alan Gerhard. LaValse: Ravel.12Symphony No- The 5:£6.00 Beethoven Aug 19.30 (21.30) (£3.00 OAP & Stage Pass) (Free SUDC) ■ SOUTHAMPTON CHAMBER CHOIRBritten. Conductor: Adrian Bautrie. Songs of UNIVERSITY Farewell: Parry. Hymn to St Cecilia: Mass: Frank Martin. Aug 13 19.30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) ■Gabrieli, ANGLIA BRASS ACADEMY Conductor:Howard George Blake; Reynolds. Scheldt, Geoffrey Winters; Sinfonietta: musicAntiphons for all tastes. Aug 14 12.30 (13.30) £3.00 (£1.00 OAP & Stage Pass) (Free SUDC) ■Hutchinson. WARWICKSHIRE YOUTH CHAMBER Symphony No 27: Mozart. ConcertoORCHESTRA Grosso Op 6 NoConductor; I: Handel.Ray Suite 14- Rakastava: Sibelius. Aug 19.30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) ■Hutchinson. WARWICKSHIRE Conductor: Ray ProgrammeYOUTH to include:CHAMBER Symphony NoORCHESTRA 27: Mozart. Concerto Grosso Op 6 No 2: Corelli. Aug 15 12.30 (13.30) £3.00 (£1.00 OAP & Stage Pass) (Free SUDC) Venue 60 - Canongate Church, Canongate, Royal Mile J15 ■Christopher NATIONAL YOUTH CHOIR OFchoirSCOTLAND Conductor: Bell. Ensembles from the perform a wide range of choral Aug 15music. 12.30 (13.30) £5.00 (£3.00) Venue 100 - Central Hall, West Tollcross. Tickets 229 7937 [i ■Christopher NATIONAL YOUTH CHOIR OF SCOTLAND Conductor: Bell. Petite Messe Solennelle: Rossini. Soloists: Susan Leslie, soprano; McCafferty, mezzo soprano; Ian Paton,Tenor; Ivor Klayman, bass. 15 Frances Aug 19.30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) ■Conductor: DORSETYOUTH ORCHESTRA CHAMBER ENSEMBLES Norton. lively and Aug 16 12.30David (13.30) £3.00A(£1.00 OAPvaried & Stageprogramme. Pass) (Free SUDC) ■NoDORSETYOUTH ORCHESTRA Conductor: DavidBerlioz, Norton.Ginastera, Symphony 2: Sibelius. Fantasia Theme of Tallis: Vaughan Williams. Franck. Aug 16 19.30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) DUNDEE SCHOOLS SYMPHONY ORCHESTRA |2 SHOWS ONLY! ■Maynes. Overture - Egmont: Beethoven. Symphony in C: Bizet.Conductor: Hungarian Charles March: Berlioz.18 Siegfried Idyll: Wagner. Carmen Aug 19.30 (21.30) £6.00 (£3.00 OAP- &Suite: StageBizet. Pass) (Free SUDC) i GEORGE SQUARE ■Fernandez. GLASGOW SCHOOLS STRING ORCHESTRA Elaine Introduction and Rondo Capriccioso: Saint-Saens.Conductor: Cello Concerto: Elgar. Study: Haas. Little Suite: Nielsen. Adagio: Barber. THEATRE Aug 19 19.30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) ■Conductor: BEDFORDSHIRE YOUTH SECOND miMk37 Ian Smith.TheCOUNTY Golden One: Godman. Mont Juic:ORCHESTRA Berkeley/Britten. Jazz Suite: Shostakovich, Grieg, Lutoslawski,Walton. Aug 20 19. 3 0 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) 0131 6502001 0131 2242151 ■andDURHAM EARLY MUSICon CONSORT Director: Phil Watson. Medieval Renaissance music £3.00 played replicas ofStage original instruments. 21 12.30 (13.30) (£ 1. 0 0 OAP & Pass) (Free IN ASSOC 0 BALLOON PRODUCTIONS Aug FESTIVAL OF BRITISH YOUTH ORCHESTRAS continues SUDC) on next page 45


MUSIC FESTIVAL OF BRITISH YOUTH ORCHESTRAS continued ■TonyDURHAM COUNTY YOUTHGirl:CHAMBER Oliver. Overture The Rossini. FluteORCHESTRA Concerto: Conductor: Poulenc/Berkeley. Drum-£6.00 Roll Italian Symphony: Aug 21 19.30 (21.30) (£3.00 OAP Haydn. & Stage Pass) (Free SUDC) ■CONCERT GOLDSMITHS’YOUTH ORCHESTRA ElinorNutcracker: Corp. forCarmen: CHILDREN. Lively excerpts fromConductor: poular classics: Tchaikovsky. Bizet. Aug 22 12.30 (13.30) £3.00 (£ 1.00 OAP & Stage Pass) (Free SUDC) ■NoGOLDSMITHS’YOUTH ORCHESTRA Conductor: ElinorClock: Corp. Symphony a Bare(£3.00 Mountain: Aug8:22Dvorak. 19.30Night (21.30)on £6.00 OAPMussorgsky.The & Stage Pass) (FreeFlower SUDC) Francaix. ■O’Malley. EDINBURGH SCHOOLS Jim Swing, jazz/rock and LatinJAZZ styles,ORCHESTRA from EllingtonConductor: to Louie Bellson and AugFrank 23 12.Mantooth. 30 (13.30) £3.00 (£ 1.00 OAP & Stage Pass) (Free SUDC) ■Karelia LOTHIANS SCHOOLS Conway. Suite: Sibelius. HungarianORCHESTRA Pictures: Bartok.Conductor:William Meditation: Massenet. Czardas: Monti. Pictures at an Exhibition: Mussorgsky/Ravel. Aug 23 19.30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) Venue 43 - Royal Museum of Scotland, Chambers Street KI2 ■DANCE LEICESTERSHIRE ARTSSlipp.SYMPHONIC WIND BAND & YOUTHConductor: Martin Kurt Weill, Mussorgsky, new commission Richard24 Fairhurst. Aug 14.30 (15.30) Free Venue 90 - Graffiti,Corner Broughton and East London Streets Tickets 5S7 8330 GI3 ■DANCE LEICESTERSHIRE ARTSSlipp.SYMPHONIC WIND BAND & YOUTHConductor: Martin Kurt Weill, Mussorgsky, new commission Richard25 Fairhurst. Aug 12.00 (13.45) £3.00 (£ 1.00 OAP & Stage Pass) (Free SUDC) Venue 100 - Central Hall,WestTollcross. Tickets 229 7937 L8 ■Durrant. RSAMDOverture JUNIOR ACADEMY ORCHESTRA Conductor: James Le Carnaval Remain: Berlioz. Banks of Green Willow: Butterworth. Aug 25 19.30Gayane (21.30) Suite: £6.00Khachaturian. (£3.00 OAP &Symphony Stage Pass)No(Free5: Glazunov. SUDC) ■21 stFIFE YOUTH JAZZ ORCHESTRA Director: Richard Michael. FYJO’s birthday celebration. Aug 26 12.30 (13.30) £3.00 (£ 1.00 OAP & Stage Pass) (Free SUDC) ■Richardson. HIGHLAND YOUTH Conductor: Suite -REGIONAL L’Arlesienne, No I: Bizet.ORCHESTRA Prelude a I’Apres Midi d’unHerbert Faune: Debussy. Symphony in D minor: Franck. Aug 26 19.30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) ■Kidgloves: PERTHConnor. YOUTHWindORCHESTRA CHAMBER Percussion - Brass Hertfordshire Suite: Noble.ENSEMBLES Serenade: Jacob. String Quartet Mozart.£3.00 Aug 27 -12.KV157: 30 (13.30) (£ 1.-0selected 0 OAP & works. Stage Pass) (Free SUDC) ■Moon:Vintner. PERTH YOUTH ORCHESTRA Conductor: D EoinSax:Bennet. Hunters’ Powerhouse: Koehne. Concerto for Alto Binge.Three Elizabeths: Aug 27 19.Coates. 30 (21.30)Brahms, £6.00Schubert, (£3.00 OAPGrieg. & Stage Pass) (Free SUDC) ■Orchestra FIFEYOUTH STRING ORCHESTRA & PERCUSSION conductor: DawnMancini, Aird. Delius,Walton, Holst. PercussionGROUP conductor: Rebecca Paterson. Brown, Bizet. Aug 28 12.30 (13.30) £3.00 (£ 1.00 OAP & Stage Pass) (Free SUDC) ■Dances: FIFEYOUTH ORCHESTRA Conductor: GraemeSymphony Wilson. Scottish Arnold.Persons Dance Variations/Fancy Free: Bernstein. No 8: Dvorak.Young Guide:(£3.00 Britten.OAPFinlandia: Aug 28 19,30 (21.30) £6.00 & Stage Sibelius. Pass) (Free SUDC) ■Callaghan. EDINBURGH WIND ENSEMBLE Conductor: ConcertandSCHOOLS Prelude: Sparke. Allerseelen: Strauss/Davis. CajunStephen Folksongs: Tichelli. Chorale Shaker Dance: Zdechlik. Marsch:Wengler. Aug 29 12.30 (13.30) £3.00 (£ 1,00 OAP & Stage Pass) (Free SUDC) ■Garry EDINBURGH Conductor: Walker. MotherUNIVERSITY Goose Suite: CHAMBER Ravel. Pulcinella:ORCHESTRA Stravinski. Symphony No 3: Beethoven. Aug 29 19,30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) ■ KELVIN Aug 30 12.3ENSEMBLE 0 (13.30) £3.00ConductonWilliam (£ 1.00 OAP & StageConway. Pass) (Free SUDC) ■Hilary EDINBURGH INTERNATIONAL YOUTH ORCHESTRA Conductor: Davan Wetton. Carnival: Dvorak.Violin Concerto: Brahms. Hungarian Pictures: Smetana. Aug 30 Bartok.Vltava: 19.30 (21.30) £6.00 (£3.00 OAP & Stage Pass) (Free SUDC) Venue 187 - St Giles Cathedral, High Street, Royal Mile J12 ■Conductor: SCOTTISH BORDERS WINDSix’:& Frescobaldi, CHAMBERBourgeois, ORCHESTRAS Kevin Price.‘St Giles’at Handel, McGibbon, Aug 3 I 18.Holst,Van 00 (19.00) Der FreeRoost, Bach/Farr. 46

—^

THE ULTIMATE GLOBAL MUSIC DEL 30 days and nights of songs to salivate to.,. MY FRIEND THE CHOCOLATE CAKE • BLUE HOUSE • KEV CARMODY • JUDY } SMALL • ERIC BOGLE • THE SENSITIVE NEW AGE COWPERSONS • THE AND HERUGHTHOUSE ORKESTRA •• REBETIKI RUBY FRUIT JUNGLE •• KAVISHA CRYING i| V INHOODANGAS PUBLIC PLACES• MADAM • JUDY JAQUES' COMPANIA MAZZELLA •LYCO NEIL MURRAY • LINDSAY POLLACK • THEOILED CELTICSISTERS CITY SONS • RORY :; McLEOD • FELIX • AMANDINA • THE WELL • HENWEN • PLUS MAJOR JAZZ FESTIVAL CONCERTS... And the best of Fringe Cabaret with, The world's Hippest Hypnotist The Hilarious SHANE ST JAMES, The King of Tricksters Magician and Comedian PAUL ZENON, THE FABULOUSLY BEIGE REGENCY ROOMS and for one night only "GOING PLACES1 BECKYS FAMOUS SBIMGELTENT VENUE S7 • WAVERLEY CENTRE, PRINCES STl BOX OFFICE OT 31 558 801 O FRINGE BOX OFFICE Ol 31 326 51 38 i PICK UP A PROGRAMME OR CALL Ol 31 SST 6884 i "This project has been assisted by The Australia Council, the Australian • •-4-. government's arts funding and advisory body, as part of its involvement AVALON PA0M0TI0NS PAESENTZ ATTENTION SOON

CLUUBZRRIITHUSTRH KOMEDIE "THE MOST ORIGINAL AND INVENTIVE CABARET VOU WILL EVER SEE" Sunday Times AUGUST Gtfi - 30th at lO.OSpm [Except 12th & 20th] PLEASANCE Box Office: 0131SSG GSSO x Foi more informat[Cialonls calcostl tn50pe ClperuimmiZarnutateluatistralal Hottimles]ine oo 0891 007706 ♦ J-4


FESTIVAL SPIRIT OO©© Venue 102 - Scotch Malt Whisky Society,The Vaults, 87 Giles St. Leith. Info 554 3451 BI9 FESTIVAL SPIRIT Spend an evening by the fireside enjoying the best of of Scottish tradition... Bagpipes, fiddle, songs, stories and a complimentary dram Scotland’s finest malt.hosts. Margaret and Martyn Bennet, James MacDonald Reid and Jack Evans are18-20,25-27 your Aug 11-13, 20.00members (22.00) £12.50 (£10.00 - Scotch Whisky Society only) ■vocalTHEharmonies, DROUTH A long established, five piecesongsEdinburgh folk band. Stunning traditional and contemporary and music. Aug 17, 24 20.00 (22.00) £5.00 FLUXrTHE EDINBURGH NEW MUSIC FESTIVAL OO©© Venue 7 - Jaffa Cake, 28 King Stables Rd Tickets 557 6969 K10 ■in contemporary Year one of a major new ‘festival within a festival’ showcasing the very best new music, highlighting the music of the next century the future starts here. ■a unique THE DIVINE COMEDY & Britain’s MICHAEL NYMAN Launching theandFestival collaboration betweentogether most intelligent poptime groupever. most popular composer, appearing on stage for the first Aug 12,13 20.00 (23.00) £12.00 ■sinceTHEBrittWANNADIES SUPPORT news frommostSweden Ekland. EdinburghPLUS Festival debut forTheonehottest of the world’s interesting pop(23.00) groups. Aug 14 20.00 £7.50 ■ ANDYBritain’s SHEPPARD & JAZZ JAMAICA Storming jazz collaboration featuring best saxophonist Aug IS 20.00 (23.00) £1 1.00 and legendary ska band. ■bandBABYBIRD They’re gorgeous and they’d do anything for you.The sexiest make their Aug 16in Britain 20.00 (23.00) £10.50Edinburgh Festival debut. ■TheSTEVE MARTLAND The bestmusic; rock’n’roll bandFactory in classical Times.The risingatstars ofBAND contemporary former recordmusic’ signing the point which new music hits the dance floor. Only Scottish date. Aug 17 20.00 (23.00) £9.00 ■a showcase URUSEIYATSURA & MOGWAI & DELGADOS Flux proudly presents strongest new bands in Scotland. Britpop is dead, please be upstanding forof the Scotpop. Aug 19 20.00 (23.00) £7.50

■appearance TINDERSTICKS CriticallyFestival. acclaimed,Tindersticks at the Edinburgh Lying in the guttermake lookingtheirupfirst at theeverstars: Scott Aug 20Walker, 20.00Jacques (23.00) Brel,Tom £10.50 Waits - and now Tindersticks. ■ FAUST One ofoftheKrautrock, most radical live performances you band.‘Nobody will ever see. The leading lights andmusic Julian Cope’s favourite present will forget it, or listen to in the same way again’ Mojo. Aug 21 20.00 (23.00) £10.00 ■Zappa, COMPOSERS ENSEMBLE (PLUS SPECIAL GUEST VOCALIST) Bacharach,chamber Beach Boys,The Kinks,their Costello all arranged Europe’s mostforinnovative grouptomaking Edinburgh Festivalfordebut. Look out announcement relating heavyweight guest vocalist. Aug 22 20.00 (23.00) £10.00 ■meets ACIDtheBRASS Thebandcollision of two great NorthernBandtraditions asclassics Acid House brassGerald, in Britain.Williams-Fairey perform by KLF, A Guybest Called 808 State, Nitro Deluxe and more. An event unparalleled in the history of popular music. Aug 23 20.00 (23.00) £9.00 ■of Techno. HEAVENSeminal 17 They’re back! Finally -a live perfomances Sheffield synth-pop, part of everyone’sfrom pastthenowGodfathers becomes aAugpart24,25 of everyone’s future. Only Scottish date. 20.00 (23.00) £12.00 ■ EAST PROJECT Unquestionably the biggest news in Scotland the cream COAST of thetripEdinburgh - live bands the hop,£7.50 acidblack jazz dance and rarecommunity groove. Don’t miss. and DJs pushing Augenvelope 27 20.00of(23.00) ■performance. MIDGE URE TheScottish uncrowned King of Scotland in a rare, semi-acoustic Aug 29 20.00Only (23.00) £10.00performance - concert promoted by Startex. ■Fanclub, TEENAGE FANCLUB bandsBook in theearlyworld. New New Danger. The onlySimply fittingoneendoftothethebestfestival. to avoid disappointment. Aug 30 20.00 (23.00) £9.00 ■ FLUX Featuring FBl.The Big Chill and more throughout all three weeks of theCLUBS Festival. Aug 14-17,21 -24,29-31 midnight (05.00) from £5.00

47


Probably . . . Edinburgh’s finest stand alone, most central, independent, inexpensive comedy venue with air conditioning on the Fringe. Cafe Royal 17 WEST REGISTER STREET, EDINBURGH ICE BOX OFFICE 0131 5562549 BEER 10am-11pm

LEE & HERRING OFF OF BBC2’s FIST OF FUN

morning with Richard not Judy II iccess, a of comic Hdenco ■He Observer brainy and same time: ««|oyable” Wm The Herald ling, it?” Judy Finnegan Box Office: 0131 556 6550

New British Comedy Every week night at 11pm


A FOLKING PALAVER AT LA BELLE ANGELE OO©© Venue 101 - La Belle Angele, 11 Hasties Close, off Guthrie Street KI2 ■Scottish SHOOGLENIFTY Theits exponential worldwide demand foryear,Shooglenifty’s brand of music continues rise.This they have energated audiences from Canada Australia withfollowers their nearquivering telepathicwithimprovisational hypno-grooving sounds, toleaving devoted pleasure in their slip stream. Aug 24,25 midnight (03.00) £9.50 (£7.50) ■backed PEATBOG FAERIES music from Pipes, fiddle, whistles by guitar, keyboards,Celtic bass &world percussion wovenSkye. into boldly eclectic soundscapes incorporating everything from traditional reels to trip-hop Afro-style guitar licks.‘..truly Scotsman ‘peatbogacious’ Folk Roots beats & Aug 20 midnight (03.00) £7.00epic..’ (£5.00) FRINGE CLUB (DO©© Venue 2 - Fringe Club.Teviot Row, Bristo Sq. Tickets 226 5138 L11 ■lateComedy cabaret, killer ceilidhs and kinky clubs, bands in abundance and late, bars. Night after night the epicentre of thethree Fringe and City.The largestafterartsnight. festivalWelcome on Earthto squeezes into one, storeyFestival building. Aug 8-30 10.00 (late) Membership required from 7.30pm Membership daily and for£25season for themembership season Passport photo£5 required ■ FRINGE club within the classic club. Getpunk,hot60’s, and70’ssweaty the sounds ofCLUB house,DISCO hip-hop, The and soul, indie pop, and to80’s standards. Aug 8-30 22.00 (late) Free with Fringe Club Membership ■event FIESTA LATINA latin Nowmusic in its tosixthEdinburgh. year, FiestaRecently Latina back is thefrom hugelyCuba, popular thatSalsa, introduced DJ Ana plays Merengue.Vallenato, Cumbia and Brazilian rhythms. Aug 8,9,10 21.30 (02.30) Free with Fringe Club Membership ■ BIG WEDNESDAY It’ssell Friday and itthese has toboys be BigwillWednesday! Freshwithfrom the sucess ofmelodic their latest out sucess, make youanswer melt their sweetHouse. pop and heavenly harmonisation. Scotland’s to Crowded Aug 8,15,22,29 11.00 (late) Free with Fringe Club Membership ■coffeebar ACOUSTIC Augthis10 lot. - Bunjie’s Soho’sAlternative: original launchedUNDERGROUND Dylan, songwriting Simon and now Aug- Recorded 17Night: - London Stars of London’s hippest clubs. Aug 24 songwriters launch and live. Limited floorspots available; details 0131ply228their 8245.wares Aug 10,17,24 23.00 (02.00) Free with Fringe Club Membership ■coolTYMPANALI Callself-penned yourself asong. singer-songwriter? judges, prizesAugfor11 best Any style(2-4asperformers); longProve as it’sit. Serious performed plugless. Soloists;Aug 18 Combos Aug 25 - Grand , Final.Tomorrow’s today!Free Details Aug 11,18,25 23.00stars(02.00) with0131 Fringe228Club8245. Membership ■ BOOGALUSA cajun band,Fringe Boogalusa breakfrenzied from & ^recording their thirdScotland’s album to premiere play the Edinburgh Club, fast, fun. Aug 14,29 midnight (late) Free with Fringe Club Membership ■fromTHEcontrapuntal HUMPFFbacking FAMILYvocalsIntertwining angst ridden lyrics, with commentary in twisting harmonies, with exotic musical breaks on- best harmonica, mandolin and dobro with won’t ainterspersed danceremain commanding rhythm section describes the Humpff Family.You seated for long! Aug 15 midnight (late) Free with Fringe Club Membership ■ DAWNTREADERS fromgreat Aberdeen this brand(21.30) of pop£6.00 isHailing filled with songs and and favourites abundanceofofMark energy.Goodier, Augband’s 16 20.00 ■Hendrix CAT SCRATCH FEVER Hot tunes. sweat, Death cold hearts. through Jimi eyes. Railroad in theGunsmoke Afternoon. Madonnas withPsychedelic hearts of stone. Johnny Cash disappears in a haze ofBeautiful purple. And the moon turns a fire red. Aug 16,17 midnight (late) Free with Fringe Club Membership i‘Affair’ ■ THEreceiving MCCLUSKEY BROTHERS With Brothers their recent album ‘A Wonderful reviews.The McCluskey music by rave many. greatwithnightFringe withClub greatMembership songs. have a repertoire of Aug 20envied midnight (late)AFree ■ THE toBEATLES BEATband take recently you backperformed to the sixties, from ‘Shepeople Lovesat You’ ithrough ‘GetGlasgow Back’.The to 10,000 an .event held on Green. ‘A splendid time is guaranteed for all’ \john Lennon 1967. i Aug 21 midnight (late) Free with Fringe Club Membership MU SOLAwitharetheoneelation of the offinest actshypnotic around, contrasting dark and [grooves driving rhythms, weaving the powerful threads Iceltic andremember. dance culture with the natural soaring melodies of Kaela’s voiceof- a ijnight to iAug 22 midnight (late) Free with Fringe Club Membership :i9 GODS of the fronted bands wle/ody MakerBOYFRIEND 813197. Debut‘Onesingle Witchbest- girl ‘A wonderful record’in theMarkcountry’ Radcliffe {Radio Aug 23One.20.00 (21.30) £6.00

■SoulBIGwithVERN uniquehasbrand of B&B/ suits,‘N’THE shades andSHOOTAHS attitude. Acircuit. highdeliver energytheirshowownwhich established them as favourites on the live music Aug 23,24 midnight (late) Free with Fringe Club Membership ■sounds THEofPORRIDGE MEN Non-stop,Dance‘till foot-stompingdrop.fun with the Celtic Tribal Themidnight Porridge(late) MenFree Ceilidh. Get Reel. Get Jigging! Aug 27,30 with Fringe ClubyouMembership ■ PEARLFISHERS toreceived Marina records their album Strange Underworld ofonRecently thea Sunday Tall signed Poppies’ ravethereviews andtalents their‘Theofsingle released in June ‘Even Afternoon’ shows diverse the band.28 midnight (late) Free with Fringe Club Membership Aug GILDED BALLOON ©O©© Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 K12 LABI SIFFRE A DAY IN THE KNIFE In words and music, a portrait of love, sex, must. violence, childhood and an with inability absolute Siffre expresses wordsto abandon what manyhope. mightInspiring., expressanwith their fists. 20.45Labi(21.45) Aug 25-30 £7.50 (£6.50) Venue 101 - La Belle Angele, 11 Hasties Close, off Guthrie Street KI2 JOHN OTWAY The twentieth anniversary of theintohitone‘Corof Baby That’s Really Free’ and two and a half thousand performances the longest running musical shows in the short history of punk rock. With guitarist Richard Holgarth. Aug 25-30Hilarious. 19.30 (20.45) £6.50 (£5.50) Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 K12 ■leapPAUL CAPSIS RETURNS IN CABARET The voice is back!last Takeyear’s a wild across the gorge of popular music with the talent that dazzled festival.‘Wonderful’ The Scotsman ‘Startling’ Scotland on Sundoy‘Brilliant’ Evening News Aug 8-11,13-17,19-21,23-26 23.30 (00.30) £7.00 (£6.00) ■swamp THEthat GADFLYS Back byDense, popular demand....smokey. ImmerseDrifting yourselfvapours, in the musical is The Gadflys. ...languid, dangerous undercurrents andyourvisions ofsnorkel. unexpected beauty.The place to go late nights at the Festival. Bring own Aug 8-30 midnight (04.00) £6.50 (£5.50) GREASE THE NIGHT CLUB ©O©© Venue 168 - Moray House Student’s Union, 37 Holyrood Road Tickets 557 6608 KM ■andGREASE THE NIGHT CLUB Open from 10 pm to 5 am every Friday Saturday throughout the Festival for the best of 70s, 80s and 90s disco. At Moray House, Holyrood Road.Tickets at the door - Fridays, £4.00; Saturdays, £5.00.1,8,15,22,29 Aug Aug 2,9,16,23,30 22.00 22.00 (05.00) (05.00) £4.00 £5.00


MUSIC HARPSICHORDS AT ST CECILIA’S HALL ®0©© Venue 31 • St Cecilia’s Hall, cnr Niddry Street & Cowgate. Tickets 650 2805 K13 HARPSICHORDS AT ST CECILIA’S HALL A rare chance to hear Early Music on antique instruments in Scotland’s oldest concert hall. ■celebrating ARBOREA MUSICA Baroque Corelli woodwind.The of France’, Leclair’s 300th birthday, and Vivaldi,Corelli featuring the Goermans/Taskin harpsichord. Aug 9 15.00 (16.30) £6.00 (£4.00) ■(baroque MOZART AND and Trios. CatherineMcGillivray Martin violin), SusanBEETHOVEN Alexander-MaxSonatas (fortepiano cl8IO),Alison (baroque cello).(16.30) Aug 12 15.00 £6.00 (£4.00) ■(1773 FRENCH BAROQUE MUSIC harpsichord), ElizabethPhilip DoddGruar (viola(baroque da gamba).flute),Ann Bond Aug 14Falkener 15.00 (16.30) £6.00 (£4.00) ■Gardens. O TUNEFUL VOICE...(counter-tenor), Songs from theJohn18th-century English Pleasure Sandy Chenery Kitchen (1793 Broadwood harpsichord). Aug 16 15.00 (16.30) £6.00 (£4.00) ■CONTEMPORARIES LOVE’S TORMENTSMarie - MUSIC BY HANDEL AND HIS(Anonymous Birve (soprano), Neil Coleman Italian harpsichord), Alison McGillivray (baroque cello). Aug 19 15.00 (16.30) £6.00 (£4.00) ■andLOKI ENSEMBLE - SINGETandDENcontinue, HERREN Bach,Hitchcock’s Handel,Telemann Vivaldispinet. for soprano, woodwind featuring 1728 bentside Aug 21 15.00 (16.30) £6.00 (£4.00) ■splendid LUCY1764 CAROLAN - J S BACH PARTITAS Numbers I, 2 and 4 with the Aug 22 20.00 Hass (21.30)harpsichord. £6.00 (£4.00) ■Francois JOHNandKITCHEN -THETHREE by Louis, Armand-Louis, played on theCOUPERINS world-famous: music 1769 Taskin harpsichord. Aug 23 15.00 (16.30) £6.00 (£4.00) ■ LUCYTaskin CAROLAN - J S BACH PARTITAS Numbers 3,5 and 6 using the harpsichord. Aug1769 24 20.00(21.30) £6.00 (£4.00) ■played DAVIDthePOLLOCK - GOLDBERG 1755 harpsichord.VARIATIONS : Bach’s masterpiece Aug 26on15.00 (16.30)Kirckman £6.00 (£4.00) ■ AMPHION ANGLICUS - SONGS OF Britain. MIRTH AND MADNESS Vocal 17th-century Aug 28and15.keyboard 00 (16.30)music £6.00from(£4.00) HENRY’S CELLAR BAR OO©© Venue 162 - Henry’s Cellar Bar, 8-16 Morrison Street Info: 221 1288 K8 ■Performance HENRY’Sstarting CELLAR BAR Fresh Dim Sum is available upforto details. I 1.30pm.Jazz, times and prices vary so please phone Blues, Ska, Reggae, Classical. Something for everyone.Thank you for supporting live music. Aug 10-30 12.00 noon (03.00) HIGHLY RECOMMENDED ®Q©© Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 GI3 ■A YOGHURT HERBIE FLOWERS WITH MARVYN HANGLIDER MY MUM’S An unlikely title, an unlikely collaboration, and unlikely to leave you anything other than captivated. Sell-out debut ‘96 (‘indeed this is highly recommended’ Scotsman). Aug 8-22 14.30The(15.30) £6.00 Fun, (£5.00)thought-provoking and great music. ■ ATRIBUTETO MAXINE DANIELS Unique as tribute shows go, Benny in that this favourite one features Maxine herself. Ella Hatchard Fitzgerald, Green’s singer. First time on England’s the Fringe,answer pianisttoMike narrates her unique life story & accompanies. Aug 8,9,11,12 £6.00 (£5.00) Aug 13,14 23.1512.20.00(21.15) (00.30) Aug 15-17,24 3 0 (13.45) Aug 18-20 16.18.0000 (17.15) (19.15) Aug 21,22 ■on MIKE HATCHARD’S PIANO The most atmospheric venue the Fringe, a deconsecrated church,RECITAL providesCorea the and perfect intimate rendition of Bach,wayBeethoven, Chick more.setting Bags forof an atmosphere, the perfect to chill out after a long day. Aug 15I 1,12,17,18 23.15 (00.15) £5.00 (£4.00) Aug 16.00 (17.00) 50


BARCODE DRESS CODE DECODE '

Co|V|ed!j

Kiupp ceiudHS & KiNKj) CLUBS

Cabaret

BaNdS >N AbUNdaNce & Late Bars NgHt aFtep N'gHt aFtep IMigHt . . .

Frin

«tlub

MUSIC

HORSE PLUS GUEST PLAYERS OO©© Venue 26 -The Palladium,Broughton Place Tickets 5S7 2100 (557 6969 preAugust) GI4 ■Returning HORSEtoPLUS GUEST PLAYERS ‘The return of the voice’ The Herald. the next Palladium asthisa solo artisttowith a new band and new material destined for her album, is sure be Horse’s year. Aug I 1,18,25 19.00 (20.15) £ 10.00 (£8.00) HUNGARIAN OVERTURES/ MERLIN INTERNATIONAL oo©o Venue 2 - Fringe Clubjeviot Row,THEATRE Bristo Sq. Tickets 226 5138 ■virtuosity LAJKOfrom FELIX AND LORINSZKY ATTILA Breathtaking musical the Violin and Bass duo,everybody brilliantlywas mixing up jazzfeet.The and rockrestwith traditional on their looked12-14 tooHungarian amazed tosounds.‘Nearly stand’;‘incredible’;‘unforgettable’Gozetto. Aug 20.30 (21.45) £6.50 (£5.50) Ticket includes Fringe Club Membership for the evening Venue 87 - The Famous Spiegeltent.Top of Waverley Centre, Princes St Tix 558 8010 j 12 ■Hungary’s LAJKOhottest AND LORINSZKY ATTHE SPIEGELTENT Catch two of musicians as they set the pace in the splendour of the Spiegeltent. Aug 15,16 Unmissable. 19.00 (20.00) £6.50 (£5.50) ■ AMADINDA ATTHE SPIEGELTENT African instrument. Amadinda; Abetween Hungarian percussion group whoseAmadinda:An aimmusic.‘They is to represent the the connection traditional and contemporary areGuardian. among most dazzling percussionists you might hear this side of Bali’The Aug 17 19.00(20.10) £6.50 (£5.50) Venue 43 - Royal Museum of Scotland, Chambers Street. K12 ■Hungarian AMADINDA ATTHE MUSEUM A special performance to celebrate the contribution to this year’s Fringe. Aug 19 18.30purchased (19.30) (on Freerequest tickets from given the withFringe any other Hungarian Overture performance box office). JAPAN EXPERIENCE OOQO Venue 55 - Randolph Studio, Inst. Francais d’Ecosse, 13 Randolph Cres. Tix 225 5366 H8 ■jazzCHIKUZAN plays the tsugaru shamisen, the 3-stringed guitar. Improv and with an oriental twist accompanied by her haunting voice. ‘For adventurous ears and fansvirtuosity.’ of acousticScotsman. music, this is a delight.The audience left gasping at Chikuzan’s Aug 10-16 18.00 (18.50) Aug 17-23 19.45 (20.35) £5.00 (£4.00) THE JAZZ CLUB OO©© Venue 92 - Dr Watt’s Library, 3 Robertson's Close, Cowgate Info 557 3768 KI3 ■A fantastic THE JAZZ CLUB The best live jazz in town funk, latin, fusion, be-bop. atmosphere andjamlatesession. bar (3.00 am) make this an essential venue. Headline followed Aug 10-16band22.00 (03.00)by£5.00 £4.00 (£4.00) (£2.50) All musicians welcome. Aug 17-30 22.00 (03.00) JAZZ JAM SESSION OO©© Venue 139 - The Honeycomb, 36 Blair Street Tickets 226 2151 KI2 ★ ■ JAZZ FROM KULU PRESENTS Bop, funk, groove & hip hop with top contemporary jazzers from John Rae Collective.Tommy Smith Bigband, Swirler, Power of‘tillScotland, East Coast Project,in town. Kulu’s Tigers and more plus top jazz DJ’s. Licensed Sam. Hippest Jazzscene Aug I 1-14,17-21,24-28 23.30 (05.00) £5.00 (£4.00) KAREN KADERAVEK - CELLIST OO©© Venue 111 - St Andrew’s & St George’s Church, 13 George Street. Tickets 225 3847 HI I ■Kadosa CELLO ALCHEMY Experience the magical sound worlds of Bach, Britten, and Khachaturian through masterpieces for solo cello. American virtuoso cellistprogramme. Karen Kaderavek makesweaves her Festival and powerful ‘(Kaderavek) a regalFringe spell’debut Bostonwith Globe.a probing Aug 18,22 14.30 (16.15) £6.00 (£5.00) Aug 26 19.30 (21.15) KENNY YOUNG AND THETOUR EGGPLANTS:THE EGGPLANT EVOLUTION Venue 2 - Fringe Club.Teviot Row, Bristo Sq. Tickets 226 5138 ■‘A KENNY EGGPLANTS The kings of oddball pop songs! wonderfulYOUNG weird,Robinson very&THE funny Scotsmon.‘Like Lou Reed onin aLithium... Unmissable!’ Tom ‘WayAband’ cool... Brooklyn’s Eggplants areTicket!’ vegetable patch all their own’ New Route. London Evening Standord‘Hot Aug 15,17,18,20-22,24-27,29,30 21.00 (22.15) £6.00 Aug 22.30Fringe (23.45)Club £6.00Membership Ticket16,23 includes for the evening 51


LOYKO OO MUSIC Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 THE RUSSIAN GYPSY BAND Two violins, one guitar, three voices -themusic that amazes andwere enchants audiences everywhere!at some ‘If jawsofweren’t hitting floor, then they shouting encouragement the most astonishing musicianship 20,26-29you’re 23.30likely (00.40)to hear’ £8.00SOS. (£7.00) THE KIMBARA BROTHERS OO0© Aug Venue 90 - Graffiti,Corner Broughton and East London Streets Tickets 557 8330 GI3 DOUGIE MACLEAN ■melancholy HOT CLUB JAZZ Django Reinhard style gypsy jazz where European with the swaggerandofwitNewin the Worldperfect syncopation.... performed Venue 72 - Queen’s Hall, Clerk Street. Tickets 668 2019 N13; with subtlety,dovetails tremendous invention setting of Cafe ■renowned DOUGIEfor MACLEAN Scotland’s finest singer-songwriter, internationally Graffiti. his songand‘Caledonia’, from in‘Thea favourite Last of thevenue.‘A Mohicans’ and Aug 18.00 (20.00) Free £5.00 (£4.00) BBC’s ‘Mug’s ‘Songroads’music performs musical Aug 2219-24 19,20,21,24 00.15£6.00 (01.15) hero..’ Wall St.19.Game’ Journal. Aug 00.15 (01.15) (£5.00) Aug 26,27 30 (21.30) £9.50 (£8.50) THE LABORATORY OOO© THE MAMBO CLUB ®0©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 Venue 75 - The Mambo Club,West Tollcross. Info 229 0469 L8 ■andGARETH HEDGES Evocative vocals, finger-picking good guitar, country ■Come THEandMAMBO CLUB ARhythms, must forReggae, anybodyLatinwhoandcomes toSocatheandFestival. delta blues, fiddle and banjo tunes, jazz classics, original songs and party to African Salsa, Calypso, instrumentals. Jazz, Funk and Soul, Rap and Hip-Hop. Late bars. Every Thursday, Friday, Saturday • Aug 24-30 14.15 (15.45) £5.00 (£4.00) and Sunday. Aug 7-10, 14-17, 21 -24, 28-30 22.00 (04.00) £5.00 (£4.00) THE LIED TRIO ©OOO Venue 131 - Greyfriars Kirk, Greyfriars Place, Candlemaker Row. Tickets 225 1900 K11 THE MEAN FIDDLER ©O©© ■ THE LIED TRIO PLAYSa variety BEETHOVEN THEviolaBEATLES 189 - The Meadows Big Top,The Meadows, Melvil e Drive Tickets 667 7367 NI2 American teen group Gerschwin plays ofLennon/McCartney music onTOviolin, and cello, including Venue ■Fiddler THEMusic MEANtentFIDDLER AT EDINBURGH FESTIVALS The Mean Beethoven, Schubert, and adapted authentically will bring you a varied and full spectrum of music, which the toAugstring trio. For all ages and tastes. Mean Quality Fiddler music hosts inforLondon & elsewhere in the UK, to Edinburgh for the first 9 19.30 (21.00) £4.00 (£2.50) this Festival Venue 55 - Randolph Studio, Inst. Francais d’Ecosse, 13 Randolph Cres.Tix 225 5366 H8 time. Aug 7-10,14-17,21 -24,28-31 17.00 too. (23.00)ENJOY!! ■ THE LIED TRIO PLAYSa variety BEETHOVEN THEviolaBEATLES American teen group Gerschwin plays music onTOviolin, and cello, including Beethoven, Schubert, and ofLennon/McCartney adapted authentically toAug string trio. For all ages and tastes. 10-16 20.30 (21.30) £4.00 (£2.50) WRITE YOUR OWN REVIEW onhttp://www.edfringe.com the Fringe web site

52


EVA MEIER oo©@ Venue 23 - 651 Chapl1332 aincy I0am-5pm) Centre, I Bristo Square, (near Fringe Club) Tix 650 8201 LI2 (pre 7 Aug ■Raben EYES(composer IN THE ofBIGall Fassbinder’s CITY Songsfilmwritten bytoWeill, Eisler.Tucholsky and music) lyrics by Brecht, Goll, Lichtenstein andtheliving poets ofsuchtheasGerman Hans Enzenburger & Sarah Kirsch. NEW YORK JAZZ! They continue22.15 tradition Aug 21-30 (23.45) £7.00 (£5.00) Literary Chanson. Venue 54 - The Cellar Bar, Chambers Street KI2 ■ NEWYORK JAZZ! New Yorksomebassist Charlie Kniceley leadsGregor this hardClarke quartet which includes of Scotland’s top players; MR MCFALL’S CHAMBER OO0O grooving (piano) and Bil Kyle (drums). Great jazz, food, late bar Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 GI3 (trumpet), (0230)20-23,27-30 and Paul FREEHarrison ADMISSION? ■by JOHN’S BOOK OF ALLEGED DANCESwithBritish premiere of MrnewMcFall’s work Aug 22.30 (01.30) Brilliant! Free John Adams for string quartet is juxtaposed dance and song. Chamber is joined by dancers Dawn Hartley, Jonathan Burnett, vocalists Dave NIGHTS IN THE CARPENTER’S ARMS ©OOO Brady,16-22 Dominic12.30Harris, Aug (13.45)Heather £5.00 McLeod. (£4.00) Venue 52 - ECF Kings Hall, South Clerk Street N13 ■tourists. CEILIDHS IN THE CARPENTER’S ARMS A must for Scots and successtheover the years. Huge. MASSIVE.Therefore two ceilidhs _j|_ MY FRIEND THE CHOCOLATE CAKE OO©© again andBigdouble Scottish music, dancing and entertainment.Treat HfgfjgjTI#! Venue 87 - Famous Spiegeltentjop ofWaverley Centre, Princes St Tix 558 8010 J12 yourself to a real tastefun!!of Scotland. ■songwriting, MY FRIEND THE CHOCOLATE CAKE powerfully emotive Aug 13,15 20.00 (23.15) Free gorgeously coloured instrumentals. Top 20 Festivalpartattraction’ ■ LIVE MUSIC AT THE CARPENTER’S ARMS Two more great evenings The List;‘Another Aussietextures, importtight reeking of class...an at thelet Carpenter’s Scotsman;‘Lush string snappy rhythms.essential Surprise hit atofthisFestival year’s‘96’ ofBe music the bandsFreeplayArms. and Live the jazz, musicblues, speak.rock and gospel music. Fringe’ The Guardian ‘96. Augindulged: 9,16 20.00(23.00) Aug 15-17 23.30 (00.30) £7.50 (£6.00) Aug 18,19,22-24 19.00 (20.00) OLD ST PAUL’S MUSIC ‘97 OO©© THE NATIONAL YOUTH ORCHESTRA OF ©OOO Venue 45 - Old St. Paul’s Church & Hall,Jeffrey Street. Tickets 556 0476 JI3 SCOTLAND FESTIVALyear,MASSES Experience Festival Worship in Schubert’s Old St Paul’s.Masses In thisin G Venue 176 - Usher Hall, Lothian Road J9 ■bi-centenary the musicians of Old St Paul’s perform (10 Aug)(24andAug). C (17 Aug) and the spectacular Widor Messe for two choirs and ■ THE- conductor. NATIONAL YOUTH ORCHESTRA OF SCOTLAND organs Tovey Michael Thompson -Horn soloist.Concerto Scotland’s finestSymphony youngBramwell musicians Aug 10,17,24 10.30 (11.45) Free play: Holst; The Perfect Fool Musgrave; Elgar; No I ‘That priceless asset of this country,The National Youth Orchestra of ■ ZADOKTHE PRIEST greatin Coronation Anthem performed ScotlandThe the choir and orchestra ofrarely OldHandel’s Stheard Paul’s, a programme that includes otherby Aug 5 19.30 Scotsman. (21.30) £ 16.00 (£8.00), £ 10.00 (£6.00), £7.00 (£4.00) (£ 1.00 SC) works by Handel, and the Serenade No I in D, by Brahms. Aug 20 20.00 (21.30) £6.00 (£4.00)

Ben Moor A Supercollider for the Family

"constantly inventive... deeply funny., oddly eloquent. FIVE STARS. " The Scotsman

Focus on the

http://www.telegraph.co.uk

^

Pleosonce (33) ^ August 7-18 (not 11) 4.00pm 0131 556 6550

festival with The List Three special issues bursting with reviews, news and a round-the-clock guide of what to see at the Edinburgh Festival and Fringe. New issues out on Thursday 7, 14 & 21 August £1.90 from all good newsagents


(Italy)Caleffi pre flute. Europe with Christina harpC)andaPaolo MUSIC Aug (21.30) Blarzino £6.00 (£3.00 (£3.00 Aug 2622 20.00 15.00 (16.30) £5.00 C) ■by PIANO FAVOURITES William Alexander plays vituoso & lyrical works Bach, Beethoven, Aug 23 Mozart, 15.00 (17.00) £6.00 Schubert, (£3.00 C) Brahms, Debussy, Chopin and Liszt. OXFORD CONCERT PARTY EUROPE’S ONLY BAROQUE & TANGO ORCHESTRA 00©0 ■ LEONA MUNRO SOPRANO, LUCIA MICALLEF PIANO Scottish-Maltese duo metMozart, as prize-winning students.They are performing Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 G13 This anAuginteresting ■ OXFORD CONCERTSixPARTY - EUROPE’S ONLYwithBAROQUE & 23 20.00programme (21.30) £6.00by(£3.00 C)Schubert, Poulenc and Berg. TANGO ORCHESTRA top professional musicians a witty and ■ FRANCIS MARTINEAU in an original style mixing original fusion‘Oneof 18th elegance, Latin-American passiongroups and Celtic delights in riding the piano unpredictable line between formjazzandand classic: exuberance. of thecentury most entertaining and mould-breaking around’ influences, improvisation. He has performed world-wide. Oxford Times. Aug 24-29 22.00 (23.00) £5.00 (£3.00 C) Aug 18-23 12.30 (13.45) £6.00 (£5.00) ■Romantic MICHAEL DAVID LYLE PIANO perform musicLADOMERYTENOR, Italy and£5.00 France. THE PADDIE BELL FESTIVAL FOLK SHOW OOO© Aug 26,28,29 13.from 00 (14.00) (£3.00AlsoC)songs by Faure.Tosti and others. Venue 89 - Roxburghe Hotel, 38 Charlotte Square. 19 ■ IVIOLAN An ethnicandensemble from Tuscany presents Ballads, Minstrel’s ■evening THE with PADDIE BELL FOLK SHOW AnotherBruce wonderful Traditional specialMcKenna, guests:FESTIVAL Hamish Bayne, Maggie Cruickshank, Davies, Tales, Aug 2728Sweet 13.00Lullabies (14.00) £5.00 (£3.00 C)Songs from Emilia-Romagna and Tuscany. Guy Heath, Gerry Sean Pugh, Spindrift. One night only. Aug 20.00 (21.30) £6.00 (£3.00 C) Aug 29 19.30 (22.30) £8.00 (£7.00) Aug 29 15.00 (16.00) £5.00 (£3.00 C) Kll PHILOMUSICA OF EDINBURGH OO©0 Venue 131 - Greyfriars Kirk, Greyfriars Place, Candlemaker Row. Tickets 225 1900 ■ LUCAincluding VILLANIBachClassical Guitar. Sonata,Tansman New programmeCavatina from thisandaccomplished guitarist Suite, Diabelii Granados Philomusica of Edinburgh celebrate the Festival with orchestral concerts in Vaises Poeticos. Greyfriars and Stin StMary’s Aug 17,18 21.00 (22.00) £7.00 (£5.00) internationalKirkartists Mark’sCathedral Church.and chamber concerts by local and Venue 91 - St Mary’s Cathedral, Palmerston Place J7 PLEASANCE FESTIVAL OF THEATRE ’97 OO©© ■Lovett. MOZART REQUIEM withsoloist, the Cadenza choir conducted by Graham Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550 LI4 Haydn cello concerto Robin Mason. ■TheGENO WASHINGTON - WHAT’S INBiTHE POT?late,(CABARET BAR) Aug 10 20.00 (21.30) £6.00 (£3.00 C) ‘Bard of Blues’ is back! Last festival’s ‘Mr g ’ returns loose and live Venue 131 - Greyfriars Kirk, Greyfriars Place, Candlemaker Row. Tickets 225 1900 K11 with his red hot combo ‘The Blues Question’. Its time to stop being polite and THIS (02.35) MUTHA£4.00 UP! ■Bachianus VIVALDIBrasilieras - THE FOUR SEASONS Soloist David Hume.Villa-Lobos AugCRANK 18-28 00.50 for soprano (Janet deVigne) and 8 cellos.Vivaldi 2 trumpet and Albinoni 2 oboe concertos. Aug 14 20.00 (21.30) £6.00 (£3.00 C) MARGARITA PRACATAN ©OOO Venue 26 - The Palladium, Broughton Place Tickets 557 2100 (557 6969 pre August) GI4 ■Haydn HAYDN/MOZART MozartPergolesi ClarinetMagnificat Concerto with soloistOpera RonaldCamerata Mackie. ‘La Passione’ Symphony, ■ MARGARITA PRACATAN ‘This woman makes you feel like your brain is conducted by Alison being scrambled by a ofspoon’ Clive -Jomes. Thisit allundefeatable Cubanago.New Yorker Aug 21 20.00 (21.30)Rushworth. £6.00 (£3.00 C) returns to the scene the crime where began two years Venue 91 - St Mary’s Cathedral, Palmerston Place J7 Aug 9,10,12 23.00 (00.30) £9.00 (£8.00) ■ BAROQUE CONCERT Bach; Concerto for 3 violins, Concerto for THE PRINCE’S TRUST 00©0 violin and oboe, Brandenburg 3 and works by Handel and Geminiani. Venue 10 - Holyrood Park, foot of Royal Mile. Info 226 5257 or 5259. K16 Aug 24 20.00 (21.30) £6.00 (£3.00 C) ■ THEmusicians PRINCE’S TRUST ACTION Hear some of Scotland’s talented Venue 125 - St Mark’s Unitarian Church, Castle Terrace J9 young who have benefited from The Prince’s Trust in a special concert ■baroque BANQUET MUSICK andDetails friendsatoffer you an extensive and delightful which features some‘surprise’ guests and celebrates 21 years of The Trust. menu onOFperiod platters. St Mark’s. Aug 17 11.00(17.00) Free Aug 10,15-19,21,22,24,25 15. 0 0 (16.00) £6.00 Aug 13.00 (14.00) 20.15 £6.00(21.45) £6.00 PSYCHO ZYDECO 00©0 Aug 2312,14,20,26,27 Venue 80 - Berties, 7 Merchant Street, off Candlemaker Row Kl I ■English WILLIAM REVELS (BARITONE) DAVID ARDITTI (PIANO) romantic song cycles ‘The Window’ by Sullivan & Tennyson and ‘The Just PSYCHO ZYDECO The surprise hit of last year’s Edinburgh Jazz and Blues SoAugSong10,12,14 Book’ by18.0German & Kipling. Festival are back for the Fringe.Their Australian blend of RNB, funk and cajun 0 (19.00) £5.00 (£3.00 C) folk never fail to electrify an audience. A must see for scenes of musical mayhem. ■of JOCELYN STEELE PianoScarlatti, ‘Total involvement...a deepDebussy insight&into the soul Aug 12-15,17-22 22.30 (02.00) £5.00 (£4.00) the works played’ Rameau, Haydn, Chopin, de Falla. Aug 16 21.00 (midnight) £5.00 (£4.00) Aug 10 20.00 (21.30) £6.00 (£3.00 C) ■includes CELLOwell-known & PIANOmasters Soaringandpilots Barlow return! path THE QUEEN’S HALL OO©© localMason heroesand(V. McNaught and E.Flight Neville Venue 72 - Queen’s Hall, Clerk Street. Tickets 668 2019 N13 crew on I Ith). Aug Ifor1, 15Dvorak 17.00 Quartet (18.30) £6.00 (£3.00 C) ■Bailable Ml SALSA - EDINBURGH LATINSonAMERICAN SOCIETY Fiesta Umbia, Porro, Salsa, Merengue, Cubana, Lambada, Samba, Rumba ■& Cesar DAVIDFranck, HUMEBloch’s VIOLIN, NELDA HARDIE PIANO Sonatas by Brahms Flamenca and drop Boleroand- come early for Americanwithdance class.Then dance till you then some more!freeInLatin association Corona Extra. Aug 15,25 19.30 (21.15)Nigun £6.00and(£3.00someC) delightful lollipops by Kreisler. Aug 12,19,26 22.30 (02.00) £5.00 (£3.00) ■style,KANTARO play a fascinating range of different rhythms in a contemporary ■ LENNY HENRY POOR WHITE TRASH ANDTHE LITTLE using instruments20.00 from(21.30) the mystical regionC)of the Andes in South America. HORNS Lenny Henry has always wanted to be the lead singer in a soulBIG band! Aug 16,17,24,29,30 £6.00 (£3.00 Somanyheremore. he is pumping out such classics as ‘Mustang Sally’ and‘Soul Man’ plus ®(piano),Wagner’s TAKE ME TOWesendonck-Lieder, YOUR LIEDER Sheila Graham (mezzo), Stuart Montgomery Aug 13,14 20.00 (22.00) £ 12.50 (£8.50) witty Mahler (heavy? NOT!), even some Chopin.16 16.30 (17.30) £5.00 (£3.00 C) Aug RED SOX ©O©© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ■ PHILLIDA BANNISTER CONTRALTO,ALPIN SMART GUITAR and other artists perform songs by Stuart Ward, Kurt Weill and Hanns Eisler. ■original STRAKER SINGS BRELBluesWITH 4Night FENDERS Peter Straker.star ofthethe Aug 18 20.00 (21.30) £6.00 (£3.00 C) production of Hair, in the and Ken Hill’s Phantom of ■combining CAMEOperiod present‘An Evening with Missevening Austen’.ofCostumed Opera to Edinburghasthenever essence of Jacques Brel’s haunting dramatic music with readings.‘An charm andentertainment delight’, cabaret8-30brings songs Scotsman. Aug (notinterpreted 14,28) 22.15 (23.00)before. £5.00 (£4.00) Aug 19,21 20.00 (21.30) £6.00 (£3.00 C) 54


MUSIC

One night only: MARK THOMAS

With Special Guest Star Norman Lovett 7.30pm August 24th The Queens Hall (No. 72) Tickets: 0131 668 2019 c/c Hotline 0131 667 7776

“A comedy act to treasure1 The Times

ROSEMARY GEORGE & RICHARD SHADROUI ®0©© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 22S 5105 110 ■ THE NEW YORK BROADWAY DUOAnything This internationally acclaimed twosome are back in cabaret with hits from Goes, On The Town, and Sweeney Todd.‘Moments This singer’s stamp anddelight.’ style areTheinStage themselves impeccable.’ The Scotsman of17.30afternoon Aug 9-30 (notThurs) (18.20) £5.00 (£4.00) ST ANDREW’S & ST GEORGE’S AT FESTIVAL TIME OO©© Venue 111 - St Andrew’s & St George’s Church, 13 George Street. Tickets 225 3847 HI I ASt very warm welcome awaits you in the beautiful Georgian surroundings ofin Andrew’s & St George’s Church where the spirit of the Festival thrives the presentation of another all-embracing dimensions. We look forwardfresh, to seeing you. music programme of stellar ■Daphne MERLYNTRIO Piano trios by Chausson and Brahms‘C minor Op. 101’. (violin);FreePatricia Hair (cello); Leon Coates (piano). Aug II Godson 12.30 (13.30) ■of GLITTER Sensational soprano Sarah-Jane Brown, following in the footsteps Callas, with spectacular Aug I I 14.debuts 30 (16.15) £6.00 (£5.00)and captivating French and American songs. ■ A VIEW FROM THE KIRKwritings Another entertaining hour from Quernstane, featuring Aug 12 the 12.30often (13.30)idiosyncratic £5.00 (£4.00) of 18th century parish ministers. ■contemporary COALITIONmusic(vocal/instrumental ensemble) perform exciting and tuneful Aug 12 14.30 (16.30)from £6.00around (£5.00)the world. Bernstein, de Falla, Jacob and more! ■ ORGAN RECITALS Aug(contemporary l3:Timothy Bryam-Wigfield (Bach,27:Mendelssohn). Aug 20: Michael Bonaventure organ music). Aug Leon Coates (Brahms’ organ works). Aug 13,20,27 12.30 (13.30) Free ■Britten’s MARKWILDE ANDAnALAN JACQUES Schumann’stenor’Dichterliebe’ ‘Winter Words’. ‘immaculate, light-textured Independentandwith ‘beautifully hung phrasing’ Aug 13 14.30(16.15) £6.00LES.(£5.00) ■ EDINBURGH (period instruments). for mandolin,captivating! violin,BAROCK cello, and harpsichord by Vivaldi, Italian Scarlatti,baroque Corellimusic etc. Guaranteed Aug 14 12.30 (13.30) £5.50 (£4.00) ■Sawyer VIVIEN LIUFabulous Superb soprano Geneva, returns accompanied Mack lieder(5.00)byfrom Brahms, Rachmaninov and Richard byStrauss. Aug 14 (piano). 14.30 (16.30) £6.00 ■Owen. MENAGE byA DEUX and Schumann, piano recitalMessiaen by Katherine Wake and Mark Mozart,FreeFlute Gaubert, and others. Aug 15Works 12.30 (13.30) ■Panufnik,Weir, UNTUNE Bernstein ME THATetTUNE Chopsticks and nonsense fromandRoxanna al. Jennifer Logan (mezzo-soprano) Alan Jacques (piano). Aug IS 14.30(16.15) £6.00 (£5.00) ■Conducted ST ANDREW’S AND STMonteverdi’s GEORGE’S CHOIRandANDCharpentier’s ORCHESTRA by Leon Coates. ‘BeatusVir’ ‘Messe deAugMinuit’. 16 12.30 (13.30) Free ■ CHANSON D’AMOUR French English‘skill songs.andElizabeth finesse fluent£6.00 tones’(£5.00) and AlanandJacques humour’McKeon‘vocal Scotsman. Aug 16- gleaming 14.30(16.15) ■music. TEMENOS VOCAL QUARTET A concert of contemporary sacred Karlheinz Aug 17Works 19.30by(21.30) £6.00Stockhausen, (£5.00) Michael Mullen and David Lesser. ■Serious SONGSongs’, RECITAL Cox (tenor);Sonnets’, Leon Coates Brahms’ ‘Four Britten’sJohn ‘Michaelangelo songs (piano). by Sibelius, Schubert and Copland. Aug 18 12.30 (13.30) £5.00 (£4.00) ■ SOSTENUTO TheTamsin innovative and classical accordian year by soprano Ashleyduo- ofin anfluteexciting afternoon’s recital.- this Aug joined 19 14.30(16.15) £6.00 (£5.00) ST ANDREW’S & ST GEORGE’S AT FESTIVAL TIME continues on next page

Cross-dressing gender-bending twins 8 Aug-30 Aug 8pm ASSEMBLY ROOMS Box Office: 0131 226 2428 Fringe Box Office: 0131 226 5138

LOST IN THE CITY ? See our map inside the back cover


ST MICHAEL & ALL SAINTS CHURCH OO© MUSIC Venue 95 - St Michael and All Saints Church, Brougham Street ■in the MUSIC AT ST MICHAEL AND ALL SAINTS Come & hear music setting of High whichKodaly it was (17th); written:Missa Harmoniemesse, Haydn (with orchestra)( 10th);Mass MissaforBrevis, Bel Amfitrit Altera, ST ANDREW’S & ST GEORGE’S AT FESTIVAL TIME continued Lassus10,17,24 (24th). 11.00 Aug (12.30) Free ■piano THE COATESrespective DUO Leon and Heather Coates celebrate with songs and SCOTTISH SINFONIA OOO© Aug 20music14.3the0 (16.15) £6.00anniversaries (£5.00) of Franz Schubert and Johannes Brahms. Venue 131 - Greyfriars Kirk, Greyfriars Place, Candlemaker Row. Tickets 225 1900 Kl I | ' ■on CELLO & PIANO Ronen Kory and Geoffrey Dancer, celebrated duo, ■Mahler MAHLER: SYMPHONY NOmet7with Conductor: Neilconfidence’, Mantle. OurScotsman... previous‘ Bach, Beethoven and Schubert. 7 ‘Every challenge was complete Augtheir 21 third 12.30 visit. (13.30)Sonatas £5.00by(£4.00) degree ofevent accuracy andstandards’, edge of fresh combine to make j ■a dash CZECHMozart. IT OUT! Janacek, Dvorak, Schumann, Strauss, Wolf, Mahler and The this anhigh important by any(£6.00 TES. enthusiasm Prague£6.00 soprano Aug 24 17. 0 0 (18.30) £6.50 OAP) (£4.00 C) Aug 21of 14.30(16.15) (£5.00)Zdena Kloubova;Alan Jacques (piano). Aug 25 20.00 (21.30) ■Haydn’s PIANO RECITALBrahms’ For his‘8 third visit, brilliant pianist Geoffrey Dancer plays ‘Variations’, Klavierstucke’ Op. 76 and Chopin’s ‘PolonaiseSEGOVIA GUITAR TRIO 00©0p Fantaisie’. Venue 77 -The Square Centre,Nicolson Square Methodist Church. LI2 |N Aug 22 12.30 (13.30) £5.00 (£4.00) ■ HOMAGE TO SEGOVIA remembers the legendary guitar maestro Andre , ■Mendelssohn MASTERSandOFLiszt THEplayed KEYBOARD Music by Bach, Mozart, Beethoven, Segovia in a programme of his greatest hits. The Segovia Trio ‘deserves the on the piano by Stefan Warzycki. honourable of Segovia’£6.00The(£4.50) Scotsman ****‘Exceptional’ The Times. Aug 25 19.30 (21.30) £6.00 (£5.00) Aug 19-22 name 13.00 (13.55) ■O’Sullivan,Verlaine,Yessenin. FOUR POETS, ELEVENSongCOMPOSERS Lyrics byIanMacDiarmid, recital: many rareties. Ainsworth SEXTETO CANYENGUE OO©© (bass-baritone), Patricia£5.00 Ball (piano). Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 557 8330 Aug 26 12.30 (13.30) (£4.00) TANGO PALACE In collaboration with Europe’s foremost Tango orchestra ■(clarinet), CANTABILE CELEBRATE BRAHMS (1833 -(piano) 1897) Philip four dancers Graffiti presents late nightssetting of pure unrestrained Robin Mason (cello), Michael Lester-Cribb presentGreene sonatas and romance, melancholy passionevening inthree the awesome and minor(16.30) Trio. £6.00 church - followed by (03.00) sixandmagical concerts. of this fabulous Augthe26 A14.30 (£5.00) Aug 21,22,24 23.00 £ 10. 0 0 (£8.00) Aug 25-30 20.00 (21.30) £8.00 (£7.00) ■recital. CANTUS Scottish tenor Schubert, Stuart Rathie’s SpiritualsANGELICUS! and sacred music by Handel, Franck,fourth WolfFestival and Stradella. SHAMBHALA OOO© Aug 27 19.30 (21.30) £6.00 (£5.00) Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 ■Stefan CHOPIN AND THE SPIRIT OF POLAND International concert pianist ■ SHAMBHALA A unique incontroChiambretti between Italian and byIrishIrishmusic and plays a£5.00 programme culture. Lyrics by Turin poet Felicita ‘songified’ brothers Aug 28Warzycki 12.30 (13.30) (£4.00) of Chopin polonaises and mazurkas. Martinworld and music. Joe Lynch producingatavenue. concert that encompasses Celtic melodies ■popular ENSEMBLE Scenesandfromaccompanist operas, operettas andin musicals by theconcert ever and CD available eleven singers from Fife this delightful Aug 25-30 16.00 (17.25) £5.00 (£4.00) programme. Aug 29 19.30 (21.30) £6.00 (£5.00) SHIHO SOUND JAPANESQUE OD©0 ■ ORGAN SPECTACULAR Maestro Alberto Massimostageguarantees 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 and spills galore. More amazing arrangements of familiar and screenthrills Venue favourites. ■ SHIHO SOUND JAPANESQUE Shiho spectacularly stage ‘Japanesque’ Aug 30 12.30 (13.30) £5.00 (£4.00) oriental and cosmic sounds with synthesiser, dance, voice and costumes. Shiho the musculartoendmellow of NewtheAgeheart’ music,TheanScotsman Eastern Mike Oldfield, successfullyis ■hisAN IMPROMPTU AFTERNOON WITHbySCHUBERT A selection(piano). of from creating‘melodies brilliant and well-loved masterpieces played Margaret Jaffrey-Smith Aug 11-23 (not 17) 18.00 (19.00) £5.50 (£4.50) Aug 30 14.30 (16.15) £6.00 (£5.00) ■portrayed SCUOLA GEOVIA Forgotten masterworks of renaissance Europe by choristers of international Monteverdi Voci). repute. Sweelinck (Pseaumes de David), Aug 31 19.3(Messa 0 (21.30)a Quattro £6.00 (£5.00) WANT TO BUY TICKETS IN PERSON? come Box Office ST MARY’S CATHEDRAL ©O©© or onetooftheourFringe four satellites Venue 91 - St Mary’s Cathedral, Palmerston Place J7 Details on page three ■ ORGAN RECITALS Evening concerts given Emeritus, on celebrated 1879 Father Willis instrument. 5th: Dennis Townhill (Organist St(StMary’s). Timothy Byram-Wigfield (St Mary’s). 19th: Peter Backhouse Mary’s).12th: 26th: Peter Wright (Southwark). Aug 5,12,19,26 20.00 (21.15) £5.00 (£3.00 SUD) (£ 1.00 C) ■choirs SCOTTISH CHAMBER CHOIR One of Scotland’s leading performs a programme including Handel’s ‘Zadock the Priest’chamber coronation anthems; Palestrina’s Tu es Petrus’ and the mass based onandthisother motet. Aug 17 20.00 (21.45) £7.00 (£5.00) ■ SUNDAY SERVICES 10.30 - Mozart,I SawCoronation Mass. 17th: 15.30 Walton, Chichester Service 17th: and Bainton.And a New Heaven. L’Anglais Messe Solennelle. 24th: 15.30 - Howells, Gloucester Service24th: and 10.30 i ColA^vT Bairstow, Blessed City. Aug Aug 17,24 17,24 10.15.3300 (11.30) (16.30) Free Free I pm-SpM ■unique DAILY CHORAL EVENSONG Sung by the renowned Cathedral Choir,3 in Scotland. Wednesday Aug 27 (16.00), broadcast live on BBC Radio (doors close 15.45). Aug 23,24,28) Aug 2718-2916.(not 00 (17.00) Free 17.30 (18.10) Free Til: 0131-557 5114 riNiSH OFF THE FESTIVAL DAY '7^ ■orchestra B MINOR MASS Ludus Baroque, Scotland’s acclaimed periodcharged chamber AT WHISTLE BINKIES CELTIC PARTY 1am-5aM and choir, continue a festival tradition with this highly performance of J S Bach’s magnificent setting.‘Purposeful performances VERY surprise Special Guests Different every ni with intelligence’ Aug great 9 19.3vigour 0 (21.30)and £7.50 (£5.00) Mary Miller,The Scotsman. 56


THE SPIEGELTENTBECK’S SPONSORED BIERPrinces St Tix 558 8010 Venue 87 - Famous SpiegelBY tent,Top of Waverley Centre, JI2 SPIEGEL MUJIK The ultimate global music deli. From the Antipodes, Hungary, Scotland, Africa and Ireland. Music and words from gipsy caravans, urban poets, New Orleans, Appalachian mountains salivating sounds. Free afternoon music.andSeeCeltic Venuesoul.Index.30 days and nights of ■TheTHE HONKIN’Cats,‘Madam’ HEP CATSandHang out t the mecca of jazz with a pint, Aug Honkin’ 3-7 20.30Hep(22.30) £7.00 (£5.00) more. ■TheTHE HOODANGAS down itwith young- the turksgutter! who’ll blow you away. straight(01.00) fromGet£6.00 where was6born Aug wildest 8,9,1 I-14jazz23.30 (£4.00) KEV CARMODY One honesty of Australia’s foremostwhoaboriginal a■respect. songwriter of devastating and feeling, has earnedperformers, worldwide Aug 18.00 (19.30) (19.30) £6.00 (£4.00) Aug 2114 18.30 ■ MADAM & HER ORKESTRA world’sin sexiest, singing septogenarian. The incorrigible, incomparable MadamThereturns style. Classy..,sassy...jazz/blues kabaret to kill for.‘95 sell out. Aug 2 20.30 (22.00) £5.00 (£4.00) Aug 3-5,8-13 19.17.00 00 (20.00) Aug 15-19,27 (18.00) Aug 30 23.30 (02.00) Aug 21-25 12.30 (13.30) Children under 12 Free ■ ERIC BOGLEforINwhich CONCERT Eric(With comes horn bringing a new song-bag and Augthe20,21classics 20.00 (21.30) he£7.00is known. (£5.00) Brent Miller, John Munro) ■singBLUE HOUSE the Fringe i l996.They’re raunchy, hilarious and like10,26angels. Don’tStormed miss them. Aug 23.30 Aug 23-25 17.00 (00.30) (18.00) £6.00 (£4.00) ■spunk..those THE WELL OILED SISTERS lusty, gutsy sassy cowgirls are(£4.00) set toFast,blastfurious, your boots off! and full of Aug 22 17. 0 0 (18.00) £6.00 Aug 25 19.00 (20.00) ■street RUBY FRUIThipJUNGLE Dynamic, versatile &alltraditional girl band plays hop, rap, pop, funk, accapella AfricanBrazilian songs. Dance3-5rhythms, & groove! Aug 23.30 (01.00) £6.00 (£4.00) Aug 22-25 14.00 (16.00) ■ JUDY discovery. JACQUES’Distinctive, LIGHTHOUSE gospel,improvisations.Trumpet, new music. Songs of journeys, passionateJazz,andfolk, soaring tuba, bass flute, guitar. Aug 4,5,7-10 17.00 (18.30) £5.00 (£4.00) ■performances THE SENSITIVE AGEOil,COW PERSONS humour,- theawesome of- Bluegrass AC/DC,NEW Midnight Hendrix, Elvis,TheBlack Supremes way God intended style! Aug 26,29 19.00 (20.00) £6.00 (£4.00) Aug 27 23.30 (00.30) ■powerful JUDY delivery. SMALLJudy’s Australian her soaring voice &and musicsinger-songwriter has been recordedknown by EricforBogle, McCalmans Ronnie26 Gilbert. Aug 17.00 (18.30) £7.00 (£5.00) Aug 27 20.00 (21.30) KNOCKING ONbutKEVIN’S DOORto him Kevinthanis ameets Roadie,thea sound l ■‘Two, two...one, more eye. techie: Aug 27-30 12.30two..’ (13.30) there’s £6.00 (£4.00) RORYDon’t MCLEODthisINvisitCONCERT Fringe favourite Rory hasn’t been for ’i: ■aAug while. he’s magic,‘powerful and political’. 30 19.00 miss (20.00) £7.00 -(£5.00) THE STUDIO THEATRE COMPANY Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 K10 I ART,songs SEXfrom ANDthePOLITICS -byGERMAN CABARETBrecht/Weill, SONGS Cabaret 20s and 30s Tucholsky/Hollaender, and Gershwin/Weill. Performed in the original and partly in English byBrecht/Eiser Josephine Allendort. Aug 8-17 22.15 (23.00) Aug 18-24 23.30 (00.15) £4.50 (£3.50) 00.0© THE SUMMER OF LOVE DANCE PARTY JIO Venue 112 - The Ross Theatre, Princes Street Gardens Tickets 467 2551 ■ A BENEFIT FOR WAVERLEY CARE AN AIDS TRUST Top I ground-breaking Edinburgh dance dance clubs unite fundraiser. Seventhehours of non-stop musicforin this the open air below castle.What better I, way Sunday £7.00 afternoon? Aug to24spend 13.00a(20.00) (£6.00)

THE PARAMOUN

B

CGM BENEFIT

THE BEST OF EDINBURGH ’97’S VDDNG TURKS OH A SIHGLE BIEL

lOPM

2i!S

TICKETS E10 / Mconcs ASSEMBLY ROOMS 0131 226 ASSEMBLY + GILDED BALLOON 2428 + PLEASANCE ALL PROFITS WILL GO TO OIV/AIDS CRARITIES IN EDINDURGO 57


■PhilipNEAPOLITAN E RACCONTI Dl NAPOLI) Contini,‘padroneSONGS di casa’(CANZONI ofValvona & Crolla, sings Neapolitan songs and and celebration accompanied by the romantic guitar of LucaVillani. Aug 13-16,30 20.00 (21.10) £6.00 (£4.00) Aug 27,28,29 18.00 (19.10) £6.00 (£4.00) LUCAVILLANI OF GUITAR from the THE TARANTINOS ®o©o ■Italian Renaissance viaPLAYS: the era across ofFIVE ItalianCENTURIES Opera to Piazzola’s tangos. LucaVillani Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 takes us on a musical journey the five continents to discover a kaleidoscope of exciting EVERYareDOG HAStoITS DAY The musicstage fromshow. Quentin Tarantino’s cult Aug 13-16 11.00 (12.00)guitar £6.00colours. (£4.00) movies brought life in one amazing All the best known hits performed by your favourite characters. With a wry look backstage at the THEVENUE Augmusicians. 8-23 23.00 (00.10) £5.00 (£4.00) Venue 158 - The Venue, 15 Calton Road Tickets 557 3073 Venue 33 - Pleasance, 60 The Pleasance. Tickets 556 6550 ■Inferno: THEVENUE Pure: (Saturdays). legendary house and techno gay clubfun(Fridays). Disco busyMotherfunk: 70s disco dance club ■PulpTHE TARANTINOS The music from Quentin Tarantino’s cult movies, (Sundays). funk, soul(Thursdays). andFuntimes: hip-hopTribalmixed clubFunktion: (Tuesdays). Messenger: Fiction and Reservoir Dogs are brought to life in one amazing stage show. reggae and dub sound system Scotland’s finest AllAugthe9-15best00.50 known(01.50) hits performed underground dance club (Saturdays). £2.00 by your favourite characters. Aug 8-10,12,14-17,19,21 -24,26,28-30 22.30 (04.00) TRON CEILIDH HOUSE WALLINGFORD PARISH CHURCH CHOIR ®OOQ Venue 9 -Tron Ceilidh House, 9 Hunter Square, High St. Tickets 220 1550 Venue 45 - Old St. Paul’s Church & Hall, Jeffrey Street. J13 | ■Ponomarev VALERYfronted PONOMAREV QUINTET Brilliantfor New Yorkandtrumpet star ■ WALLINGFORD PARISH CHURCH CHOIR TheSchubert’s 30 strongMass choirin Art Blakey’s Jazz Messengers 4 years is now world from Oxfordshire presents a varied programme including famous! CatchShells Valery(bass) in Edinburgh Russel Cowieson (Sax), David Milligan G, motets, folk-songs and instrumental works.The Edinburgh visit follows I996’s (piano),10-16 Brian and Bi(£5.00) l with Kyle (drums). successful Aug 22.00 (00.30) £7.00 Aug 8 20.00CD-producing (22.00) £5.00Dublin (£3.00)tour. We promise something for everyone. ■SESSIONS THE TRON3pmCEILIDH HOUSE TRADITIONAL FOLK MUSIC to 6pm and 9pm to 12pm the Tron is at the centre of HANKWANGFORD OO©© Edinburgh’smidday folk and jazz music. Come along - all welcome. Bar meals Venue 90 - Graffiti,Corner Broughton and East London Streets Tickets 557 8330 GI3 available to 7pm. Aug 4-30 15.00(18.00) Free ★ ■ WAKE UP DEAD Hank Holiday Hoedown with the sincerest cowboy Aug 4-30 21.00 (midnight) Free inDead’ town.tourHankforand thenights Lost ofCowboys bring heartbreakers the fabulously and successful three(21.45) toe(£7.00) tappers, mighty‘Wake tall tales.Up ■ JAMES MALCOLM -THE lyrics NEWandTRADITION Themusic voiceonoftheScotland 23,24 20.15(01.00) £8.00(£7.00) today’ his sharp-sighted soft jazzy Scots state Aug Aug 25 23.30 £8.00 ofinvigorating’ the focuses nationThewhile warmly reflecting its history and land ‘New, fresh and Scotsman Aug 11,13,14 19.30 (21.00) £5.00 (£4.00) WHISTLEBINKIES OOO© ■ CHANTAN -THE NEW TRADITION ThreeKydd. of Scotland’s finest Venue 111 - St Andrew’s & St George’s Church, 13 George Street. Tickets 225 3847 HI I vocalists Elspeth Cowie, Corrina Hewat, Christine Stunning harmonies ■ WHISTLEBINKIES One ofoldScotland’s longest established traditional music from brilliant debut album Primary Colours.Tradition with a new slant - blues groups perform Scottish music and new in a wonderful acoustic setting and jazz influences.‘Sparkling new triumvirate’ The Scotsman with and ScotsFling’ song, lowlandonbagpipes, clarsach, flute, fiddles, concertina, j Aug 20-23 19.30 (21.00) £5.00 (£4.00) drums.30Gaelic CD19.30 ‘Wanton ■harpBACHUE CAFEHewat - THEfuseNEW TRADITION Top vocals andandCeltic/jazz Aug (21.30) £6.00available (£5.00) Greentrax. from Corrina with the wizardry of jazz pianist guitarist David MilliganThetoLiving createTradition an inspiring new sound. Folk jazz fusion.‘Sheer musical WHISTLEBINKIES UNPLUGGED CELLAR CLUB expression’ Aug 29-3 I 19.30 (21.00) £5.00 (£4.00) Venue 170 - Whistlebinkies, 5/6 South Bridge KI3 ■TheBRIAN MCNEILL - THEtwoNEW TRADITION A leading of New Tradition for over decades (BattlefieldmostBand, Clanvoice Alba etc). WHISTLEBINKIES UNPLUGGED CELLAR CLUB Every day: Hear tales Many of his songs are hailed as classics.‘Scotland’s meaningful of torture, horror and Edinburgh from a real white witch 13.00 17.00.The contemporary The (£4.00) Scotsman ‘Obscenely talented...’ Eric Bogle best rock,Binkies blues, Celtic folk LIVEparty22.00 - 01.00. PLUS finish your festival day with the Aug 15-18 19.songwriter...’ 30 (21.00) £5.00 Whistle Aug 4-30 4-30 22.00 13.00 (01.00) (17.00) £3.00 £2.0001.00 - 05.00. ■(EasyRODClub,PATERSON -THE NEW TRADITION A Scots folk legend Aug Jock Tamson’sRod’s Bairns,achingly Ceolbegwarm etc).You miss this all Aug 4-30 01.00 (05.00) £5.00 too tonescannot in a pureaffordsolotoperformance. Sheerrare class.chance19.to30hear Aug 24,26-28 (21.00) £5.00 (£4.00) WORLD MUSIC ON 2 GUITARS oo©© Venue 94 - Columcil e Centre, 2 Newbattle Terrace (next to Dominion Cinema) Tickets 229 0560 VALVONA & CROLLA OO©© Venue 67 - Valvona & Crolla, 19 Elm Row, top of Leith Walk. Tickets 556 6066 G15 ■ NEIL STEWART & DAN PERRY Cross cultural meeting of Scottish Neil ofStewart Israeli modernacoustic jazz guitarist Dan Perry,& ■ THE EDINBURGH QUARTET - Afrom CLASSICAL CHOICE Join us the flamenco fusing in aguitarist programme originalandcompositions, jazz / flamenco for a Taste of Europe’. A musical journey Scotland to Austria, savouring vocals. delights of the string quartet at its best. Works include Boccherini, Dvorak and Aug 11-30 (not Suns) 21.00 (22.30) £4.00 (£3.00) Borodin. of wine.£ 10.00 (£8.00) Aug 25,26Free11.glass 00 (12.10) FREI ZINGER OO©© ■ EDINBURGH YOUTH ORCHESTRA YoungEdinburgh Italian Youth Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LI4 flautists Angela Camerini andquartets Andrea Olivi joinENSEMBLE members of the Orchestra Ensemble, playing by Mozart, Puccini and Boccherini, in the ■ FLUTE DREAMS Following a major feature on BBC Radio 4’s real Italian atmosphere of Europe’s famous delicatessen. Free pizza and wine. Kaleidoscope and a national UK tour, Frei Zinger returns to Edinburgh for Aug 27,28 11.00 (12.10) £6.00 hisenchanted third successive year to launch hisandnewdreams. album ‘Seasons’. Experience an musical11.30landscape ■minor DONALD GILLAN SOLO CELLIST willDonald, performa freelance Bach Suitecellist No5 from in C Aug 18-21,25 (12.15)£4.00of£3.50light (£3.00) and Thomas Wilson’s ‘Fantasia for Cello’. Aug 22-24 11.30(12.15) (£3.50) Glasgow, playsin numerous frequentlyvenues. with the Scottish Chamber Orchestra, and as recitalist and Augsoloist 30 11.00 (12.00) £6.00 (£4.00) MONEY.WOODSTOCK TAYLOR AND OO©© AZOOT STRAWB ■Handel,Vivaldi LOKI ENSEMBLE ‘MASTERS OFcontemporaries. THE BAROQUE’ Music byvary,Bach, Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 and their lesser-known Programmes and feature and permutations of Soprano, Baroque flutes, oboes, recorders, viola da ■ ZOOT MONEY.WOODSTOCKTAYLOR AND A Edinburgh STRAWBsong TV star gamba harpsichord.‘Breathtaking...pure delight’ The Scotsmon;‘Excellent’ and British Blues legend Zoot Money joins up-and-coming The Herald. writer Woodstock Taylorsongs and Strawbblatant Brianentertainment. Willoughby for an unplugged and Aug 11,12,18-20,22,23 11.00 (12.10) £6.00 (£4.00) surprising Aug 23-28bill18.of15quality (19.15) £6.00and(£5.00) 58


For a Fun

Family Day Out cone to

Holyrood

Park

n0

" ^3‘ns Uarl

ptore [un in tie son HISTORIC nQn SCOTLAND Sunday 17th August

59


“This dazzling company is the future of music theatre” NATIONAL YOipiI m#*ic TTIEATKE Supported by ANDREW EEOYI) WEBBER 9-25 August

LIUi The Valiant; Apprentice A new musical fantasy romance set in the 1 7th centurpfrom the writers of the 1994 award-winning Pendragon

Some cards get your message home faster than others. The more exciting things you experience in the U.K., the more you’ll value AT&T. We make sharing the fun back home and around the world fast and easy. Just dial the AT&T DirectSM Service Access Number 0800-89-00-11 or 0500-89-00-11, then bill your calls to your AT&T Calling Card, AT&T Universal Card or call collect to the U.S. You’ll get the fastest1 connections and clearest sound quality on calls to the U.S.* So when you want to call from the U.K., use any of these AT&T cards. They sure beat postcards. By weeks.

By Peter Allwood, Joanna Horton, Jeremy James Taylor and Frank Whately Commissioned by the National Youth Music Theatre 12-24 August “Simply terrific” (0 Evening Standard Big-band jazz musical version of AM Baba and the Forty Thieves Music by David Nield, Book and Lyrics by Jeremy James Taylor By arrangement with Josef Weinberger Limited

AT&T 'Fcarriers astest, clearest connections from countries voice prompts compared to major U.S. callsand to themanyU.Slocal . Clearest based with on company customer preference CorporateonCard telephone calling cardstesting. can also"Thebe AT&T used. http://www.att.com/traveler ©1997U.S.AT&T. 60

.ASSEMBLY ROOMS BOX OFFICE 0131 226 2428 Programme details subject to alteration


AGAPE THEATRE CO. OOOO Venue 188 - Seventh Day Adventist Church, 3 Bristo Place Tickets 225 2819 L12 ★and■sacrifice. REDEMPTION SONG A precarious journey of desire, control, love Chad and Lydia search for Utopia allegorising the human diaspora through this world ‘unparalleled voices!... unparalleled RASA,Christian Intercultural Holland.Tremendous!’ Director S.LC.' A delight... hugelysongs!’ enjoyed!’ Herald. Aug 10-16 (not 13) 20.00(22.20) £5.00 (£4.00) AMERICAN HIGH SCHOOL THEATRE FESTIVAL oo©o06 Venue 137 - Church Hil Theatre, Morningside Road BIG RIVER:THE ADVENTURES OF HUCKLEBERRY FINN Mark Twain’s tale two of Huckleberry and the his friend, been settotoa a lively musical classic score.The fugitives floatFinndown mighty hasMississippi travelogue of American musical styles and adventures. Aug 18.05 (19.55) £3.00 (£2.00) Aug 10,12,14 16 10.05 (11.55) Venue 128 - Youth International at St Oswald’s, Montpelier Park Info/Tix 346 1405 or 229 5562 N6 ★ CHASING DEADLINES is Chicago a world premiere specifically student performers from severalAbramson area created high created schools.Windy Cityforauthors, Allan Chambers andchallenges Deborah have this ‘musical tabloid’ of contemporary teen and greater worldly issues. Aug 10,12,14 10.10(11.50) £3.00 (£2.00) Aug 17 18.10(19.50) QUILTERS The story of afrontier pioneerwith woman and six daughters the lot of manyofwomen on the love,herwarmth, humor andandmoving spectacle human dignity in £3.00 the face(£2.00) of the adversity. Aug 10,12,15 22.45 (00.15) Aug 11 18.15(19.45) Aset(ROCK-N-ROLL) MIDSUMMER NIGHT’S DREAM Shakespeare’s in a 1950’s Poetry Americanbuilds HightoSchool, complete with ‘greasers and for a text, cheerleaders’. great 50’s Rock & Roll tunes making spirited version 16.10(17.50) of this classic£3.00 comedy. Aug 1610,12,14 (£2.00) Aug 10.10(11.50) TUMBLEWEEDS A cheerfully irreverent atlyrics the American ‘Oldjokes. West’ burstingjoinwiththegood humor,ofwonderful music,aslook lively anddance hilarious Come residents Grimey Gulch they sing and their way through gun fights12.10(13.55) and Indian £3.00 attacks.(£2.00) Aug 1411,13,15 Aug 22.40 (00.25) WORKING / PLAYING Working isinbased onandStuds bestseller about Americans atAudience work. Stylish and variedbecome tonesketches tune.atTerkel’s Playing - whose improv isAugit, anyway? suggestions the speed of laugh. 10.10 (11.55) £3.00 (£2.00) Aug I171, 13,15 16.10(17.55) THE ARTHUR TERRY SCHOOL OOO© Venue 167 - Moray House Theatre, Canongate/St John’s Street Tickets 667 2212 K14 ★ ■ ‘LET ITwithBE’a story - THEabout MUSICAL Twentychildren classic(John, BeatlesJudith), songssetcleverly interwoven two adopted in Liverpool the 60s.Thistriesmusical is a moving account as tension between them risesinwhen Aug 24-27 21.15Judith (23.30) £6.00to find (£5.00)her biological Mother. BRUNSTANE NORTH OOOO Venue 43 - Royal Museum of Scotland, Chambers Street. Tickets 225 9954 KI2 ■Century BRODIE! In this Fringe premiere, the life and loves of notorious 18th Edinburgh character Deacon Brodie are brought to life in this highly entertainingshow’ new musical.You’ll laugh, you’ll greet - get a seat! ‘A wonderful, wonderful Aug 11-16 18.30Noda (20.45)Magazine. £6.00 (£4.50) BUNBURY & CO ®0©0 Venue aincy Centre, I 1332 BristoI0am-5pm) Square, (near Fringe Club) Tix 650238201- Chapl(pre7Aug65l LI2 GILBERT & SULLIVAN GO WILDE This Fringe 1995 sell-out hit returns, combining the wittyvillage lyricsofofBunbury Gilbert and humour ofhow-de-do! Oscarsparkling Wilde.music Visit theandleafy and Sullivan preparewith for athe veritable Aug 9-18 21.30 (22.30) £6.00 (£4.50) COWARD’S ‘Play,andorchestra, play’Master, as we present a relaxedCalling cabaret featuringCHOICE themadwords music of the Noel Coward. Mrs Worthington, dogs and Englishmen, hopefully you’ll not question ‘why must 9-18 the show on’! £6.00 (£4.50) Aug 22.50go(23.50)

MUSICALS & OPERA CAMBRIDGE OPERA GROUP ©O©© Venue 167 - Moray House Theatre, Canongate/St John’s Street Tickets 667 2212 K14 ■masterpiece THE BEAR William Walton transforms Chekhov’s classic drama into a of comic opera. Romantic intrigue meets Russian farce in the cathartic tale ofanda woman’s for liberation from the beast in us all. An orchestral theatricalstruggle extravaganza! Aug 00 (19.00) £5.00 (£4.50) Aug 8,10,12,14,18,21,25,27 16,23 18.00 (19.00) £6.0018.(£5.00) ■in ALennox DINNER ENGAGEMENT Culinary and emotional converge Berkeley’s beautiful just fairytale. Matchmaking’s onstarts thecrises menu: whenseven the dress doesn’t fit, the lipstick’s wrong and the oven to smoke, outstanding young singers cook up a magical feast. Aug 1,13,20,26,28 00 (19.00) Aug 9,115,17,22,24 18.00 18.(19.00) £6.00£5.00 (£5.00)(£4.50) CAMBRIDGE UNIVERSITY ADC ®0©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ■moving COMPANY Recently revived in theLiberty West-End, Sondheim’s powerful and explores love,‘Life, and the happiness’ with an hit-musical unforgettable score. From the*****people behind lastpursuit year’sofstorming success,‘Chicago’ ‘kill for a ticket’ Scotsman. Aug 20.10 £7.50 (21.45)(£6.50) £7.00 (£6.00) Aug 6-11,13,14,17-19,21,25-27 15,16,22-24,29,30 20.10 (21.45) THE EDINBURGH UNIVERSITY FOOTLIGHTS ®G©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★ BIRTHself-fulfilment. OF A MANRockExperience the journey through mind, seeking opera,leavecontemporary danceyouranda confused a myriad ofonspecial effects, this world premiere will you questioning own beliefs life in today’s society. Aug 8-14,19-21,24-27 22.15 (23.50) £6.50 (£5.00) Aug 15-17,22,23,29,30 22.15 (23.50) £7.00 (£5.50) EDINBURGH WORKSHOP FORTHE EXPRESSIVE ARTS OOO© 06 Venue 137 - Church Hil Theatre, Morningside Road 42ND STREET for A sparkling and innovative production ofwellthisknown hit musical set during rehearsals a 1930’s Broadway show. Featuring toe tappers ‘Lullaby of cast. Broadway’,‘We’re in the Money’ all performed by a talented young Edinburgh Aug 26,27,30 19.30 (21.30) £5.00 (£3.00) Aug 30 14.30 (16.30) £5.00 (£3.00) MALONEcomedy Fat Samgangster says don’t miss Come our witty production ofbyBUGSY this sidesplitting musical. see and this engaging tremendous show a fantastic cast (21.30) of talented Aug 28,29 19.30 £5.00Edinburgh (£3.00) children. A must for all the family!! EDINBURGH YOUTH MUSIC THEATRE O0©© Venue 69 - Broughton High School, I Carrington Road. Tickets 336 1081 E7 ■Broadway BRIGADOON Lerner andSetLoewe’s (creatorsHighlands of My FairandLady) stunning and West End hit. in the Scottish featuring a nonstop cavalcade ofsmash song hithits,- spectacular dance routines, comedy and romance. Another EYMT book early! Aug 11-19 (not 17) 19. 1 5 (21.45) £6.00 Aug 16 15.15(17.45) £5.00 (£3.50) (£4.50) ■ HOT MIKADO Gilbertera,andblues, Sullivan’s Mikado is re-set inrecent the 1940s featuring the styles gospelthose andkimonos swing.This West--End hit isunmissable! the jazziest show ofonthat the Fringe. Catch and zoot suits Aug 24) 19.£5.00 15 (21.45) Aug 22-30 30 15.(not 15 (17.45) (£3.50) £6.00 (£4.50) THE FANTASTICAL THEATRE COMPANY 00©0 Venue 117 -Viewforth Centre, 104 Gilmore Place Tickets 229 7659 M6 THE FANTASTICKS ‘Alongest boy, a running girl, twomusical fathers,off-Broadway.‘Fantastical’ a wall’ - the ingredients which have produced the characters in a timeless story of love and growing up. Aug 19-23 sing20.15upbeat (22.15)numbers £5.00 (£4.00) FORTH CHILDRENS THEATRE ®OOQ Venue 120 - Inverleith Church Hall, Ferry Road (opp Granton Road) Tickets 538 6077 A9 ■much OLIVER! Edinburgh’s most exciting young theatre company present thisand loved familywithmusical. Freshthisfrom their 1996tosuccess with Oklahoma earlier this year Barnum, show is sure be a winner. Do you want some more?19.30 (21.40) £5.50 (£4.50) Aug Aug 8-16 9,16 14.30(16.40)


TINthePAN ALI Big-band jazz musicalslick-talking transports AH1930sBabaChicago. and theInfectiously Forty Thieves razzamatazz of family a fast-moving, MUSICALS & OPERA tohilarious unbeatable entertainment from the 1996 Bugsy Malone directors.‘Extraordinary....irresistible...simply terrific’ (Evening Standard). Aug 1213,17,19,21 16.30 (18.45)13.30£7.00 Aug 15,23,24 (15.45)£10.50 £9.50(£8.00) (£7.00) Aug 13.30 (15.45) 14,19,20 16.30 (18.45) £9.50 (£7.00) HARD KNOCK KAFE KIDS 00©0 Aug Venue 137 - Church Hil Theatre, Morningside Road 06 Aug 16,22,24 16.30 (18.45) £10.50 (£8.00) ■Watch ANNIE Orphan Annie strums the heartstrings of wealthy Warbucks & co. her Lill.THE defy the ultimate hateful Hannigan and sidekicks ‘razzle-dazzle’ and NORTHWEST LEICESTERSHIRE YOUTH THEATRE oooo the ‘lovely’ up-beat solution to 1930s depression.Rooster Fast-moving Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 family entertainment suitable for aspiring politicians! Aug 19-23 19.30 (22.00) £5.00 (£3.00) ■ BUGSY MALONE After a sell out with rave reviews in Leicestershire,THE Aug 22 14.30 (17.00) UNLIMITED messiest of allattime. Bursting withTHEATRE enthusiamCOMPANY and humour,bring there’syounothedoubt we’reshow the best being bad guys! HARLAND HAMSTRINGS THEATRE COMPANY OOQO Aug 11 -16 13. 0 0 (14.15) £4.50 (£3.50) Venue 79 - The Subway, 69 Cowgate K12 ★ NICE ‘Mistresses caricature’ Scotsman 60’s spiceMusical from five ONTHE ROAD OOO© ‘nice’ girls,-GIRLS thirty years before- oftheir time (always - From Hull ‘96. tothan Eternity! LI3 premiere Old/Dyslexic New Songs Live Band better a dead one!) comedy - Family Venue 16 - Southside Courtyard, Davie St. Tickets 6672212 show.' M agcila’ Times. ■Corruption, HIT THELove ROAD A rocking newCanfamily musical about Greed, Power, Aug 11-23 (not Weds) 14.00 (15.45) £4.00 (£3.00) and Traffic Lights. Morris Minor defeat Portia and Val the fastestroadbitches on four wheels? Are the beetles as good as they say? Hit the JASPERIAN THEATRE COMPANY OO©© Aug 25-30 14.with05 them? (15.00) £4.00 (£3.00) Venue 77 - The Square Centre, Nicolson Square Methodist Church. LI2 CHARLES WESLEY 1707 and Costumed dramagreatest focusinghymn on OPERA INVENTION 00©0 18th century socialandconcerns religion:Georgian focusing onmusic world’s Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 writer, also poet preacher. Inspiration. Intrigue. Passion. Controversy. Aug 21-23,25-30 19.30 (21.40) £6.00 (£4.50) ■ DON GIOVANNI Seduction, deceit, revenge; throw in a ghost and a Aug 24 14.30 (16.40) sword-fight, and you have the most dramatic and beautiful of Mozart’s operas. Funny, fastrising moving sexploits in 1940s England. Well-known tunes sung in English stars.£5.50 K C PRODUCTIONS LTD ®0©0 byAugseven 17-23 16.young 30 (18.15) (£4.00) Venue 45 - Old St.Paul’s Church & Hall,Jeffrey Street.Tickets 556 0476 JI3 ★ DIY -club THEin MUSICAL A sexy, viciously funnysongs, nightstunning out. Bedancers part of and the most OPERAWORKS OO0O dazzling town,The Sex Pack. Electrifying a razorVenue sharp script20.15 combine outrageous Info/Tix128346- Yout 1405h International or 229 5562at St Oswald’s, Montpelier Park N6 Aug 8-23 (21.45)in an£6.00 (£5.00) tale of money, murder, revenge and sex. ■ DIDO Imaginative production of Purcell’s powerful tale love andAND fateand-AENEAS thenovelgreatest early English opera. Music theatre with beautiful LEICESTERSHIRE YOUTH ARTS 00©0 ofchoreography use of video.‘Everyone was excellent, including the Venue Ann’sfrom Community orchestra’ Tickets65557- St0469 6 AugustCentre, South Gray’s Close, Cowgate. KI3 very Aug fine 19-23chorus 16.00and(17.15) £5.00 Sheffield (£3.00) Telegraph. ■Be HAIR American TribalyouLoveare,Rock Musical byyouRagni, free, noTheguilt, be whoever do whatever wantRado - justanddon’tMacDermot. hurt OZMOSIS PRODUCTIONS ®0©@ anyone! up your Venue 90 - Graffiti,Corner Broughton and East London Streets Tickets 557 8330 GI3 Aug 11-23Pick(not 17) glow 20.00worms (21.00)and£4.50glow!(£3.50) ★ ■ OZdrama, - KING OF CLUBS Ground-breaking MUSICAL THEATRE fusing of live music within the club culture; the show charts the fortunes NATIONAL YOUTH MUSIC THEATRE ©O©© dance, promoter, Original material conceived,festival written, performed by young Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 aspiring Edinburgh talent11,18,23) withOz.impressive award-winning Aug 8-30 (not 21.15 (22.25) £6.00 (£5.00) success. ★romance AURELIUS.THE VALIANT APPRENTICE New musical fantasy set in1994). 17thFemale centurypirates, England and Turkeywhales, from writers Pendragon lions, (Fringe First, colourfulofforcostumes, PETTICOAT OPERA 00©0 horses,9 comedy and exotic adventureshipwrecks, - rollicking entertainment all ages. Venue 122 - St Cuthbert’s Parish Church, 5 Lothian Road J9 Aug 16. 3 0 (18.45) £7.00 Aug 10, 1 1, 13,17,18,21,25 16.30 (18.45) £9.50 (£7.00) ★ ST MATTHEW by Oonagh Bernon. Bringing theatre and opera to the Aug 14,18,20,25 13.30 (15.45) £9.50 (£7.00) church with words straight from the Bible. Lively tuneful meaningful. Lena Aug 10.50 (£8.00) (£8.00) PhillipsSermon and members of Petticoat Opera present The Healings of Jesus’, Aug 15,23 16,22 16.30 13.30 (18.45) (15.45) ££ 10.50 ‘The the Mount’ Aug 16 16.00on(17.30) £4.00 and (£2.50)‘the Lord’s Prayer’. ■Phillips. THEAOPERA DIVA A new allwhich womannoopera company directed by- enjoy Lena glamorous performance operaMagic loverFlute,The should missMarriage CREDIT CARD SALES 0131-226 sias lines) again scenes frombeautiful Carmen, Madam Butterfly.The of Open 10am-6pm (June ft July), 9am-9pm1 (10(August) Figaro and other Arias. Aug 18,19 17.00 (19.00) £4.00 (£2.50) The Award Winning Stage 84 Presents

Directed by ADRIAN McKAY

J)oN Choreographer ANDREA MALLEN

THE ACCLAIM AY MUSICAL August Uth to Uth 7.1) itinee at 2.15pm Adults £<1| rn Cotiro'--. uw £4.50 Box Office (0j§85) 24 ) 2265138 62

OPERA INVENTION presents

GIOVT^I 17-23 AUG. 4.30pm MARCOS VENUE 98 tickets £5.50 & £4 cones. Box office 228 9116


PLUNGE! PRODUCTIONS 00©0 Venue 98 - Marcos, SS Grove Street. Tickets 228 9116 K7 ■offers INTO THE WOODS Stephen Sondheim and James Lapine’s musical story a modern-day twist on traditional fairytales. Cinderella, Rapunzel et al are thrown together with very surprising results...suitable for adults and older children. Aug 17-23 18.45 (21.05) £5.50 (£4.50) PROSCENIUM THEATRE COMPANY 00©0 Venue 187 - St Giles Cathedral, High Street, Royal Mile J12 ■passionate JEANNEstory D’ARC An emotive new musical telling the enigmatic and ofversion Joan ofinArc,medieval the world’s mostin famous heroine. gothic Presented hereSt asGilesa concert costume the magnificent setting ofAug Cathedral. 18,19 19. 4 5 (21.45) £9.50 (£6.00) (£7.50 for Friends of the Festival Theatre) THE R.A.T. PACK OOO© Venue Info/Tix128346- Yout 1405h International or 229 5562at St Oswald’s, Montpelier Park N6 THE HIRED MANofThe youth oflife,South Cumbriaby the gatherauthor to bring youBragg The and Hired Man’, a story Cumbrian supported Melvyn composer Howard Goodall.A passionate and moving musical which is uniquely MADE25-30 IN CUMBRIA. Aug (not 28) 19.00 (21.00) £5.00 (£4.00) THE REALISTIC EDINBURGH THEATRE COMPANY OF (DO©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★ BARRIE A musicalbyjourney through the life of theyouth man who wrote ‘Peter presented Scotland’s companies. The truePan’lifestory of one one manofwhich is evenpremier stranger thantheatre the fiction heAugcreated. 8-30 (not 10,17,25) 16.10 (17.50) £6.00 (£4.50) (£3 for school parties) THE SCOTTISH THEATRE AND MUSIC SCHOOL ©OOO Venue 88 - St Stephen’s Centre, Foot of Howe Street Tickets 556 2661 FIO THE WIZARD OF OZ Follow the yellow brick road with Dorothy on her magical journey to the Emerald City. Our all children cast present a colourful storybook version19.05of this classic£6.00tale(£4.50) for both young and young at heart. Aug 5-9,12-16 Matinees Aug 9,16 14.(21.05) 05 (16.05) £6.00 (£4.50) SHREWSBURY SCHOOL OOO© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★a fantastic ■ THEnew TIMEmusical MACHINE Fringe First winners from 1995 return with on Wells’s celebrated tale. Travel with us into a future of song,14.00dance(15.45) andbased spectacle.‘Best Aug 25-30 £7.00 (£5.00) musical this year’ Chris Eldon Lee. SMARX ARTS CREW OOO© Venue 27 - Lauriston Hall, Lauriston Place Tickets 0802 774800 K9 ★how■ things GENESIS?..! DIDbeen’. IT MY WAY A comical musicalsongs adaptation of ‘might have With sixteen unforgettable and non-stop laughter, new production is bursting with energy. Don’t miss it. Aug 24-29this 19.fresh45 (22.00) £3.00 (£2.00)

SHIHOs Spectacular Stage JAPANESQUE” Oriental & Cosmic Sounds with sy j lance, human voice, and lights Allg. 11th ~ 16th (6:00pm~ 7:00pm) 18th — 23rd (6:00pm~7:00pm) GARAGE THEATRE Venue 81 Jrindlay court centre Srindlay street court BOX office Tel. 0131 -229-7941) £ 5.5 (£ 4.5) ‘resented by SHIHO sound Japanesque

MUSICALS & CPCRA STAGE 84 OOOO Venue 93 - James Gil espie’s High School, Lauderdale Street. Tix 0385 244984 N8 ■winning ANNIEStageIn 84theirpresent 7th year at the Fringe the nationally acclaimed, award Annie, the story of the most beloved orphan of all times won seven Tony Awards and became one of the longest running musicalswhich on Broadway. Aug 19.15 (21.45) £6.50 (£4.50) Aug I161-1614.15(16.45) TRIP 26 THEATRE COMPANY ©O©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 6672212 MI2 ■Come, CABARET If you could your see through their eyes, SallyJoincould be a star... drink with Berlin guts willTrip be garters! the musical cabaret (keep going straight end or£5.00 of the(£4.50) world...). 26 presents the Cabaret. Aug 9-24 00.15at the (02.15) UNION THEATRE 00©0 Venue 93 - James Gil espie’s High School, Lauderdale Street. Tix 01968 675642 N8 AExperienced FUNNYTHING HAPPENED ON THE WAYTO THEmusical FORUM Fringe players bring comedy tonight. Sondheim’s masterpiece. Unashamedly romp,with slaves,titillating courtesans, unite totunes. pleasure you. Unabridged,rudevalueRoman for money togas,eunuchs tremendous Aug 19-23 19.15 (21.45) £5.00 (£4.00) VOICES OF THE SOUTH & THEATRE WHATSITOQ©0 Venue cy Centre, I 1332 BristoI0am-5pm) Square, (near Fringe Club) Tix 650238201- Chapl(preain7Aug65l LI2 ★based ■ SCHOOLHOUSE ROCK, LIVE!television A dynamic new American musical on educational Saturday morning cartoons aired in the States during the 1970’s. SchoolhouseHistory Rock teaches mundane principles of grammar, math,12,14,16,18,20-22 science and American explosively Aug 12.15 (13.40)in £4.00 (£2.50)innovative, colouful ways! YOUNG OPERA ©OOO Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 THE RAPEinterpretation OF LUCRETIA Benjamin Britten’sof young tragic singers’ chamber(Guardian) opera given an■under energetic by this ‘exciting group the direction Lampard, of Voice(Observer). at the Junior Royal Academy of Music. futureofofAnn English OperaHead is assured’ Aug 6-9 The 18.00(19.50) £5.50 (£4.50) YOUTH CONNECTION OO©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ■disasters! A SLICEOnlyOFSaturday SATURDAY NIGHT I960’S musical triumphs and fashion matters.acclaimed A sparkling, irresistably energetic, musical pastiche, presentedtours by thisandnightnationally youth company, whose credits include European several outstandingly successful Festival appearances. Aug 17-30 18.15 (19.50) £6.00 (£5.00)

SHIHO is from the muscular end of New Age music, an eastern Mike Oldfield successfully creating melodies to mellow the heart through beefy and evocative synth sound. Rolling bass rhythms and stirring drum sounds. THE SCOTSMAN aug. 1996


TALKS & CVCNTS ARCHITECTURE ON THE FRINGE II 00©0 Venue 13 2 - Royal Fine Art Commission for Scotland, Bakehouse Close, 146 Canongate K15 MINDS MEETINGS - BRIDGE and Bridge deliberations on issuesexhibition relating to theDESIGN HighwaysDebates, Agency’sdiscussions Poole Harbour Design13,15,20,22 Competition Aug 17.30 (19.00) hosted Free by the Commission. ARTHROB OO©© Venue Old 5900 GPO Buipreldi8ng,Aug) North Bridge Tickets118558- Arthrob. 7559 (0171The 591 113 ★mix,■ beats, ARTHROB DEFINING Afilm,NATION A two weekcontemporary intoxicating verbal DJs, bar, performance, dance and dancing, classical music, video, installations, silence, chemical commentary, talks, fashion...tomato, glamorous K foundation, guerilla(Freetheatre...hedonism. Aug 10-25 hooligan, 10.00 (05.00) £5.00 (£3.50) entry before 6pm) THE ARTS OUT OF AFRICA ©o@© Venue 103 - Mandela Vil age, Scotsman Market Street Gallery ]I2 ■handMANDELA VILLAGE Experience the New South African lifestyle at first theatre, dance, comedy, music, poetry, crafts and a late-night dance club a unique and exhilarating insight into the talent and vibrancy of the New SouthAfrica. Aug 8-24 18.30 11.00 (01.00) (17.30) £5.00 £2.50 (£2.50) (£1.50) Aug 8-24 (NBThe evening performances are not suitable for children) BRAIN POOL OO©© Venue 121 - Edinburgh University Management School, 7 Bristo Square Tickets 229 1576 LI2 POOLSIDE LEARNING CAFE Daily workshops and seminars led by futurists, cartoonists, business writers many more. Get to know new people, stretch your mind,people, make new andyouandunexpected connections. Phone 0131 229 1576 for programme we’ll make very welcome. Aug 11-29 (not Sats and Suns) 10.00 (20.00) £8.00 (£6.00)

18-29 August at the Fringe Club

The Royal National Theatre Studio is offering a two-week programme of

classes worksh ops for theatre practitioners Also, lectures and discussions open to the public Schedule available from the Fringe Office from mid-July

CHOUDHURY CO-THE BANGLADESH FESTIVAL OF FOOD AND&CULTURE Venue 184 - Raj Restaurant on the Shore, Henderson Street, Leith Tickets 553 3980 TRADITIONAL MUSIC OF BENGAL The Bangladesh festivalplus a of■ THE foodcourse and culture isfrom a nightly performance ofoftraditional Bengali music, three dinner an extensive menu the best of Bangladesh cuisine in the10-14,17-21,24-28 best waterfront venue Leith. £13.95 Aug 19.319.30 0in(22.00) Aug 8,9,15,16,22,23,29,30 (22.00) £17.95 CLASSIC FM OO©© Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 KI2 ■hostsCLASSIC FMspecial LIVE ATTHE FAMOUS GROUSE HOUSE Classic FM a late night of classical music and comedy for broadcast on Classic FM on18Bank Holiday(01.30) Monday Aug midnight £3.0025 August. The Caledonian, Princes Street 18 ■Phillipe CLASSIC FM Susannah LIVE ATTHE CALEDONIAN inspecial association with Baron Rothchild. Simons hosts a one hour live broadcast from The Caledonian. FurtherAugust. live broadcasts feature at 12 noon on Saturday 23rd August and Sunday Aug 16,23,24 12.0024(13.00) Free ■performances CLASSIC FM LIVE ATTHE CALEDONIAN A week of Sonata’ introduced by Jon Aug 18-22 18.30 (19.10) Free Tolansky and broadcast live on Classic FM. DEMARCO EUROPEAN ART FOUNDATION 00©0 Venue Tickets22558- Demarco 7330 European Art Foundation, St Mary's School,York Lane/Albany St HI3 DRAMA, POETRY ANDon this SCIENCE James Clerkperformed Maxwell, scientist, poet, lover: drama and poetry subject and others by the Solway FestivalandPoets. toavailable. be missed’ (1996 Fringe Review). Lively and inventive, funny sad.14.‘Not Food Aug 21-23 00 (15.15) £2.00 (£1.50) DIY DIARIES use thetimetable Fringe web site to create your own daily http://www.edfringe.com 64

9-25 August 1997 Charlotte Square Gardens Tickets on sale from 30th June 1997 Box Office 0131 220 3990 Information 0131 228 5444 Come and enjoy this cultural extravaganza - over 400 events in a tented village! For a copy of the programme, write to EBF Box F, 137 Dundee Street, Edinburgh EH111BG


TALKS & CVCNTS

onger An Exhibition about the Olympic Dream

DIVERSE ATTRACTIONS 0Q©0 Venue 11 - Diverse Attractions, Riddles Court, off Lawnmarket Tickets 225 8961 Jl I I MEDITATION Introductory workshops. Anremedy experience of peacenature. amidst the hustle and bustle of the Festival. A rescue of a different Brahma11-23Kumaris. Aug (not 17) 14.00 (15.30) Free EDINBURGH CONTEMPORARY CRAFT FAIR OO©© Venue 196 - Edinburgh Inti Conference Centre, Morrison Street Tickets 300 3000 K8 MEET YOUR MAKER -makers ARTISAN IN ACTION Workshops, lectures and demonstrations from top and designers at galleries around Edinburgh. See at E.I.C.C.Freeor phone 0131 225 2059 for info. AugArtisan 20-25 leaflet 11.00 (12.00) EDINBURGH FESTIVAL VOLUNTARY GUIDES (DO©© ASSOCIATION Venue 165 - Cannonball House, Castle Hil , Royal Mile JI0 ■intrigue, ROYALwizardry MILE and HISTORICAL WALKS With us you hearspooky tales ofcloses. murder, royal romances. Explore secret gardens, See famous where lords, thievesWeekly and grave robberstalks. lived on the same street and where the are buried. illustrated Aug 4-30 Tours last approximately 2 hours Free Tours at 10 min intervals between 10.00 & I 1.00 and between 14.00 &start 15.00. (Sundays between 14.00 & 15.00 only) EDINBURGH MELA OOQO Venue 151 - Meadowbank Centre and Stadium, London Road Info 668 4100 J19 ‘brilliant...atmosphere’s amazing...not often you get multi-cultural event this size...smell of food amazing...been round the bazaar really lovely things... kids having brilliant BBC.ticketed Free performances, workshops and the time.’ following events. exhibitions, puppets, sport, MAIN LADKI SOLAH BARAS Kl (I’M THE OFnewSIXTEEN) World Premiere of celebrated IndianUdit director, DevAGIRL Anand’s film & livelove, performance by star playback singer, Naryan. story of adolescent 60% of16film20.00(23.00) shot in Highlands Aug £7.00 and Edinburgh. ■ BHANGRA ATTHE Bhangra Group,andwith gutsy, infectious new wave MELA of danceLeading and vocals that’sband.Apna sweeping Asia the west with DJ Vip. Aug 16 23.30 (02.00) £7.00 ★ ■Rajput NAGWANTI PARAM PARA against evokes background the in -16th Century, this THEATRE dance dramaSet in English a tragicof love storymusic allCourts toofromidentifiable to a modern audience. Original music alongside beautiful the past. Aug 17 15.00 (16.30) £4.00 ■ WARmusic WITHandWIND -combine WAVESwithDANCE COMPANY and western dance vibrantdance costumes, vividEastern patterns and colour, in brave, exhilarating and inventive choreographed by the Augvigorous 17 17.00young (17.45)talent£3.00of Mukid Choudhury. Created in Sylhet, Bangladesh. ■Collaborative NORTH-SOUTH-EAST-WEST SPECTACULAR musicsouth, suite,andprincipally forMUSICAL pipes and drums, inspired by Irishfrom music, north and world music, performed by mass ensemble Ireland, Scotland, Pakistan, Africa and other communities. 10 minutes walk from Sunday. Free Aug 17Fringe18.00(18.30) ■of ATTA KHANconcert ESSA atKHAILVI theof Pakistan’s sell-out success Nusrat ULLAH Fateh Ali Khan’s 1995a close Mela,Following another outstanding singers brings 1997 Mela to with passionate vibrant music17and20.00 song,(22.30) combining Aug £7.00traditional and modern influences. FRIENDS OF THE WESTERN BUDDHIST ORDEROO©© Venue 18 - Edinburgh Buddhist Centre, 55a Grange Road Tickets 662 4945 PI I BUDDHIST MEDITATION Buddhiston Meditation isexperience. based on the principle oftechniques Mindfulness; full awareness centred immediate In the simple we teach, qualities such as concentration, calm and emotional warmth canthat be11.00developed. Aug 15-30 (12.30) £4.00 (£2.50) Aug 15-30 15.00 Aug 19,21,26,28 (16.30) 19.00 (20.30)

65


KETI PRODUCTIONS INC. OOO0 TALKS & CVCNTS Venue 55 - Randolph Studio, Inst. Francais d’Ecosse, 13 Randolph Cres. Tlx 225 5366 ■OFSYMPOSIUM ONaLOVE:THE DEVASTATING LITTLE BREATH Lovephilosopher, from multi-ethnic point oftheviewshadow featuring dancerEROS -Tantric Shakti. mix Explores sidefantastic of love erotic using the i feminine art form, Rondai...exciting of East and West. FRINGE AGM Aug 24-30 15.15 (16.30) £3.50 (£2.50) Venue 2 - Fringe Club.Teviot Row, Bristo Sq. Tickets 226 5138 LM MAGAZINE OQ©( FRINGE ANNUAL MEETING Drama, laughter, It’smonths, the revue review forGENERAL you.The directors reviewofpathos, the lastpoetry. 12 Venue 29 - Apex, 31-35 Grassmarket Tickets 0171 278 9908 KI0|| standand foropen re-election and226Fringe hear5257theSociety’s comments and ideas performers. CUT! CENSORSHIP AND SELF-CENSORSHIP IN THE MEDIA Cut!of Open minds mic. Call for Society membership info. Free tea, will bring together media professionals, artists and ‘punters’ in an exploration coffee and light buffet. contemporary taboos. isIn under these threat. censorious times, the pressure to ‘cut’ is greater I Aug 23 11.00 (14.00) Free than ever, free11.speech Aug 13,20 0 0 (17.30) £7.00 (£5.00) FRINGE SUNDAY oo©o Venue 10 - Holyrood Park, foot of Royal Mile. Info 226 5257 oi NIGHTS IN THE CARPENTER’S ARMS ooeo'i ■it allFRINGE SUNDAY Theperformers, highlight ofmusic, the Fringe! else can you get Venue 52 - ECF Kings Hall, South Clerk Street - hundreds of Fringe comedy,andWhere circus, theatre. Non-stop ■thought SUNDAY NIGHT LIVE! Jesus: Live and Unplugged. If you’ve always entertainment, great food and fresh air. Laze, graze be amazed.The Park’s church is boring and God is dead, tonight is for you. An evening with the kicks off at II o’clock! aAugdifference AugPlace. 17 11.And00 the (17.00)Fun Free 17 19.00- music, (21.00)drama Free and much, much more. INTERNATIONAL CD & RECORD FAIR oo@© PLEASANCE FESTIVAL OF THEATRE ‘97 oo©o Venue 89 - Roxburghe Hotel, 38 Charlotte Square. Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LI4 ■selection INTERNATIONAL CD & RECORD FAIR Now in its 4th year, massive 10 STEPS TO STARTING ATHEATRE COMPANY ITC (Upstairs) of rare and collectable records and CDs, dealers from the UK/Europe, Essential guidetheto management running your maze.Tips own company. ITC reveals the secrets of success specialising in 50s/60s/70s, HM, punk, classical, blues, Scottish, Brit pop, country and etc. A22MUST all music£1.00lovers. cards,navigates profit share, plus ideasFreeand notes toontakefundaway.raising, tour-booking, equity Aug 12.10.0000for(19.00) Aug 22,23 11.00 (13.00) Aug 23 (19.00) Aug 24 10.00 (17.00) ROYAL NATIONAL THEATRE STUDIO LI I JAPAN EXPERIENCE OO©© Venue 2 - Fringe Club.Teviot Row, Bristo Sq. Tickets 226 5138 Venue 55 - Randolph Studio, Inst. Francais d’Ecosse, 13 Randolph Cres. Tlx 225 5366 H8 STUDIO ATTHE FRINGE A two-week programme of classes, workshops and master classes for theatre practitioners and administrators, led by a team ■Ukishimamaru ASIAN BLUE Controversial film about the mysterious sinking of the from Studio. Lectures and discussions open to the public. Schedule available ship harboring overeyes500ofKorean laborerssearching on theirforwaytheirhome in July.the Sponsored by MSN,The after war.powerful Filmed through the two sisters roots. Aug 18-29 9.30 (19.00) Free Microsoft Network. AAugrarethe and film. 17-30 13.00 (15.00) £3.50 (£2.50)

UNDER ONE ROOF - EUROPE'S ARTI SAN

LARGEST EVER SELECTION OF TOP CRAFTS PEOPLE

EDINBURGH CONTEMPORARY CRAFT FAIR &

FESTIVAI

AT THE NEW EDINBURGH INTERNATIONAL CONFERENCE CENTRE MORRISON STREET (BEHIND THE SHERATON HOTEL) • 140 TOP NAMES SHOWING 10,000 WORKS AND ALL FOR SALE • FREE EXHIBITION CURATED BY BAYNES-BROCHOCKA (ART MACHINE/ART OF LEGO) •LECTURES •WORKSHOPS •MASTERCLASSES • PANEL GAMES ETC FOR MORE INFORMATION ABOUT PURCHASING, INVITATIONS FOR THE OPENING OR GENERAL INFORMATION ABOUT THE EVENT PHONE THE ARTISAN OFFICE ON 0131 225 2059 OR FAX 0131 225 2770 AUGUST 21 -25 (BANK HOLIDAY WEEKEND) [E SCOTTISH ARTS COUNCIL^ OPENING HOURS: 11 -7 THURSDAY & FRIDAY, 10-6 SATURDAY, 10-5 SUNDAY, 10-4 MONDAY


TALKS & CVZNTS

w WATERSTONE’S 83 George Street Edinburgh Telephone 0131 225 3436 Facsimile 0131 226 4548 Festival Opening Hours Monday to Saturday 9.30am - 10pm Sunday 1 lam - 8pm Edinburgh Festival Fringe

SANCTUARY GARDENS - FESTIVAL OF HEALING Venue 46 - The Salisbury Centre, 2 Salisbury Road Tickets 667 5438 ■Centre SANCTUARY GARDENS - FESTIVAL The and the therapies. Sanctuary presentcrystals, this event toOF raiseHEALING awareness of Salisbury complimentary Reiki, reflexology, tarot, clairvoyance, aromatherapy, stalls, talkstheandenergy. workshops. All healings by donation. Come10-30 relax and enjoy Aug 10.30 (13.00) £2.00 (£1.00) Aug 10-30 13.30 (16.00) Aug 10-30 16.30 (19.30) THE SHAKESPEARE WORKSHOP oo©o Venue 40 -The Quaker Meeting House, 7 Victoria Terrace. Tickets 220 6109 Jll ■ SHAKESPEARE’S BESTintoBITS! Shortimages scenes,andsonnets, speechespersonal for you to explore. An adventure words, meaning.Your participation in the Edinburgh Festival - spend a memorable 90 minutes with anAug entertaining 18-23 14.3group 0 (16.00)in this£3.50welcoming (£2.50) venue. THE SPIEGELTENT - SPONSORED BY W- BECK’S BIERSpiegeltent,Top of Waverley Centre, Princes St Tix 558 8010 J12 Venue 87 - Famous ■Spirit. THEExperience REFRESHING ROOM Recharge, revive, your flagging Festival thereading healing power of more.There massage, reiki,restore aromatherapy, reflexology, taireadings chi, tarot, psychic and much will also be individual Free entry. Aug 2-30in the 10.00afternoon. (17.00) Free

Box Office Box office open seven days a week Monday to Saturday 10am - 7pm Sunday 11 am - 7pm Between 1st August - 30th August Bookings in person only by cash, cheque, or credit card payment Tickets for all Fringe Shows Celebrate the Festival with Waterstone’s of George Street Author readings Regular Fringe-linked events Extensive range of imports Late night opening Free parking after 6pm For full details contact Waterstone’s George Street Also at 128 Princes Street, Edinburgh (Telephone 0131 226 2666) and 13-14 Princes Street, Edinburgh (Telephone 0131 556 3034) 67


THCATRC A-BIT-OF-ROUGH THEATRE COMPANY ©O©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★chills...Through UNDINE is the a handgrenade of a play it makes you laugh even as your peephole weshortlisted witness Undine’s fear, her quirky sexualityblood and her nail-biting Aug 6-30 22.30reality. (23.30)Currently £6.00 (£5.00) by the BBC for production in 1998. ABLAZE THEATRE COMPANY OOO© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 HI0 ★extinguished. 21 YRS @216.AM 06:00 a boy will die. Flick the switch: 21 years years into moments waiting in the chair. Find out all you can about the killer. times:£4.00 Father,(£3.00) Mother, Lover. Cut the crap - time’s up. Aug 24-30 14.3First 0 (15.30) ABSINTHE ®0©0 Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 SEXUAL PERVERSITY IN CHICAGO Bernie hates Joan who loves Deborah who loves Danny,ofmaybe. David twentysomethings Mamet’s award-winning dark society comedy examines the relationships four urban in a bleak where communication and freedom are meaningless ideals. Aug 8-23 (not 12,17) 14.00(15.10) £5.00 (£4.00) ABSOLUTE BANANA THEATRE COMPANY ®0©O Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 THE IMPORTANCE OF BEING EARNEST The Bananas are back after last year’s sell-out Seventies Extravaganza cordially inviting to theirticklecomedy ofbestmanners and mannerisms. Wilde’s dramatic feathers will you elegantly the Cucumber Aug people 8-23 (notin society. 17) 13.30 (15.00) sandwiches £5.00 (£4.00)provided. Venue 45 - Old St. Paul's Church & Hall,Jeffrey Street.Tickets 5S6 0476 JI3 MARVIN’S ROOM A smalloftale of theScotttensions resultingdarkfromcomedy family touches loyalties when faced with the reality cancer. McPherson’s this issueCancer with a sensitive between compassion and wit. Proceeds to Imperial Research18.balance Fund. Aug 12,14,16,19,21,23 30 (20.00) £5.00 (£4.00) ROPE The Absolute Banana Theatre present‘Rope’ Patrick I Hamilton.The versionCompany of theI’veAlfred Hitchcockbyclassic.‘Do know what I’vestunning done?... original I know exactly what Aug 11,13,15,18,20,22 18.15 (19.45) £5.00 (£4.00)done.. I have done murder..’ ACTION THEATER ®0@© Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 ★theatrical BECKETTLAND places short works by Samuel Beckett within the framework of a ‘Ghost Carnival’ or ‘Bemusement Park’. A truly mesmerising theatrical experience featuring‘What Where’,‘Footfalls’, ‘Theatre Aug 8-30l’,‘Catastrophe’,‘Act 23.00 (00.15) £5.00 Without (£4.00) Words II’ and‘Breath’.

|m|^l guy masterson presents Beth Fitzgerald in the British Premiere of BYE BYE BLACK BIFygr a portrait of ‘the first flapper’ Zelda Sayre Fitzgerald by willard simms directed by guy masterson “Beth Fitzgerald displays a sexuality of epic proportions” The Scotsman ASSEMBLY ROOMS 1996 Edinburgh Festival Award 0131 226 2428 BEST ACTRESS The Stage |m|£iH guy masterson presents placing burton by Zm bv markjenkins with josh richards as richard burton

ACTIVE PERFORMANCE PRODUCTIONS ®O0O Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★come ■ EYES AND TEETH War is stupid. And people are stupid. Brothers to blows and Shakespeare meets Trainspotting in this new fast-moving black comedy small-town life.‘Writer Stephen Keyworth certainly knows how to6-23 get(not hisabout hooks into (13.45) an audience’ Aug 17) 12.30 £5.00 Scotsman. (£4.00) ACTS OOO© Venue 49 - Bedlam Theatre, 11 b Bristo Place Tickets 225 9893 LI I ★you,■ I LIES, WHITE SHIRTS AND A BOTTLE OF BLEACH If I don’t like bleach you!’andLiverevenge.Toxic music, passionate and dancing shirts Free bringbreakfast a tale of Domestos-icity contentstext- view with caution. with Aug every 25-30 performance. 10.30 (11.40) £5.00 (£3.50) AFG (CUTTING EDGE THEATRE COMPANY) OOOO Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I ★ BLUDEusingREDstirring ‘WhatCeltic wouldmusic, you beBludewilling tois die for?’ Set inportrayal 17th Century Scotland, Red a passionate of the lives ofI 1-16 the Covenanters and died for what they believed in. Aug 18.15(19.50) who £5.00lived(£3.00)

directed by guy masterson

■ JB#

“haunting mesmerising deliriously literate... A shattering portrayal.’ Jack Tinker, Daily Mail

From 8 August FOR 22 PERFORMANCES 68

ASSEMBLY ROOMS ASSEMBLY + GUltDED BALLOON + PLEASANCE


Radio 4 and BBC i’s The Stand Up Show present the

BBC

COMEDY AWARDS BBC Stand Up Award National Final hosted by ARDAL O'HANLON

AFTERTHOUGHT ©Q©© Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 ★ GLIMPSE (SUNDAYS,WEDNESDAYS, FRIDAYS) New inwriting by Thomas Everchild. Philippa Hammond’s one-woman performance repertory. AD415 forcesnightdestroying Empire.poignant Opposing them,rosephilosopher Hypatia -Edwardian - dark her last on earth.Roman Also:- funny, English performs genteel pornography. Previews Aug 8,9 19.00(20.00) £2.00 Aug 10,13,15,17,20,22,24,27,29 20.00 (21.00) £5.00 (£4.00) ★ GLIMPSE (TUESDAYS,THURSDAYS, SATURDAYS) glimpses. 1946. Marcia Blouse, privateAlso:-eyeFurther Dick Mammal -Downtown thewalk-on jazz-infested horror story ofsecretary Dick’sFringe-verite lasttocase. leather-clad, walked-over dishes the dirt in backstage expose. Previews Aug 8,9 20.00(21.00) £2.00 Aug 12,14,16,19,21,23,26,28,30 20.00 (21.00) £5.00 (£4.00) UNRELIABLE ROMANCES FREE SHOW)Original We call it ‘cabaret noir’. Funny, dark, (MONDAYS: scary, comedy, songs, storiesoftricky, and poetry, voiceserotic and and soundunexpected. effects - and it’s free.drama, Details and pictures all Afterthought’s shows http://www3.mistral.co.uk/thoughts. Aug 11,18,25 20.00 (21.00) Free AGAPE THEATRE CO. OOOO Venue 188 - Seventh Day Adventist Church, 3 Bristo Place Tickets 225 2819 LI 2 ★Sharon’s BEHIND THE MASK An acidic journey of self-discovery, when a blast fron wild and riotus past arrives unexpectedly in leafy suburbia at 2am. Arecommend humorous,ityetwithtouching examinationDirector of the S.EC very fabric of friendship.‘I Aug 11-15 (not 13)confidence’ 17.00 (19.00)Youth£5.00 (£4.00) AHA! SISTER CITY SISTERS FROM DUNEDIN, ©O©© NEW ZEALAND Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 2257226 KI0 ★ UP THE DUFF is about sex,thing love,inroots and change inpregnant.Young the lives of threewild women from NZ who have one common: they’re Janelle, Arts-school £5.00 Helen(£4.00) and English emigrant Ruby are expecting you. Aug 24-30 8-23failed20.55 Aug (not (22.15) 28) 19.40 (21.00) ALBATROSS THEATRE COMPANY OOOO Venue 126 - C cubed, St John’s Hall, West End Princes Street Tickets 225 5105 19 ★A young REMEMBER, REMEMBER by Andrew Gough. Bonfire Night, 2005. man is found dead. A lone assassin waits by an open window. Athatyoung journalist returns home to find herself involved in a conspiracy Aug shatters 11-16 17.her00world. (18.30) £5.00 (£4.00) AMERICAN HIGH SCHOOLTHEATRE FESTIVAL®Q©0 Venue 137 - Church Hil Theatre, Morningside Road 06 CHILDREN OF A LESSER GOD A dramatic struggle of communication between the the deaf deaf Sarah and hearing worlds depicting James Leeds’ challenge teaching Norman to speak. conflicts become intenseofwhen their relationship develops into£3.00romance andThemarriage. Aug 11,13,15 18.10 (19.55) (£2.00) Aug 14 10.10(11.55) FEIFFER’S Ladveworld. High Educational School presents Jule’s Feiffer’s theatre funny, yetclash acerbic look atPEOPLE the modern and experimental head on in this series of sketches, monologues, music and dance. Aug 16.15 (17.45) £3.00 (£2.00) Aug 11,13,15 12 10.15(11.45) LEND ME A TENOR is scheduled a farce settoin perform, I930’s Cleveland Ahilarious renowned Italian il , andin ansmash. in noopera timehouse. at all, chaos10.15(11.15) erupts.tenorCome see(£2.00) this uproariousfalls Broadway Aug 11,13 £3.00 Aug 1716 20.15 16.15(17.15) Aug (21.15) LOOK HOMEWARD, ANGEL Asheville High honors our native-son, Thomas Wolfe, in this upPulitzer-prize winning about a young writer growing in the stormy milieu(1958) of thecomedy-drama Dixieland boardinghouse inAugtheI mountain town of Asheville, Carolina. 14.10(15.50) £3.00 (£2.00) Aug 161,13,15 20.10 (21.50) MUSEUM An exhibit offoreigners, three fictional contemporary artists brings out art lovers, Village skeptics, lost soulswithandAmer.can fellow artists.‘Moving and beautiful.’ Voice. ‘A comedystudents, of absurdities a serious message’ New York Times Aug 10,12,14 20.20 (21.40) £3.00 (£2.00) Aug 17 12.20 (13.40) AMERICAN HIGH SCHOOLTHEATRE FESTIVAL continues on next page 69


THCATRC

C&J PRODUCTIONS PRESENTS THINK NO EVIL OF US my life with

AMERICAN HIGH SCHOOL THEATRE FESTIVAL continued I II iMn NATIVE COLORS an original about children,warmth, born in happiness, the US of immigrant parents.Theis play is full ofscript joy, human tolerance, understanding of human kind, and thefeelings, importance of bilingual and multicultural education. Aug 12.30 (13.30) £3.00 (£2.00) Wiiliai Aug 11,13,15 16 18.30 (19.30) written & perl jerformecT by DAVID BENSON THE NEW MEXICO MASQUE AND MUMMER’S PLAY Cibola High SchoolSantapresents anFandangos, original theatre pieceKid,composed of native American tales, the Fe Trail, Billy the Aliens (!) and much more.. AAugpanoramic feast16.30(17.15) of southwest£3.00Americana. (£2.00) “Unforgettable, Aug 10,12,14 15 10.30(11.15) has the THE NIGHTTHOREAU IN JAIL A young philosopher livedGhandi in the woods andherefused tonight pay ina taxjailSPENT supporting a questionable war. Inspiring audience and King, spent a where a new civil disobedience was born. Aug 20.10 (21.50) £3.00 (£2.00) Aug 1711,13,15 14.10(15.50) cheering” Venue Info/Tix128346- Yout 1405h International or 229 5562at St Oswald’s, Montpelier Park N6 Awanders COMPANY OF WAYWARD SAINTS A Commedia dell’Arte troupe a 20th century allegory. Thehome, challenge: successfullyof aimprovise the ‘history ofintoman’. reward? The isreturn compliments new patron. Discovering whereThehome actually becomes a theatrical journey towards human understanding. Aug 14.10(15.55) £3.00 (£2.00) Aug 10,14,17 13 22.40 (00.25) THE DIVINERS Thistwopoignant tale - textured withaGospel music - about Zion, Indiana and itsteenager, most famous fallenis matched preacher, andby Buddy, a retarded whose gift forcitizens: diviningC.C.water only hisAug paralytic fear of touching it. 11,13,15 14.10 (15.55) £3.00 (£2.00) Aug 16 22.40 (00.25) BOX OFFICE: 0131 226 2428 LADIES INplayWAITING /women SILENTgathered DEATHtogether ‘Ladies’toisprepare a comical,for thoughtFRINGE BOX OFFICE: 0131 226 5138 provoking about four a wedding. ‘Silentdifferent Death’ uses theallintriguing form of Reader’s Theatre to explore why three very people chose suicide. Aug 10,12 18.20(midnight) (19.30) £3.00 (£2.00) Aug Aug 16I I 22.50 12.20 (13.30) THE popularliveAmerican takes no events life, but theOUTSIDERS rest - who how are kidsAnot think, and feelabout -story, is fordecency real.This is amidst playfromabout young people yet hopeless: in the of struggle. Aug 16.15(17.45) £3.00 (£2.00) Aug 11,13,16 17 12.15(13.45) ROOMERS /these STAGES Humour, frustration,avaricious dreams, despair -who the stuff ofthelife ispantry the stuff ofbedroom plays. Fromparanoid ROOMERS’ landlady rents as a to the director and the disenchanted playwright (STAGES), a tour de force for all. Aug 12,16McDonough 14.(19.40) 20 (15.40)promises £3.00 (£2.00) Aug Aug IS13 18.20 16.20(17.40) SERIOUS MONEY Greed,allpower, corruption, sexget.andChurchill’s murder arefast-paced, the key factors in taking., andoftaking thetrade money you canincludes high energy comedy the world market a negative view of British10,12,14 and American capitalism.£3.00 (£2.00) Aug 12. 1 5 (13.45) Aug 9 18.15(19.45) AMERICAN UNIVERSITY IN CAIRO OOOO Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 Kl 3 ★ KHAMASSEEN Blinding sandstorms, ritualamidst magic.Atheculture shocked, expatriate woman finds acceptance and healing intensely exciting, sensory of modern Cairo.about Alive with belly-dancing, music and ‘sparkling dialogueEastoverload - shot through with jokes language and miscommunication’ Middle Times. Aug 11-16 19.15 (20.45) £5.00 (£4.00) ANGEL FISHKiTHEATRE OO0© Venue 28 - Greyfriars rk House, Candlemaker Row Tickets 225 3626 Kl I ★throw BITEtheirMEown Adultparties comicin drama set in London 1997. Four twentysomethings the same house with clashing results. A forbidden trip Wonderland. Auginto 11-30a spicey (not Suns) 20.45 (21.35) £5.00 (£4.00)

JACKIE CLUNE’S BRAND NEW SHOW ttrifiks Kith lliiki ...an evening of HAIRSPRAY & HARMONY 10.25pm ASSEMBLY ROOMS BOX OFFICE: 0131 226 2428 FRINGE BOX OFFICE: 0131 226 5138

70


ANNEX THEATRE - USA Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 oo©@ ★playwright THE HANDWRITING,THE SOUPpaths. ANDWackiness THE HATS An actress, aentertaining, and a dentalacted’, hygienist cross ensues.‘Extremely beautifully The Play Stronger,‘Sharp andTimes. smart...it deserves to beAugseen’, Seattle Weekly. ‘Best New 1996’ Seattle 18-30 (not 24) 21.15 (22.45) £6.50 (£5.50) Aug 26,28,30 12.00 (13.30) APIP PRODUCTION ®0©@ Venue I i - Southside Courtyard, Davie St. Tickets 667 2212 LIB ★encounter RAMBLING SAM -THE DR JOHNSON SHOW A rambunctious filled with humour and pathos with the legendary raconteur himself. Professional actortheJohn Rainer,lexicographer who sharesand the wit. sameDictionary birthplace, Staffordshire, England,British portrays famous Johnson lives! Aug 7-30 13.00(14.00) £5.00 (£4.50) ARKLE THEATRE COMPANY 00©0 Venue 88 - St Stephen's Centre, Foot of Howe Street Tickets 557 5864 FI0 AwithMIDSUMMER NIGHT’S DREAMfavourite After lastcomedy.This year’s sell-out, Arkle venue return an interpretation of Shakespeare’s stunning hosts a ‘Dream’ of mischief, confused lovers and politically correct mechanicals. AAug great18-23 mix of19.traditional 45 (22.00) and £5.00contemporary (£4.00) themes.

|||| ASSEMBLY ROOMS ®0©© Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 Stella Assembly -’a building. powerhouse of creative energy’1000 performances inSeea our gemArtois of an Edinburgh Following is a range of Assembly Shows. advert for the rest or ‘phone for a free brochure: 0131 226 5992. ★premier I CAN’T REMEMBER ANYTHING AMiller’s smashplay. hit inMoving Moscow, the UK andacclaimed stunning production of Arthurcreated beyond words this is an theatrical experience by the stars of Russian Theatre in honour of his 80th Birthday.‘Unforgettable’Arthur Miller. Aug (18.15) £9.00 £8.00 (£8.00) (£7.00) Aug 10-14 15,16 17.17.0000 (18.15) ★1967.The ■ JUMP‘MadTOAxe’ COW HEAVEN By Fringe First winner Gill Adams. London is sprungandfrom Dartmoor every need 8-14,17-21,25-30 is met, includingmana hooker a £7.50 minder. But is byanyThejobKrays. worthHisa life? Aug 18. 3 5 (20.00) (£6.50) Aug 15,16,22-24 18.35 (20.00) £8.50 (£7.50) ★Robert ■ SURFING The Red award-winning ofworlds Surfingapart. by Young. A gentle storyRoom’s of erotic e-mail fromproduction twowithpeople ‘a funnyOn. and‘Recommended’ touching piece’ Independent, ‘performed boundless charm’ What’s Time Out Critic’s Choice -14,17-21,25-30 19.35 (20.35) £7.50 (£6.50) Aug 1115,16,22-24 19.35 (20.35) £8.50 (£7.50) THE ASHCOMBE SCHOOL THEATRE GROUP 00©0 Aug Venue 11 - Diverse Attractions, Riddles Court, off Lawnmarket Tickets 225 8961 J11 ★ ■ BOY’S LIFE Great Jones Theatre Company (Chicago). The most andHoward intelligent comment on the battle ofcomedy the sexes in a long time’ ★ DANDELIONS by AntoniatwoHoneywell. Making theircarrot Fringeadddebut, five girls, balanced New Korder’s Pulitzer-nominated four traumas, three poignant, overdrafts, bridesmaids men Yorker. contemplating adulthood... while £7.00 trying(£6.00) to get laid. targets three American thought provoking, new play.‘a sack loadandofaneuroses,’ BBCup toRadioa Aug 8-14,17-21,25-30 14. 3 5 (16.00) ‘aAugphone-omenal success,* Dorking Advertiser Aug 15,16,22-24 14.35 (16.00) £8.00 (£7.00) 18-23 13.45 (15.15) £4.00 (£3.00) ★ new RAPSCALLION PRODUCTIONS: BRING ME SUNSHINE Aschizophrenia, play about love, armed robbery, bacon sandwiches, public and the unconquerability of the human set ontransport, Solstice night inwriter’ Edinburgh’s Brougham Street by Simonspirit, Stephens ‘anSummer CREDIT CARD SALES accomplished The Stage. RING 0131-226 5138 (10 lines) Aug 8-14,17-21,25-30 14.00 (15.20) £8.50 (£7.50) Open 10am-6pm (June Et July) Aug 15,16,22-24 14.00 (15.20) £9.50 (£8.50) 9am-9pm (during August) ★ RODNEY MENof INJerome A BOAT RodneyThree Bewes.from The Likely LadsBEWES:THREE in his solo adaptation K Jerome’s Men in a Boat.altogether ‘An delightful evening’ London Evening Standard. ‘Huge tour de force’ Sunday Times. ‘Makes you chuckle, chortle and guffaw’ The Mail Aug 8-14,17-21,25-30 16.00 (17.15) Aug 15,16,22-24 16.00(17.15) £8.50 £7.50 (£7.50)(£6.50) ★ ■mean THEbyWRESTLING SCHOOLrWOUNDSTOTHE FACEofWhat do we ‘losing face’? Howard controversial exploration how see ourselves and others, throughin Barker’s the character of the human face.‘The mostwe important buildingless company Britain’ Independent Aug 17-21,25,27-30 (18.20)(£8.00) £9.00 (£7.00) Aug 22-24 17.00 (18.20)17.00£ 10.00 THE CHAIRS Vagabond Productions Ionesco’sFringe modern classic to life in a breath-taking production directed bybrings three-time First winner Andrew Dallmeyer.A must for all theatre lovers.‘Performed with electrifying tension’ The Scotsman Aug 8-14,17-21,25-30 Aug 15,16,22-24 14.50 14.50 (16.05)(16.05) £8.50 £7.50 (£7.50)(£6.50) KRAPP’S LAST TAPE by Samuel Beckett istoonesearing of thetragedy, seminalthisplaysproduction of theatre.Veering frombeen broadhailed humour ofmodern Irish classical theatre has from the U. S . to Argentina as a perfect production.13.15(14.30) Hugely funny and eerily beautiful. Aug Aug 8-14 15,16 13.15(14.30) £7.50 £8.50(£6.50) (£7.50) ★Berkoff STEVEN BERKOFF INof British MASSAGE the UK set premiere MASSAGE, exposes elements sexual Inhypocrisy, in the‘Anofseedy world of the massage parlour.... a world uncomfortably close to home! enchanting mix of visual cartoon and verbal dexterity’ LA Weekly. Aug 19-21,25,27-30 (12.45)(£9.50) £9.50 (£8.50) Aug 22-24 11.30 (12.45)11.30£10.50 ★Stoklos DENISE STOKLOS IN CASA her second solo performance piece, compresses 20 million years ofIn human evolution into thethelonely, repetitive, domestic rituals of a working woman.‘Stoklos blitzes stage. Her Casa is as consummate as her Mary Stuart’ Tempo / Sun Herald. Aug Aug 8-14,17-21,25-30 15,16,22-24 13.30 13.30 (14.45)(14.45) £9.00 £8.00 (£8.00)(£7.00) CANT FIND THE SHOW YOU’RE LOOKING FOR ? See page one 71


CONNECTICUT STATE 00©01 THCATRC AURORA/WESTERN UNIVERSITY Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 LI 3 If I ★ ■explore ENEMY: PROJECT IBSEN Physical theatre andofmixed mediaoncombine ?! j toindividual the shifting nature of ‘truth’ and the impact technology and morality. A unique theatrical experience. Provocative ASYLUM THEATRE COMPANY OO©© and daringfreedom drama, direct from(19.50) New York. 11 -14,17,19-21 18.40 £6.50 (£5.00) Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 Aug Aug 15,16,22,23 18.40 (19.50) £7.00 (£5.50) OTHELLO - WILLIAM SHAKESPEARE A production that powerfully contrasts comedy withmost tragedy, lightandwithsmiling darkness. Through theambition deceptions AUSTRALIAN NATIONAL THEATRE COMPANY®0@© I ofperverted lago, Shakespeare’s subtle villain, love and are into30 (14.55) sexual jealousy and murder. Aug Venue 30 - The Netherbow Theatre, 43 High Street. Tickets 556 9579 J13 Aug 1011-3012.(not Suns) £3.50 12.30(£2.50) (14.55) £6.50 (£4.50) OPIUM EATER Writer/director,Andrew Dallmeyer, three times Fringe First iI TWO JIM CARTWRIGHT Our 1996 hit. Set in a pub, two actors play winner, returns with this ‘brilliant play’theScotsman, ten years after itsmore original adrunk dizzying cocktail of drinkers, lovers, brutes and saints.The audience was quite Traverse production, which ‘honours Fringe’ Time Out. Once back SI Three Weeks. ‘Performed with verve and tremendous toAug1820s the hallucinagenic insight’10with The19.pleasure’ Scotsman. 9-30Edinburgh (not Suns)and20.30 (22.30) £7.00 world (£4.50)of DeQuincey’s imagination. Aug 3 5 (20.55) £3.50 (£2.50) Aug 11-30 (not Suns) 19.35 (20.55) £5.50 (£4.50) AXIS OO©© * CHRISTIE IN LOVE - HOWARD BRENTON Between 1943-53,John Venue 238201- Chapl(preain7cyAugCentre, I 1332 Bristo10am-5pm) Square, (near Fringe Club) Reginald Christie murdered eight women and, like Fred West, concealed Tix 650 651 LI 2 • If their corpses about look his home. Theyfacewereof evil. killed, he confessed, because he ‘loved them’. Come into the ★ SHADOWBOXING This one-manas play about a boxerjourney confronting hispushes 1■ f Preview Aug 10 00.05 (01.00) £3.50 (£2.50) masculinity is an emotional awakening well as a physical which Aug 12,14,16,19,21,23,26,28,30 00.05 (01.00) £4.50 (£3.50) both character and actor to thecredibility’ limit. ‘Kumar’s commands attention...ominous Sceneperformance Magazine. is exceptional18-23 16.30 (17.30) £5.00 (£3.00) ATLANTIC CTC OOO© Aug Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 Aug 24-30 20.30 (21.30) OLEANNA by David Mamet. A scathing investigation of insecurity and power. BACKSTAGE THEATRE COMPANY 00©0 Aquestions college student filespolitics, a sexual harrassmentandclaim againstofherauthority professoras the - raising 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 K10 l I of sexual manipulation the liberty play Venue moves towards its final climax. ★ STACKED Gus and Jumbo are having breakdowns. What with affairs, belief Aug 25-30 10.15 (12.15) £4.00 (£3.00) that airlanes are full ofstack flying saucers communicating in ancient Etruscan -controllers problems - so doand the pilots aeroplanes. Unfortunately they are | -14.10(15.10) or areup they? ATTIC THEATRE COMPANY 00©0 airAugtraffic 11-22 (not 17) £4.50 (£3.00) Venue 30 -The NetherbowTheatre,43 High Street.Tickets SS6 9579 JI3 ■ THEplaywrights’ SEAL WIFE Sue Glover, authorcontemporary of Bondagerstale ‘oneofofpassion Scotland’s finest - TheByScotsman. Powerful ; destruction in a Scottish fishing community, based on the Seal-people myth.and LOST IN THE CITY? ‘Haunting play. . directed with alert delicacy’ TheTimes. See our map inside the back cover Aug 11-23 (not 17) 18.00 (19.25) £7.00 (£4.50) Avalon Promotions Presents Al Murray THE PUB LANDLORD is the KING OF BEERS 'Hilarious...Al Murray’s landlord is a winner” Independent On Sunday 'Do not miss this The Sunday Times August 6th-30that 9.30pm (Except 12th and 26th) Pleasance Box Office: 0131 556 6550 For furtherhotline information call the Al(Calls Murray on 0891 cost 50p per minute at all887766 times)


Arts International Exchange Merlin International Theatre, Budapest Presents ^^Hungarian ^JOVERTURES Hungarian the Fringe tne 9uest A timeless erotic fairy tale. Chaplaincy Centre, Venue 23 tRageoy of maN The Hungarian classic by award-winning Scottish director. Famous Grouse House, Venue 34 woundcd women Tales of ill-fated women. Virtuoso flesh and blood theatre. Continental Shifts at St Brides, Venue 62 Lajko felix & LoRiNSzky attila Traditional Hungarian sounds brilliantly mixed with jazz and rock. Beck’s Famous Spiegeltent, Venue 87 & Fringe Club, Venue 2 amaoiNDa "The most dazzling percussionists this side of Bali/’ The Guardian Royal Museum of Scotland, Venue 43 &’ Beck’s Famous Spiegeltent, Venue 87 For More Information See HUNGARIAN OVERTURES in the Theatre Music Sections

BARE AND RAGGED THEATRE OO©© Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 K13 ■at the THE‘95PICTURE OF DORIAN GRAY After playing to packed houses and ‘96 Early Fringe,booking DorianisGray makesto see its final appearance year by popular demand! advised Wilde’s tragedy this of decadence and Augcorruption. 25-30 12.20(14.00) £6.00 (£4.00) ★100■years DRACULA 1997 is the 150th of Bram Stoker’s birththeandplot,is since the publication ofterror his anniversary novel.This adaptation dealsawith the themes, the erotica and the of the vampire lord. Not spoof! Aug 25-30 (not 28) 21.50 (23.10) £5.00 (£3.50) ■ceremony DOCTOR FAUSTUS An exploration ofBarefaith,andloveRagged and mortality athrough and ritual. critically acclaimed fast play. moving,18-23 humorous andThehighly accessible production of Marlow’spresents most exciting Aug 20.15 (21.45) £5.00 (£3.50) Aug 25-30 14.15 (15.45) ■ THE REVENGER’S Atour-de-force darkly comicwhich masterpiece fromman’sthebasic Jacobean era.The playseduction, is anTRAGEDY emotional examines instincts for revenge, violence and retribution. A rarely performed play, ripe a Fringe(17.45) revival.£6.00 (£4.00) Aug 25-30for 16.00 ★portrayal ■ THEofART OF CRUELTY A new play Brown. ofA disturbing the lifeofandCruelty work and of Artaud.‘I am byan Tom incarnation my own ideas -1Augam25-30 the Theatre it is me. ’ (not 28) 20.15 (21.35) £5.00 (£3.00) BARRY SORTS IT OUT ©O©© Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 K12 ★obnoxious BARRYcowardly SORTS little IT OUT ...tells the riotously funny story of Barry, an runt, who is left to fend for himself when his ‘old woman’ leaves him for getting his leg over with ‘that June’. (Time Out Critics Choice) Preview 19.45 (20.55) £4.00 £7.50 (£6.50) Aug 9-30Aug (not8 13,28) 19.45 (20.55) BATS ©O©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★ FUGUE individuals united in aunfolds search asforthey escape take watches in theThree desert. A beguiling theiralternate respective flights through art, science and love.story A new play which isseek fantastical yet peculiarly contemporary. Aug 6-30 (not 12,20) 16.50 (17.40) £5.00 (£4.00) BE BA THEATRE OOOO Venue 45 - Old St Paul’s Church & Hall,Jeffrey Street Tickets 556 0476 JI3 DRACULA Dracula is back and looking for blood. One hundred years since Bram Stoker gave him life, Be Ba Theatre bring you Liz Lochhead’s brilliant version of the Count Dracula story.‘a powerful performance filled with horror and Herald. Augsuspense’ 11 -16 12.Fife15 (13.45) £4.50 (£3.50) DAVID BENSON ©O©© Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 THINK NO EVIL OF US...MY LIFE WITH KENNETH WILLIAMS ‘96 FRINGE FIRST. David Benson’s uncanny impersonation, the complex character of one of Britain’s entertainers unlocks in this exhilarating, semi-autobiographical show.‘A tourIndependent. degreatest force’ Scotsman. ‘Delicious...Breathtaking...Brilliant’ Aug 11.45(£7.50) (13.15) £7.50 (£6.50) Aug 9-11,13,14,17-21,25,27-30 15,16,22-24 11.45 (13.15) £8.50 BETTER OUT THAN IN THEATRE COMPANY OO©© Venue 49 - Bedlam Theatre, I lb Bristo Place Tickets 225 9893 LI I ★through WILLtime. YOUPastREMEMBER? Five women with interwoven destinies spiralof and present collide, unleashing remembered knowledge love andanddestruction. Facingofthefate?ultimate rupture of their bond, can they finally unite Aug 18-30defeat (not the 24) hand 16.15 (18.00) £5.00 (£3.00) BIG WORD PERFORMANCE POETRY ©O©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ■verse-phobic’ BIG WORDScotsman PERFORMANCE POETRY The ultimas cure for the ‘96. Britain’s leadingWithperformance poetry club returns with three almighty three-act showcases. rap, bite, comedy and insight, this poetry18.00most(19.00) electrically alive. Different bill every week. Augis7-30 £5.00 (£3.00) 73


i' esi Stage

3O '; ^

v

playS i(.0 A ** 5

GUINNESS

g7 EMPTY SPACE FRANTIC JONATHAN HARVEY NATIONAL YOUTH THEATRE PEEPOLYKUS PHELIM MCDERMOTT TRESTLE VOLCANO Along Came a Spider Artts International Backchat Beckett’s Molloy Blue at the Throat Beyond Ecstasy Blue Remembered Hills Campaign to Free Vanunu Derevo Dr. Johnson’s Dictionary Economical Truth Fun Song Factory Grace Happy Gang Hoipolloi Home is Where the Art Is Hummingbirds Ian Shuttleworth ITC Kanzerstik Laffa Jaffa Long Good Friday Marcel Steiner Nightshift Oscar Mclennan Shooting an Elephant Paul Clark Post-Off Poems Railtrack Rejects Revenge Richard II Sandy Walsh Seduction Opera Stephen Fry’s Latin! Sykes and Nancy Tomorrow is a lovely day Young Pleasance

The Guardian International Student Drama Award See under Pleosrnue Festival ofTheatre '97 for details PLEASANCE 0131 556 ASSEMBLY + GILDED BALLOON 6550 + PLEASANCE 74

BLACK LIGHT THEATRE COMPANY Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 LI3|. GANGSTER NO. I By Louis Mellis and David Scinto.‘...fast, hard, dark, electrifying A taleGangster of passion,No.murder revenge‘...an in gangland London. |j Mean, hardcomedy’ and ruthless, I stopsand at nothing utterly disgusting new play’ Standard. Aug 7-30 Evening (not 17,28) 21.50 (23.45) £6.00 (£5.00) THE BLASTED HEATH PLAYERS OOO©! Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 ★ THE LAST George, SUIT May, struggling tohercome to termsbutwithdoting the suddenJoan, death ofand herherhusband, to endure overbearing well-meaning buthastactless gay neighbours. How much moresister, will May have to take? Aug 25-30 16.50(17.40) £4.50 (£3.00) BOB HELLON & CATHERINE SIDE OOO© ' Venue 40 - The Quaker Meeting House, 7 Victoria Terrace. Tickets 220 6109 J11 ★James FIREAitken, ROPErudely ANDinterrupts LIBERTYa modern 18th Century Edinburgh painter and arsonist, biographer. This witty tragi-comedy tracks Aitken to London, America freedom. songs colonial highlight the action.and back, to strike a blow for Aug 25-30Excellent 20.30 (22.15) £6.00 (£4.00) BOILERHOUSE ©O©© Venue Tix 2201925606- Scottish International at the Quad, University Old College, South Bridge KI2 | ★ ■ SEIZER By Spencer Hazel (FLESH and KLUB - ‘a winning, sexy mix’ Independent) and Out). Boilerhouse (HEADSTATE - ‘challenging, intimidating, energising’ Physical, combat. Seizer’s Colosseum -Time An Arena. A theatre.sexual, A club.emotional, A party. gladiatorial Outdoors, fire, vehicles, film, ;! colossal. Aug 9-25 (not 15,16,23) 22.00 (23.15) £8.00 (£6.00) ■■■ — 1 BOLD AS BRASS ENTERTAINMENT OO©© j Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I TWO a Jim Cartwright awardandwinning Northern pubshow’ comedy. This richly textured is an one assured highly, Bold entertaining Reviewedpiece as ‘simply of the best...' As Brass Ents. Independent. presents this skilfully characterised comic fusion. Aug 18-30 (not 24) 18.10(19.50) £5.00 (£4.00) BOLSHOI CIRCUS ©O©© Venue 189 - The Meadows Big Top,The Meadows, Melvil e Drive Tickets 667 7367 NI2 | ■boisterous BOLSHOI CIRCUS With the grace and beauty of balletic choreography, melodies of authentic Russian music, thrills and excitement of spectacular Russian circus artistes - zanycultural humourperformance. of award-winning clowns allAugcarefully blended to create 8-15,19,20-22,26-30 19.0a0 classic (21.00) Aug 9,12,13,16,17,23,24,30,31 14. 3 0 (16.30) Aug 16, 17,tier 23,24,£8.00 31 17.(£6.00) 00 (19.00) CentreChampagne tier £16.50seats(£12.50) Side tier £12.50 (£10.00) Rear£25 VIP inc. Programme and Champagne BREAKWITH PRODUCTIONS ©O©© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 KIO ! FALSTAFF by Robert Nye. Performed by the RSCs David Weston. Exciting, deeply moving, pulsating with life and energy. A living, bawdy tapestry of the Middle Ages.‘A - the conception is brilliant, the execution full ofAug panache and Masterpiece invention.’ Kenneth Tynan. 8,11-14,18-21 16. 4 5 (18.00) £6.00 (£5.00) Aug 16.45£8.00 (18.00)(£6.00) £8.00 (£6.00) Aug 2315-17,22,23 22.3021.10(23.45) Aug 25-28 (22.25) £6.00 (£5.00) Aug 24,29,30 21.10 (22.25) £8.00 (£6.00) BRENTWOOD THEATER COMPANY OOOO Venue 49 - Bedlam Theatre, 11 b Bristo Place Tickets 225 9893 LI I ★to THE ACCIDENT tells the shattering story of eight teenage boys who go the California desert to kick back and have some fun. Hours later, four are dead real story Aug and 11-16the16.30 (17.35)begins.This £6.00 (£4.50)new play stunned audiences in Hollywood. BRINGWONDERTHE STORYTELLER FROM NEW ZEALAND OOOO Venue 126 - C cubed, St John’s Hall, West End Princes Street Tickets 225 5105 19 ★Victorian KIWI ODYSSEY The tale of one woman’s love-inspired journey from England to New Zealand. Interwoven with Homer’s Iliad, the bloodstained voices of the Trojan war echo through the agonising arena of despair atAugGallipoli. 11-16 18.45 (19.40) £5.00 (£4.00)


BRISTOL OLD VIC THEATRE SCHOOL GRADUATING STUDENTS Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 ELEEMOSYNARY An enriching about women who want to fly.. in their minds.The secret of flight liesVicin Theatre thetaleassurance Performed School.that we are worthy of flying’. Aug 13-23 by(notthe17)Bristol 14.3Old 0 (15.30) £7.00 (£5.00) Venue 139 - The Honeycomb, 36 Blair Street Tickets 226 2151 K12 ★ THE material CONVERSE ISfrom ALSO TRUEMarx An exciting playEinstein.The of word playresult that exploits ranging Groucho to Albert is comedy that dares to be intelligent. Written by a Texan, performed by a Californian. Aug 8-30 13.30 (14.30) £5.00 (£3.00) BRISTOL TRAVELLING THEATRE 00©0 Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I ★ THEMesopotamia) EPIC OF GILGAMESH The very firstdream work: a ofjourney fictionto(2500BC from telling of King Gilgamesh’s a dark forrest to kill the ‘Keeper of Fear’ - Featuring Sumerian dance and vibrant music.I 1-23 Aug (not 17) 16.40 (18.00) £4.00

THCATRC L BROKEN HEART THEATRE COMPANY oooo Venue 11 - Diverse Attractions, Riddles Court, off Lawnmarket Tickets 225 8961 J11 ★ TOfearless EACHLinda HISfallOWN - DEAD AND GONE TO GRANNY’S Why does in love with Freddie,The Ragman? She’s supposed to be the Patrik.The WhyIsdoes break perfectly good violins? Or killmistress people?of And where’sHero! Granny... this Patrik an outrageous tragicomedy or what? Aug 11-16 15.40(17.20) £5.00 (£4.00)

BRUISED BUT CONSCIOUS PRODUCTIONS ®G©© Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 ★ INTO THEmakes SKYpeople OF MILES by Jan-Andrew Henderson. I stopped asking myself‘What kill?’ and started asking‘What stops them from doing it?’A(not harrowing fear and£5.00 loathing on the streets of Edinburgh. Aug 6-30 14,28) tale23.45of (01.00) (£4.00) C ®0©© THE BROKEN DREAM THEATRE COMPANY ®G©© Venue - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 Storm 19through the century at C’s two venues! Catch the creme-de-la-creme ASirQUESTION OF ATTRIBUTION MIS is pressing former Russian spy of modern classics and go global with comprehensive cosmopolitan culture 3 Anthonya Blunt the identity of theArtFifthandMan. He iscombine more interested and newsection. writing. Check out our packed programme - see C and C identifying dubiousforplay. painting by Titian. politics in Alan in in thebrave venues Bennett’s acclaimed Aug 6-30 (not 14,28) 19.40 (20.40) £5.00 (£4.00) ★ ■S4BSHAKESPEARE FORall-new BREAKFAST Back forcomplete a sixth smash season, return with Bardic beanfeast, with FREE Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 the coffee andteamcroissants, and aancholesterol-free, low-fat spread of Shakespearean soundbites and shenanigans. ‘Now a Fringe fixture...exceptional.’ Independent ★1996MRFringe WILDE THEhighly VIRGIN Following his phenomenal success at writer the On with&the controversial a Lesbian, AugSunday. 6-30 10.00 (11.05) £5.00 (£4.00) including breakfast Gavin Armstrong returns with a provocativeLadytaleBracknell of OscarwasWilde, the Virgin Mary, moving statues and Ballydrumshambo. ★ ■ CALIBAN - MARCOS DEof AZEVEDO & EDUARDO BONITO Aug 6-30 (not Suns) 10.10(11.05) £4.00 (£3.00) (BRAZIL) A post-colonial viewembodies the Conquistadores’ servant credulous monster themillions plight ofhavethelearned enslavedtomoon-calf. peoples ofProspero’s Shakespeare’s New World. Like Caliban, curse in a foreign tongue. WANT A SOUVENIR? Aug 24-30 18.00 (19.20) £5.00 (£4.00) t-shirts, posters ft other goodies at the Fringe shop 180 High Street, Royal Mile The Neptune Theatre Liverpool presents two award winning shows from Merseyside’s premier comedy venue Britain’s crappiest comic TERRY FULL LENGTH 'The funniest new comedian I’ve seen in years HARRY HILL

She’s big, she’s tough, she’s dog rough!

GILDED BALLOON 0 13 1 226 2 15 1 y ASSEMBLY + GILDED BALLOON + PLEASANCE Midnight £6.00 (£5.00)

8-30 August

"Hilarious, touching, clever & controversial... Fitzgerald is BRILLIANT" Liverpool Echo

by Marc Gee 11,45pm £6.00 (£5.00) 75


CALIFORNIA FAULTZONE ®0©0 Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 KI3 ★ OPEN HOUSE Bytheir Melissapast.There Berry. Following mother’s funeral, threeissisters clean out the house of is more to clean up and mom there every moment, stage,22.10(22.40) watching them£2.00 relive(£1.50) their past joys and torments. Aug 11-22 (notonSuns) ALL INTHETIMING By David lves.‘...aerobicizes the brain and and tickles the heart...puts conceits the play back in playwright.’ Timeor‘wizardly...magical funny...spinning of a sort I’ve not seen heard before.’ Canby, NY Times. Aug 9-23 (not Suns) 22.50 (00.05) £3.00 (£2.50) THE CAMBRIDGE MUMMERS OO©© Venue 49 - Bedlam Theatre, I lb Bristo Place Tickets 225 9893 LI I ★there■ THE TALKING CURE ‘God made a thousand sexes and told them were only two.’ Onlyat society’s lies can follow untruth. Bitterly comica exploration of identities nerve God’s centre, examined relationship’s Winner, Student Dramathrough Festival. Aug 11-30 (notbreakdown. Suns) 20.15 (21.45)Cambridge £5.50 (£4.50)

SHOPPING AND F***ING

by Mark Ravenhill

CAMBRIDGE UNIVERSITY ADC ©O©© Venue 167 - Moray House Theatre, Canongate/St John’s Street Tickets 6672212 KI4 ★ ■ INCARNATE is a emergency sequence ofexit,realhysterical and dreamed scenes of human crisis. Bursting out of theatre’s raving and relentless spectacle fil the streets with messiahs and anti-christs.Totally preposterous, anarchic Aug 7-24and(notinvigorating. Mons) 22.30 (midnight) £5.00 (£3.00) CAPAB (SOUTH AFRICA) 00©0 Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 HI0 ★ DEAR MIESTER MANDELA BBCthrough Playwriting Awardof winner.‘A moving, witty account of a serious subject...told the eyes a poor couple from the Coloured Community...aCouncil, particularly effective piece of drama’ Tim Butchard, Head: Dance-Drama, Aug 10-23 (not 17)British 14.30 (15.45) BBC£5.00Radio-Interview. (£4.00) CATALYST THEATRE (CANADA) OO©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 HI0 ★The■story ELEPHANT WAKE Winner of all 4 awards, Edmonton Fringe of Jean-Claude: bastard, simpleton, philosopher and sole resident ofEdmonton StVierge.‘Knockout blendwriting, of blackimpeccable humour, directing, absurdity flawless and achingperformance’ wistfulness’ Journal.‘Beautiful Newest Review. Aug 10-30 (not 17,26) 19.30(20.40) £6.00 (£5.00) CAVEAT THEATRE CO. OOO© Venue 117 -Viewforth Centre, 104 Gilmore Place Tickets 229 7659 M6 ★struggling MISBEGOTTEN SON By Jean Dallman.A doctor hopes to cure a artist of his mental problems. The patient’s improvement leads to anGogh. unexpected dilemma. A potent new drama on the last agony ofVincent Van Aug 26-30 20.15 (21,50) £5.00 (£3.00) C.C.T. ©0©0 Venue BristoI0am-5pm) Square, (near Fringe Club) Tix 650238201- Chapl(preain7cyAugCentre, 651 I 1332 LI2 THE BEDSELLER’STALE Interior sprung, firmerotic, edge orcontemplative, pocketed springs -★Exotic ‘choosing a bed is like choosing a wife’. Humorous, dark. fantasies. Worldsin CCT’s within worlds. Poet Caroline Smith and composer Jon Nicholls Aug 9-17collaborate 14.30 (15.30) £5.00 powerful (£3.50) ensemble production. THE CHERUB COMPANY OO©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 HI0 ★ ■ TEN DAYS’ A MAZE, ORTHE Fast, PRODIGIOUS MYSTERIES OFsecret THE SARAGOSSA MANUSCRIPT fantastical erotic comedy of desires: gruesomeFringe adventures with oriental beauties, madmen, gypsies and the heavenly First winners in adult(£5.00) physical theatre. Aug 10-30twins. (not 17) 21.00 (22.00) £7.00 CIRQUE BAROQUE ©O©© Venue 147 - Cirque Baroque, Leith Links Tickets 477 7200 D20 ■andCANDIDES Virtuoso international circuschoreography theatre uses soaring high live wire trapeze, brilliant visual imagery, sensuous and superb music to reinvent Voltaire’sprofessionals’ Candide.'Fullle Monde,‘Dynamite!’ of new ideas, grace,L’Express. rhythm...perfectly executed by19.30 impeccable Aug 6-3 I (21.00) £ 10. 0 0 (£8.00 conc.Tue-Thur only) (£20.00 family: 2 children, I adult) 76

9-30 August 1997 (exc 11 + 26) Box Office: 0131 226 2428 Fringe Office: 0131 226 5138 Out of Joint/Royal Court Theatre Production

ASSEMBLY ROOMS THE MUSIC HALL


CITY LIGHT PRODUCTIONS Venue 90 - Graffiti, Corner Broughton and East London Streets Tickets 5578330 GL ★ ■ THEgorged KEROUAC TRIANGLE Rebellifehero of theA Beat Movement,of Jack Kerouac himself on books, friends, and jazz. dramatisation the love triangle behind and his lover, cult novel ‘On Cassady. the Road’, produced in collaboration with thehimsurviving Carolyn CONSPIRACY THEATRE Aug 1-7 19. 3 0 (20.50) £6.00 (£5.00) Aug 9,10,12-17,19-22,24,26-30 22.40 (midnight) Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ■ THYESTES 1997 Sunday TimesAnNSDF award-winners in Caryl Churchill’s CLOSE TO YOU translation of Seneca’s masterpiece. impotent King’s family is at war with itself. The classical collides contemporary an explosiveSunday psychological Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 landscape.‘Elaborate terrorwith whichthe£5.00 leaves you deeplyin impressed.’ Times. CLOSE TO YOU Sarah Davison is Raelene Heslop, a vision from hell in a Aug 6-30 (not 17) 14.00(15.15) (£4.00) tangerine pantsuit. She IS the third Carpenter. A dark tale of obsession and bri-nylon with great songs, bad clothes and very bad hair. ‘Kitsch with knobs o CORAZON PRODUCTIONS WITH PARADISE BY Time Out.Aug WAY OF KENSAL GREEN ©O©© Preview 8 16.25 (17.40) £5.00 25 (17.40) £7.50 (£6.50) Aug 9,10,12-14,17,19-21,25,27-30 Venue 19 - C, Over-Seas House, 100 Princes Street Tickets 225 5105 110 Aug 15,16,22-24 16.25 (17.40) £8.5016.(£7.50) ★performance ■ HERE IbyPAINT MYSELF, FRIDA KAHLO This one-woman Jillian Tipene fuses poetic text, dance, live music and visual COMMUNICADOTHEATRE COMPANY to embody Mexican artistofFrida her inner world and oooo images portraying the significant her lifeKahlo, - withexploring complimentary Venue 15 - Traverse Theatre, Cambridge Street, off Lothian Road Tickets 228 1404. J9 Aug 6-30 (not 28) 22.30events (23.30) £5.50 (£4.50) (Free tequila) tequila! PAY WHAT YOU CAN PREMIERE The Suicide by Nikolai Erdman. Director Gerry Mulgrew.farce. £2 orBookmorein person buys yourat Traverse ticket forfrom Communicado’s GEORGE COSTIGAN ©O©© hilarious, death-defying 29 July. Full fringe performance details Traverse listing. Venue 2 - Fringe Club,Teviot Row, Bristo Sq. Tickets 226 5138 LI I Aug 10 20.00(22.40) £2.00 or more TRUST BYRON ‘George Costigan’s brilliant one-man show....You’ll learnfrom more about Byron, the spirit of poetry and life itself from this show than a year’s9-26worth lectures. Go on, see and be inspired’ Howard Walker. COMPANY THEATRE (notof18)Fringe 18.00Club (20.30) £6.50it (£5.50) Venue 47 -The Cafe Royal, l7West Register Street Tickets 556 2549 I Aug Ticket includes Membership for the evening HANCOCK’S LAST HALF HOUR by Heathcote Williams.An established Fringe cult. Pip Utton returns in his ‘uncannily accurate portrayal’ Sunday Times. ‘He gets the Mail laughsonthrough the tears as skillfully as Hancock himself’ The List. ‘Impeccable’ Sunday. Aug 15.10(16.00) Double9-30Bill(notprice28)(with Stone Me£5.00 - see(£4.00) Comedy & Revue) £7.50 HELP & INFORMATION Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 RING THE FRINGE ON 0131-226 5257 or 5259 Open 10am-6pm (June a July) ELSIE AND NORM’S MACBETH Fed up with playing Trivial Pursuit, Elsie and 10am-7pm (during August) and Normlounge. treatMind theiryou, gueststhetopoetry a spotneeds of culture withanda performance of Macbeth in their updating a few jokes added. Aug 9-17 20.30 (21.55) £6.00 (£5.00) Aug 18-23 21.20 22.05 (23.30) Aug 24-30 (22.45) BOUND & GAggED PRESENTS

§

BOUND&GA6ffiDP“*«

n|Y

rlJUNY,

'HE PERFORMS STAND-UP'S GREATEST MAGIC SIMPLY BY BEING HIMSELF' THE HERALD

m DAVE JOHNS 18 - 30 August (Except 13 & 28) at 10.15pm Preview 8 August 77


Sc^BrsTti-Olil WSUNUjtO^ OFF THE KERB PRODUCTIONS PRESENTS IN ASSOCIATION WITH . r • THE PARAMOUNT COMEDY CHANNEL, VISION VIDEO LTD An Evening with and assembly theatre ltd

JACKDEE i /‘Naw is your chance to m see this classic comic " ...a timelessWil istand-up” am Cook The Guardian “a midget terrier in a flashy suit with vicious-look eyes” |

THURS21&TUES 26 AUGUST 8PM

f

PLAYHOUSE 18-22 Greenside Place, Edinburgh 0131 557 2590 or Fringe Office0131 226 5138 THIS SHOW CONTAINS MATERIAL WHICH SOME PEOPLE MAY FIND OFFENSIVE OFF THE KERB PRODUCTIONS PRESENTS A BENEFI T IN AID OF EDINBURGH RAPE CRISIS & GLASGOW WOMEN'S SUPPORT GROUP

‘A carbuncle on the hard-earnedj face of feminism^ on Sunday WITH SPECIAL GUESTS MARK LAMARR JEFF GREEN RICHARO MORTON ANDY RORINSON

CRAZY HORSE THEATRE COMPANY OO©© Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 ★film■extras HEAVY BREATHING Noisy lust, silent sex and trivial pursuit as two fall out of love and into bed. NSDF award-winning production from the writer controlled...’ of last year’s Sunday hit comedy,‘Hunting the Snark’.‘Cool, quirky and beautifully Times. 19.45of(20.45) Aug 10,12,14,16,18,20,22,24,26,28,30 £5.00 (£4.00) ★ ■ DRIPDRY Headfailedin aescapologists whirl? Whirl and it some more, in a spinhousewives. cycle of psychotic brownies, algebra-obsessed Allnewthiscomedy and more tumbled together inanda visually dazzling,funny’ highlyVarsity. innovative extravaganza, ‘poignant excrutiatingly ‘highlyI 1,commended’ The Guardian. 19.45 (20.45) £5.00 (£4.00) Aug 13,15,17,21,23,25,27,29 CRUMPET THEATRE COMPANY 00©0 Venue 51 - Diverse Attractions Complex, 112 West Bow, Grassmarket Tickets 226 4412 K11 ■theTRAFFORD TANZI An exciting, dramatic and humorous play from popular ACrumpet Theatre whonightmare celebrateas their Festival appearance. hardcomic hitting rideCompany, intoTanzi’s her past10thhaunts her through dark characters, house music and wrestling. Aug 18-23 16.00(17.05) £4.50 (£3.50) CRYING IN PUBLIC PLACES ©O©© Venue 38 -The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 KI2 ★Australians. ■ JUMP!Stunning Four women! Four great voices! Four internationally renowned original music, soaring harmonies, intimate confessions ...sheer nerve. Examining that great leap forward - LIFE. ATheCappella with Attitude.‘intriguing, imaginative, subversive and hilarious’ Age, Australia; ‘Scalp-tingling Aug 8-30 (notpassion 11,18) and19.1rhetoric’ 5 (20.20) The£8.00Mercury. (£6.00) CYGNET THEATRE ©OOO Venue 167 - Moray House Theatre, Canongate/St John’s Street Tickets 667 2212 K14 ROMEO AND JULIET A crystal clear, traditional production, gorgeously costumed.This is a perfect opportunity for students of the text to see the play come alive with all theELECTRICS. drama, insight and romance of Shakespeare’s vision. Sponsored Aug 7-16 by15.00STAGE (17.30) £6.00 (£5.00) ■in-depth MICHAEL CHEKHOV ACTINGandWORKSHOP demanding preparation performance character work.Exciting Led byandprofessional actors. Sponsored by13.for STAGE ELECTRICS. Aug 9,11,13,15,16 45 (15.00) £4.00 (£3.50) DAEDALUS THEATRE COMPANY ©OOO Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 2257226 KIO AUDENWarTwo, AND ISHERWOOD’S THE ASCENT OFtheF6unclimbable In the build-up toWorld a reluctant mountaineer must scale F6 to preventandthesome inevitable. A mystical journey encompassing tragedy, comedy, live music of Auden’s poetry. Aug 8-16 12.15(14.05) £5.00best(£4.00) DARK MATTER ©O©© Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★sound MILES AND CRANE’S MEN IN BLACK Whatever we say is gonna wanky, sounnecessary lets cut theviolence. crap. It’sWea black swearing, cigarettes and thinkcomedy it’s greatthriller and wewithshould know, we wrote it. Aug 6-30 15.30 (16.30) £4.00 (£3.00) DEMARCO EUROPEAN ART FOUNDATION OO©© Venue Tickets22558- Demarco 7330 European Art Foundation, St Mary’s School,York Lane/Albany St HI3 ★ ■ MARRIAGE - DZE-YA? BELARUS STATEof THEATRE Bawdy, boisterous, humorous and romantic interpretation Gogol’s classic comedy using mime, dance,bymusic and arebothamplified English byandspectacular Belarusian costumes language. Original characterisations the cast generating powerful, humorous Aug 11-16emotional, 13.00 (14.30) £5.00 entertainment. (£3.00) ★Leqoc/Gaulier) ■ KALEIDOSCOPE - THE BARELY ENSEMBLE 15 Actors (ex fromrepertoire. ten different countriesunique present, selected pieces from their An celebration exciting, and every physicalafternoon, world ofimagination. clown, mask, chorus, puppets, dance...a of international creative Aug 11-30 (not Suns) 15.15 (16.30) £5.00 (£3.00) ★presented ■ A SUBLIME DISCORD: SAND notorious & CHOPIN By RomaTomelty, by Centre Stage (Belfast).The novelist reflectsChopin on her affair with the brilliant Polish pianist whose ghost lingers to play many favourites. ‘A riveting performance’ Belfast Telegraph. Aug 11-16 15.30 (16.40) £5.00 (£3.00) ★bird■sings TWO ROOMS BLUE RIDGEis aTHEATRE FESTIVAL The caged stay ’S-.- Government’s Two Rooms provocative,policies, compelling drama involvingofthetoa devoted media,alive.U.couple. international and the spiritual survival Written by the popular Lee Blessing. Aug 14-16 17.00 (19.00) £5.00 (£3.00) Aug 14-16 23.00 (01.00)


★ ■TheTHEElements’ DINNER PARTY Spellbinding variation(Theatre of‘SleepingKana), Beauty’ bySreekumar, cast:Jacek Zawadski Priyaanddevised Haftorofinternational Medboe, Andrew Dallmeyer, Avidance Nassa,andlocalmusic. people guests! Theatre Being’ with improvised drama, Accessible! Aug I 1-30 (not Suns) 17.IS (18.30) £5.00 (£3.00) ★ ■ DISINTEGRATION - DZE-YA? BELARUS THEATRE Shakespeare’s sonnets and tragedies fused into Emotion this newSTATE dramaenergy in English and Belarusian with innovative, colourful costumes. and award-winning professional Belarusian actingofillustrates Shakespeare’sfrom thoughts about arguments and convictions his great characters. Aug 11-16 19.00 (20.30) £5.00 (£3.00) ■clerk, THE OVERCOAT - CREDO Gogol’s storytoabout a ghost,upa overcoat: about the freeTHEATRE human spirit refusing be buttoned ininternational anyand coat.anFunny and sad. A fantastic beginning and an unexpected ending. 5 awards.(23.00) 5 stars£5.00 from(£3.00) The Scotsman 1996. Aug 18-23 11-16 22.00 Aug 19.45 (20.45) ★ ■messengers ANGELS between MEMORIES - DAH TEATAR Three actresses angels are people andpieces ideas, heaven and earth. Theyplaying remember their different lives on earth, acting of their broken memories.They are like bridges worlds£5.00above(£3.00) and below. Aug 11-16 between 22.00 (23.00) ■by THE OF BERNARDA ALBA Tragedyoppressive by LorcaSpanish performed QueenHOUSE Anne’s School intoEnglish translation.The heat pervades the background a play of passion and jealousy among an inhibited family of women stifled by their village customs. Aug 18-23 11.30 (12.45) £5.00 (£3.00) ★Lemon ■ LEMON SISTERS ThesourIcelandic Take-Away (ITAT) presents sweetandandmagic, aboutreminded twoTheatre hopeful who bringSisters. aboutA fun butcomedy aremiracles. soon of theglobetrotters historic fact that some people are not mad about Aug 18-23 13.30 (14.30) £5.00 (£3.00) IF I AM MEDEA? The actress Zofia Kalinska compares her bypersonal with thatand of theHeloise’ mythical Medea. Inspired by ‘Medea Material’ HeinerlifeMuller, ‘Abelard by R. Duncan and ‘Salome’ by Oscar Wilde. Aug 18-23 15.00 (15.50) £5.00 (£3.00) ■of MACBETH by Trident Theatre Shakespeare’s and tragedy obsessive lovePerformed and destructive ambition. An Company. uncut,atmospheric’ uncompromising vicious production.‘High standard...brilliant...really Nottingham Evening18-23 Post.‘Extraordinary performances..gripping stuff’ BBC. Aug 15.00 (17.00) £5.00 (£3.50) ★ AN AIS ANAGRAM Written by Kathryn Willsteed, performed by Roberta . Lemon. Revelations ofofchildhood abuse adult incestandthrow a blinding on the11,18 complexities Anafs£3.50Nin(£3.00) and herandmysterious challenging opus.light Aug 19.00 (19.30) Aug 13,16,20,23 23.00 (23.30) ★ IN YER FACE Themescensorship of isolation,of HIV and drug misuse are explored in three short plays without thought, feeling or language - issues relevant to young people’s culture today. Written in collaboration with young , people in Fife21.00 and (23.00) performed Charlie’s Posse. Aug 18-23 £5.00by(£3.00) ★ ■ THE RIVER-MERCHANT’S WIFE short, delightfully creative, I' sensual and imaginative journey, basedCompany aroundAvarious stories/poems from love, ancient civilisations.The Nightwood explore identity, physicality, patience and independence through dance, music, text, film, mime, smells, i silhouettes Aug 18-23 and22.00shadows. (23.00) £5.00 (£3.50) ★ ■magical IN YOUR DREAMS and-her pals go onfantasy an extraordinary . and journey of artisticDorothy discovery a Britain. theatrical which looks at the realities of community arts in today’s Presented by Craigmillar • Aug Festival25-30 Society13.30with(14.30) linked£2.00 art exhibition. (£1.00) ■performance RUSSIANsubtly ANGUISH Krasnaya Presnya’s cabaretsongs of nostalgia is Russia a dramais laced with humour and toincludes by whichsoul, recognised worldwide. Far from giving way the grieving Russian this work explores the strength and sadness of all humanity. Aug 11-23 (not 17) 19.45 (20.45) £5.00 (£3.00) ★ ■ NOSTALGIA Thecomplicated Belarus Republic Theatrebetween Laboratory presents a play about thewhoromantic andwidely relationship and Esenin travelled in the Twenties. BasedTapdancing. on theirIsadora diaries Duncan and Russian poetry, using music and dances like Foxtrot and Aug 25-30 17.30 (18.15) £4.00 (£2.00) ★ ■ THE NIGHT OF THE GREAT SEASON - AKNE THEATRE 1 Characters from Bruno Schulz’s novels are stuck in a room, imprisoned inbuttheall space between earth and heaven. frozen19.00 in time. cast. Some alive, some still alive, some dead 'Aug 25-30 (20.00)Multinational £5.00 (£3.00) ★ JOURNEY A bomb beingsurvived carriedtoonwrite a London bus experience. accidentally explodes. Paris Panther miraculously about the Aon combination of monologues, poetry, music and video footage takes you trip through Auga virtual 25-30 reality 19.30 (20.30) £5.00 Paris’s (£3.00)odyssey of self-discovery. Venue 109 - Craigmil ar Castle, Craigmil ar Tickets 558 7330 PI4 Outer ■Shakespeare’s ROMEO AND JULIET Box Hedgein the Theatre Companyopen-air presentssetting of most romantic tragedy unparalleled P Craigmillar Castle. A beautiful, timeless production, the climax of a two-month national14-17tour,‘Romeo Aug 20.00 (22.45)and Juliet’ £ 12.00promises (£8.00) to be an unforgettable evening.

AUGUST 8TH -3UTH [NUT 11,18,28)

THEATRE

irgsents

THE SUICIDE by Nikolai Erdman A furious, funny five-act farce Directed by Gerry Mulgrew

Tues 12 - Sat 30 August TICKETS £10. £6 cones 0131 228 1404 Traverse Theatre Cambridge Street

Sun 10 August PAY WHAT YOU CAN PREMIERE bring whatever money you can afford to the Traverse (from Sunday 29 July) and exchange for 1 ticket. Translators Eileen Thalenberg & Alan Richardson. Publisher Mosaic Press 79


DICE THEATRE COMPANY 00©0 THCATRC Venue 136-Telford College, Crewe Toll BS ■world THEofSLAB BOYS Let Dice Theatre Company whirl you back to 1957 to a Elvis and Brylcreem, carpets and James Dean. Follow the hopes and dreams of Phil, Spanky and Hector in John Byrne’s ‘laugh a minute’ Scots Classic. DE MONTFORTTHEATRE COMPANY OOO© Aug 15-23 (not 17) 19.30 (21.30) £6.00 (£4.00) Venue BrlstoI0am-5pm) Square, (near Fringe Club) DIVERSE ATTRACTIONS OO©© Tix 650238201- Chapl(preain7cyAugCentre, 651 I 1332 112 Venue 11 - Diverse Attractions, Riddles Court, off Lawnmarket Tickets 225 8961 Jl I Aproperties TASTE ofOFtheHONEY Shelagh Delaney’s 1958 playuneasy containsrelationships all the Edinburgh’s unique award-winning community venue. Between the sponsored kitchen sink genre. Its focus on the polish of The Assembly Rooms and the dire risks of the commercialised Fringe inpotential families,ofandits witty its exploration of controversial themes escalates the tragic there two venues reason prevails. Open 9am - midnight. Cafe, northern theatre,aremusic, poetry where and dance. Aug 24-30 14.15 (15.45) £4.00characters. (£3.00) ■ SGANARELLE’ BLOODforWEDDING Lorca’s play is oneruralof the powerful & innovative ofEdinburgh love£5.00 and People’s mistakenTheatre identitypresent in a newSganarelle’ adaptation.by Moliere. written theatre. Spain,most of passion seeking This Aug classic 11-16 comedy 20.00 (21.00) tomatriarchal overcomethe theEuropean destructive natureSetofinfate, within thea tale confines of a harsh society. ■ SHIRLEY VALENTINE Shirley,toa Greece’. put upon housewife, heads for the sun. Aug 24-30 16.10 (17.45) £4.00 (£3.00) The the table ‘Gone Aug note I 1-16on 21.45 (23.10)reads£5.00 (£3.00) DESIRABLE RESIDENCE THEATRE ©0©0 ★ WE’RE ALL SWEET HERE Organised to an inch, yet the weedkiller Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 and into(19.00) the bathroom. Citadel Theatre Group. Auglemon I 1-16 got18.00 £4.50 (£3.00) ★Helen BRIEF AND BIG TIME PERFECT Feeling guilty about not feeling guilty? (ball’s new play re-invents the scenario of the classic 1940s movie Brief HOTmenopausal FLUSHESwomen The Melo-Marinello Players lookmaking irreverently and men songfully Encounter the 90s. Magic Realist text and energised physical theatre merge at★ two with fertile imaginations plans with in toAug amuse andfor disturb. mind. 18-23 8,10,12,14,16,18,20,22 18.00 (18.50) £5.00 (£3.50) Aug 21.45 (23.15) £5.00 (£3.00) ★ THE ARNOLD CROMBECK STORYWitty ArnoldandCrombeck infamous ★ FISHERMAN’S MOON AND THE LOGOS COLLECTION by Eric mild-mannered monster awaiting execution. twisted, theis thecompany Morgan. Springwell Players. Fisherman’s Moon - a musical comedy;The Logos adopts a narrative approach when unravelling Crombeck’s poisonous mind. Collection conscience. An adaptation of the story by the ‘darkly humorous’ Patrick McGrath. Aug 18-23 - examines 11.45 (13.15)crime£4.50and(£3.00) Aug 9,11,13,15,17,19,21,23 18.00 (18.50) £5.00 (£3.50) WALKINGnew ON THE ROOF MsFits - Rona Munro, Four star awards everyFiona year.Knowles with a THE DESPERADO THEATRE COMPANY 00©0 spellbinding 18-23 19.45comedy (21.00) drama. £5.00 (£3.50) Venue 124 - The Sheraton Grand Hotel, Festival Square, Lothian Road Tickets 229 9131 J8 Aug ★Mairi’s ■ ALL by Chameleon Company. THE ANATOMIST murderers andcentury a sinisterEdinburgh, medical genius arrivalFORhomeMAIRI’S with herWEDDING Glasgow fiance results in aTheatre fine Hebridean inhighBridie’s popular blacklifeProstitutes, comedy ofevilearly nineteenth where comedy. society and low witness the hideous truth of Dr Knox’s shady Aug 18-23 17.45 (19.15) £4.50 (£3.50) connexion Hare.(£3.50) ★ ■ OTHER PEOPLE’S FOOTSTEPS R.U.Theatre CompanyPluspresents Aug 17-22 with 19.00Burke (21.30)and£5.00 Other People’s Footsteps, written and directed by John Harvey. Romance, a short25-30 curtain-raiser Aug 20.00 (21.10)by Jan£6.00Natanson. (£3.00)

PEASY HE COMEDY FACTO ITY

<

I

|

i


★ ■ A CALENDAR OF LOVE Tweed Theatre. A tribute to the Orkney poet George Mackay Brown£4.00through Aug 18-23 18.30 (19.30) (£3.50)his own magical words. ★A WOMEN SPREAD THE WORD Poetry, comedy, prose, drama. provocative performance by the ‘words’ women of Edinburgh’s Adult Learning Project. Aug 18-23 15.45 (16.45) £3.00 (£1.00) ★ ■another NO SPRING CHICKENS/A Thesetosisters aim for 5 star success with songs,WEE poetryWORD and harping celebrate the Scots language. Aug 11-16 12. 0 0 (13.00) £4.00 (£3.00) Aug 14-16 20.00 (21.00) £4.50 (£3.50) ★ THEinvestigators, NET FILESaskTickled Productions. Scullery and Mouldy, the fish board - ‘is£3.50 theTrout troot Aug 11-13 12.00 (13.00) (£2.00)really (£0.50ootC)there???’ ★ BULLY-DOZER and Moving Parts. Bossy Bully-Dozer gets taught a lesson by Daphne-Dumptruck Aug I 1-13 14.30(15.15) Colin-Crane.‘Best £3.50 (£2.50) (£0.50show C) for under eights’ Scotsman. MENmale-THE FINAL Baggy of★ the stoppingFRONTIER a pint on(£0.50 the C)Breeks. way. Unchartered emptiness Aug 14-16 psyche, 12.00 (13.00) £3.50for(£2.50) ★ HAVING ofA women GOOD TIME Blisshairdo Theatre. An exceptional party in the required! Augcompany 11-13 13.30(14.15)- no£3.50new(£2.00) (£0.50 C) ★ MULTIPLE DIVISION Bash.Working ina divided the factory there’s no need for questions until love opens your eyes to Aug 14-16 14.00 (15.00) £3.50 (£2.50) (£0.50 C) city. UNDERSTANDING POETRY AND PLAY READING Readings by Thom Nairn,MAGAZINE Paulpeople Hullach,from Susanna Roxman, contributors to Understanding Magazine, and the floor. Aug 15,16 21.45 (23.15) £2.50 (£2.00) ROBERT BURNS SplinterofTheatre ToAug celebrate his life,(21.00) anSecond exploration the poetCompany. and the Poet, man. songwriter, patriot. 27-30 20.00 £3.00 (£2.00) ★ THE toLADYCHAPEL the silent loneliness separation breaking through a secret strength.explores Performed by Roslyn Gentle.ofCo-ordinated by Brahma Kumaris. Aug 11-13,18-23 20.00 (21.00) £3.50 (£2.00) ★ POSTCARDS Napier Drama Society presents Postcards - The weather is 1 here, wish you17.were lovely...£5.00 A selection Aug 25-30 45 (19.00) (£3.00) of short stories to provoke idle minds.

DIVERSE ATTRACTIONS THEATRE COMPLEX OO©© Venue 51 - Diverse Attractions Complex, 112 West Bow, Grassmarket Tickets 226 4412 KM ★conservatories ■ MURDERandHOUSE International Murder. inChewed umbrellas, imaginary fish fixations are all involved this absurdist murder mystery. Aug 25-30 18.00 (19.00) £6.00 (£4.00) ★ SLEEP ISLAND Productions - Touched Sleep... tell AND me yourCALIBAN’S dreams, fantasy, reality, Ugly growing up. Caliban’s Island...Theatre. run, run, away? Injustice Aug I 1-16Tempest, 15.45(17.15) £5.001997.(£3.50) ★ ■ MEDEA by Vestris.Thecantopfly.‘show from Hellchoreographic returns! Plus talent’ ‘A Faustbook’: you’ll believe16.00 grand-pianos A remarkable The Stage. Aug 25-30 (17.00) £2.50 (£2.00) ■contrasting LOVERSsetsBy ofBrianloversFriel.in Edinburgh Graduate Theatre Group examines two this (£4.50) funny and moving play. Aug I 1-16 19.35(21.15) £6.00 ★ ■ SNOGII?AND OTHER Lip Theatre Braveheart Here’s(23.15) 90s life£3.50LipSTORIES style - you’ll laugh, barf,Company. want a Remember kebab. Aug 11-16 21.45 (£2.50) ■timeless MEASURE FOR MEASURE A cutting-edge adaptation of Shakespeare’s parablegovernment. of political corruption and social anarchy, following 18 years ofAugineffectual 11-23 (not 17) 17.45 (19.15) £4.00 (£2.50) ■andYEATS IN PERFORMANCE The Poetry Agency presents contemporary interpretation ofYeats, drawing on man, myth anandexciting politics. Aug 25-30 19.45 (21.15) £6.00 (£4.00) DOUBLE EDGE DRAMA OO©© Venue 97 - Overtures at the Edinburgh Playhouse, Greenside Place Tix 0705 003 9496 HI4 ★poetry IN TRANSITION a new play by Richard Gowan. Paris, 1950. Jazz, and sexbutonthethecynics Left and Bank. A youngproveEnglish writer casts a cool eye on The Scene’, Aug 18,22 19.00 (20.30) £6.00 sinners (£4.00) brutally seductive. Aug 19,23,26,30 13. 0 0 (14.30) Aug Aug 20,27 21,28 15.17.0000 (16.30) (18.30) DOUBLE EDGE DRAMA continues on next page


THCATRC DOUBLE EDGE DRAMA continued ★Brigade BLOOD AND Berlin, 1945. Aschildhood. defeat looms, Hitler’s Tiger salvationHONOUR in thewhose evocation A poignant byPleasance, Angusfinds Graham-Campbell last ofplaylosttransferred from Edinburghnewtodrama the London in 1996. Aug 18,22,25,29 17.00 (18.30) £6.00 (£4.00) Aug 19,23,30 19. 0 0 (20.30) Aug Aug 20,27 21,28 13.00 15.00 (14.30) (16.30) ★school, WHO’S LAUGHING NOW? Mackinnon.An Englisha boarding today. A rebel-bully, victimbynew & Bruce theirdrama mutual friendson the launch attack on ‘therelationships. system’.This hispowerful focuses boys’stinging tense and often comic Aug 18,22,25,29 15. 0 0 (16.30) £6.00 (£4.00) Aug 19,23,26,30 (20.30) 17.00 (18.30) Aug Aug 20,27 21,28 19.13.0000 (14.30) ★in conflict. THE CRITIC a newhours play ofby rehearsal David Eltis.overMoscow, 1932-36.Art and politics After 1,097 fourtheyears, Bulgakov’s‘Moliere’ reaches the stage. It is savaged by the critics, but author is unrepentant... Aug 18,22,25,29 13.00 Aug 19,23,26,3000 (18.30) 15.00 (14.30) (16.30) £6.00 (£4.00) Aug Aug 20,27 28 19.017.0 (20.30) THE DYLAN DOG THEATRE COMPANY ©OOO Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 ★ ■ MEMORIES FROM THE INVISIBLE Gripping murder mystery drama from a young, award-winning Anglo-ltalian group. Fresh from performances in Paris and London, comic strip adventure follows an investigation to find modern day this ‘Jacksurreal the£5.00Ripper’. Auga9-16 17.15(19.00) (£4.00) ECLIPSE ©Q©© Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 ★originality JAQUESwhere ANDthree HISinterwoven MASTERlove Milanstories Kundera’s masterpiece of comedy and take place in two simultaneously running17-30 time12.00 dimensions, Aug (13.30) from £5.00which (£3.50)the audience is not excluded... THE SEAGULL Chekhov’sglamorous greatest playpresence revolves around a group gathered the acountry.The a famouspresent. actressofandfriends her lover8-16,24-30 soonin has profound impact£5.00on (£3.50) the lives of allof those Aug 19.30 (21.00) ECLIPSE THEATRE COMPANY OOO© Venue 40 - The Quaker Meeting House, 7VictoriaTerrace. Tickets 220 6109 J11 THE CHEVIOT,THE STAGtheAND THE ofBLACK, BLACK OIL An a exuberant ceilidh play telling real story Scotland. Steeped in humour, production vivacity(£2.50) that grips from start to finish’ The Herald. Aug 25-30 with 18.00‘theatrical (20.00) £5.00 EDINBURGH ACTING SCHOOL 00©0 Venue 177 - YMCA, 73 Ferry Road B17 SEE HOWTHEY RUN King’s Following‘96’s four starof mix-ups productionandofmistaken Stags and Hens, EAS presents Philip farcical cocktail identities - another side-splitting production. Aug 19-23Aug 19.2300 (21.30) £6.00 £6.00 (£4.50) Matinee 14.30 (17.00) (£4.50) ★of ■loveTONGUE-TIED In Scott Hart’s newinplay,thisaabsurd tramp struggles with the joys andevoking the frustrations ofChaplin bureaucracy (but romantic) comedy, the spirit of and Music Hall.‘Hart’s ‘Sunshine’...impressive...absurdist and finely judged.’ Scotsman ‘96. Aug 19-23 22.00 (23.10) £5.50 (£4.50) EDINBURGH GAELIC DRAMA GROUP OOO© Venue 83 - St Serf’s Church Hall, Clark Road, Goldenacre AI2 ■to CLUICHEADAIREAN DHUN EIDEANN ANDmusic FRIENDS inviteRoyalyou join them for an enjoyable evening of Gaelic drama, and song. National MODthewinners 1993,95 and 96. Fourth Fringe appearance. Critically acclaimed national Aug 27-29by19.30 (21.45) press. £4.00 (£3.00) EDINBURGH PEOPLE’S ©O©© Venue 17 - St Peter’s Church Hall, Lutton PlaTHEATRE ce PI3 ■theNE’ERTHE TWAIN An hilarious Scots comedy set in 1919 at the time of joining of Edinburgh and Leith. Do you join St Cuthberts or Leith ‘provie’ when the boundary runs right through your house? Capital Award-Winners 1994.9-30 Aug (not Suns) 19.45 (22.00) £5.00 82

I Assembly “A glorious hive of continual colourful activities” Tlieaitre Bob Kingdom Edgar Elsa Rapsngliion Productions Bring Me Sunshine Bye Bye Blackbird Sarah Davidson Close Tor You Denise Stokios Casa (B az!i) Great Jones Theatre Ho Boys' Life (USA) / Can’t Remember Anything by Arthur Miller (Russia) Jump To Cow Heaven by GiU Adams Kerry Shale The Prince of West End Avenue Krapp’s Last Tape by Samuel Beckett (USA) National Youth Music Theatre Aurelius The Valiant Apprentice & Tin Pan AH! Northern Broadside Anthony & Cleopatra Playing Burton Rodney Bewes Three Men in a Boat Spontaneous Combustion Steven Berkoff Massage Shopping & F***ing by Mark Ravenhiii Surfing by Robert Young The Ballad of Jimmy Costello (New Zealand) Think No Evil of Us - My Life with Kenneth Williams Vagabond Productions The Chairs by Ionesco Wasp by Steve Martin Wrestling School Wounds To The Face Franklyn Ajaya Talkin’ Vagabond Jazz (USA) Glynn Nicholas Crossing The Line (Australia) Graham Norton Hattie Hayridge Random Abstract Memory Jackie Clune Chicks With Flicks Jerry Sadowitz Magic Mark Little Owen O’Neill (Fire) Paul Morocco - 0'e Perrier Pick o? the Fringe Award Shows Poulter & Duff The A nf Taboo Rainer Hersch All Classical Music Explained Scared Weird Little Guys (Australia) The Topp Twins (New Zealand) The Right Size Do Yon Come Here Often? Steve Steen The Blues Brother Dance Tblisi Ballet (Georgia) Ttfusic ^Voc«l« <"al»AX*et Loyko The Russian Gypsy Band (Russia) Mika (New Zealand) Opera Circus Shameless! S King Stag Paul Brady (Eire) Ray Davies The Storyteller Vice and Verse: The Poetry of Murry Lachlan Young Risenga Joburg Streets (South Africa) Sharon Shannon (Eire) Steve Harley Cluh Latino with Sonora La Calle Just a Tickle Amnesty international Benefit Jo Brand Benefit Time J^iglmten Up Uome«ly Festival In Association with Marlboro Lights For your free brochure 0131 226 5992 M5!m ASSEMBLY ROOMS ISKl»kW«VA 60X OFFICE 0131 226 2426

1


THCATRC J0HI1 HEGLEy at The Traverse

EDINBURGH THEATRE ARTS ®0©0 Venue 71 - St Ninians, Comely Bank Road Tickets 553 1549 E6 OF MICE AND MEN Steinbeck’s riveting drama of human aspirations and tragedy set in depression-ridden America of the 30s. George and Lenny’s search for securitytale.and happiness ends in tragedy. Pathos and humour combine in thismodest harrowing Aug 8-21 (not ID,17) 19.40 (22.30) £6.00 (£5.00) Aug 9,16 14.40(17.30) EDINBURGH UNIVERSITY THEATRE COMPANYoo©o Venue 49 - Bedlam Theatre, 11 b Bristo Place Tickets 225 9893 L11 SLAVS! Scottishwalks! premiere ofis afollow-up to Tony Kushner’s acclaimed AngelsTheIn America.Yeltsin God bourgeois! Chernobyl cloned sheep first! Politburo but the human spirit survives on vodka and sorrow. What IS toAug be 11-23 done?suffers (not 17) 22.15 (23.15) £5.00 (£3.00) ★he ■begins TIMON A man and the city.The lovecityaffaireatsis ending.Jilted and embittered aoftragic venture. Behind him, the itself alive.of‘Dubliners’ Radical adaptation Shakespeare’s ‘Timon of Athens’ from director (FringeI 1-23 First,(not1996).17) 18.15 (19.45) £5.00 (£3.00) Aug EDINBURGH YOUTH THEATRE 00©0 Venue 128 - Youth International at St Oswald’s, Montpelier Park Info/Tix 346 1405 or 229 5562 N6 ★ ■ A MIGRATION SOULS The EYT perform and intimate set in 16thof OF century and acclaimed the New World. storyanaofmoving innocence against a epic background power andItalyintrigue.Visually stunningA with original score. Aug 14-23 (not 17) 19.45 (22.00) £5.00 (£3.00)

PACIFIC RIM PRESENTS mini

Pacific Rim and Assembly Theatre presents “He’s a five star comedy deity inGlhis asgow Herown ald right” “A POWERFULLY FUNNY STAND-UP”

From ITV’s Saturday Live “HILARIOUS, WATCH Wil iam Cook,THIS The GuardMAN!” ian

O'NEILL OFF MY FACE ■“fffilOPM ASSEMBLY ROOMS 0131 226 2428

EXACTING THEATRE COMPANY ®0©© Venue 127 - St John’s Church, West End, Princes Street 19 ■movingly BECKET by Anouilh. Exacting, on the back of their cathedral tour, present a witty play charting the violent deterioration of a relationship between acompany’ Norman sensualistMorning king andNews.his Saxon friend.‘A startlingly innovative young Aug 9-16 Western 19.30 (21.30) £5.50 (£5.00) Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 L13 ■excitingly ANTIGONE by onJeanoneAnouilh. Agreatest modernstories classic,ever Anouilh’s Antigone putsandan fresh spin of the told. Witty, comic profound in equal turns,Antigone follows up Exacting’s 1996 success with The Hound.£4.00 (£3.50) Aug Real 15-24Inspector 13.30 (15.00) Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 WHALE MUSICDeeply’ From -thean Oscar winningportrayal writer ofofThe Englishof aPatient’ and Truly, Madly, entertaining the seelives ofMinghella friends. Sometimes happy, sometimes sad, this is a must for all group Anthony Aug 9-16 fans. 20.40 (22.10) £5.00 (£4.50) THE FAMOUS GROUSE HOUSE - SCOTTISH INTERNATIONAL PRESENTS ®0© Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 I BURNS FOR BREAKFAST That’s right! -Rab ThetheBardRanter is back.returns Leapingto Auld off aReekie tartanandtea-towel to reclaim his reputation. invites you to breakfast. What better way to start the day? (Breakfast included) Aug 9-30 (not 18,26) 10.30 (11.30) £5.00 ★present CALIFORNIAN POPPYby JanD.M.G. Productions / Byre Theatre,asSttheAndrews, a newliveScottish Natanson Jan Wilson mother. Two sisters their livesplayAlexander. in the shadow of anfeaturing unconventional and powerful mother. Directed by Ken Aug 9-30 (not 18,26) 19.00(20.00) £8.00 (£6.00) CRUISING - CALLUS COMPANY byand Johntheir Herdman. High jinks ononthea cruise. high seas. An THEATRE Edinburgh Advocate, his wife joiner lock horns Scottish social mores hilariously exposed by a writer renowned for his ascerbic wit. Aug 21-30 (not 25) 17.00 (18.15) £7.00 (£5.00) ★ LIFE KEYNES Jack was a promising actor until the AND soap... DEATH the lossDuffy ofINaninMILTON arm intodreams. ventriloquism a talein ofa juggling puppetsaccident party bagsforces and him broken Aug 20-30 10.- 1Chris 5 (11.20) £5.00 ■Shakespeare. THE MERCHANT OF1990s: VENICE Productions movetheintoheiress? MoneyPrime is- power. Who’ll marry Will the justice, banker1590s get meet wiped outhatred financially and ofterminally? Friendship, love, revenge, mercy, racial and lots laughs. Aug 21-30 14.15 (16.15) £6.00 (£4.00) THE FAMOUS GROUSE HOUSE continues 83


Avalon Promotions presents

‘New lad? New confessional? Who cares? This audience was too busy roaring with laughter’ James Hampton, The Independent — August 15th - 23rd at 9.00pm PALLADIUM \ \ ) Box Office: 0131 557 2100 \ s° Credit Card Bookings: T0CTA: 0131 557 6969 For further information call the David Baddiel hotline on 0891 887766 [Calls cost 50p per minute at all times!

as seen on the X-FILES “Bac«!i,SfKsnre JQh MvT? ,

JjiL'l'JJj'Jjj ij’JJJj'JJ: h'J HjjjjJJUjjjdJ Us jJUJj Jli'JU iJj-iJAjidj women sumo wrest championships PALLflBDIUM M TICKETS FROM OFFICE0131 01315572266969 5138.(IQ-6 mon-SAT) TOCTA CREDITFRINGE CARDBOX HOTUNE VIRGIN & RIPPING VENUE BOX OFFICE 0131 557 2100 (CUBING FRINGE)


THE FAMOUS GROUSE HOUSE continued ★review ■ VAGABOND Acclaimed atBilltheRitch1996is John FringeMuir,‘Vagabond with a five starJohn’, The Scotsman,JOHN American the greatin Scottish-American whoseactor passion for the wilderness won the foundation of the American National Parks System. Aug 20-30 17.30 (18.30) £7.00 (£5.00) ★ SMART WOMEN,Nancy STUPID CHOICES your shrink appointment! Spokesmodel/therapist Hartman recountsCancel outrageous talesintelligent of Travel and and Love American style. Snacks will be served.‘Delighfully talented... ironic... Genius!’ Valley Vi e w, Hollywood Aug 10-30 (not 18,26) 22.30 (23.45) £6.00 (£4.00) AWAREHAUS presents PUGILIST Keeley. Inatthethe future, boxing is anTHEATRE illegitimate sport. TheTHE Pugilist takes bythe an Brian abrasive look personal conflicts within the fight game, ‘awesome..had audience on edge 21-26 of their12.15(13.15) seats...jaw dropping performances...’ Evening Express. the Aug £6.00 (£4.00) ★ captivating BOWHOUSE PROJECT present by Raymondtruth, Ross. Alove, comedy. near Sleeping the grave.Dogs EnterWake a world death andblack passion mergeA rave to create a goth-ic landscape wherewhere the spirits flow. Directed by JimTwaddale. Aug 21-30 12.00 (13.00) £5.00 (£3.00) ■Fringe PARALLEL LINES FreshCryptic’s from a sell-out Europeanproduction tour and returns last year’s First success,Theatre award-winning toAug the25-30 festival. Unmissable! 20.45 (21.45) £8.00 (£6.00) FESTIVAL THEATRE USC-USA ©O©© Venue Tickets25558- Drummond 9695 (afterCommunity 14 July) Theatre, Drummond Community High School, 41 Bellevue PI FI3 The University of Southern California’sitshighly acclaimed Fringe First Awardwinning company Americanrepertory classics. Buses 8,9,presents 13, 19,24, 39.18th Fringe season of premieres and ■Gorman. STAR Back WARSby TRILOGY THIRTY MINUTES by PatrickT. demand!near-hysteria., ‘TheINShow’s no-budget slapswon’t aAdapted grinupset on the from the outset and prompts a piss-take that thefacedevotees’ The List. Aug 12.00 (12.30) £5.0023.30 (midnight) Aug 9,16,23,30 11,13,15,18,20,22,25,27,29 RESERVOIR DOGS by Quentin Tarantinoadmirably...the adapted by PatrickT. Gorman. Back by demand! ***** ..Go see!theSucceeds authentic delivery Tarantino’s lines contribute to success of this study of betrayal and loyalty’of The Scotsman. Aug I 1,13,15,18,20,22,25,27,29 22.00 (22.30) £7.00 THE MUDDY FUNSTERS THEmialS A CANAL RUNS THROUGH IT directed by DIANE MESSIAS director of BBC Radio s "ONE FOOT IN THE GRAVE"

is fli S. : MARCOS [venue 98] 228 9116 8th - 30th August (not 17th) 4.45 pm - r—

THCATRC ★Music ■ OLYMPUS ONBased MY onMIND Musical. Bookmyth.‘A and Lyrics Barrymusical Harman, Grant Sturiale. thelyrics’Amphitryon dazzling spoof...bonding music and witty Newsdoy.‘Percolates with an oldfashioned sense of naughty musical22.00 comedy fun’ N.Y£5.00 .Times. Aug 12,14,16,19,21,23,26,28,30 (midnight) ★ SUBURBIA BY ERIC BOGOSIAN Is onethemes of the cover best plays season..one ofthethose rare must sees...Bogosian’s escapeofa the and See!’ re-invention, American Dream..and the American nightmare.Yes, Must Clive Barnes, N. Y . P ost. Aug 9 22.00 (midnight) £5.00 Aug 13,16,20,23,27,30 19.00 (21.30) ★ A PERFECT by Terrencemoving, McNally.‘..clearly McNally’s important toGANESH date. funny itsandconcerns. most of Clive all most life-Barnes, assertive, awork play that definesIt isitsabsorbing, time while addressing N.AugY. Post. 11,14,18,21,25,28 19.00 (21.30) £5.00 ★ VIVIEN:THE OTHER SIDE OFMovies, GONE Reminisce withperformed Vivien Leigh on theLafferty. the WITH MarriageTHE and WIND the Madness. Written and by Marcy Aug 11 14.00 (15.45) £5.00 Aug 13,27,30 16.00 (17.45) Aug 8,15,26 19.00 (20.45) ★ OBEDIENTLYYOURS, ORSON by Richard Francerecords and performed by- reminisces Robert Machray.At 70,illustrious a WELLES shell ofpastformer self, Welles voice-overs about his while waiting for Steven Spielberg to restore his career by financing his new movie. Aug 19.00(21.00) Aug 9,19,29 16.00 (18.00) £5.00 Aug 1815,22,23 14.00 (16.00) ★ LILLIAN BY WILLIAM Performed by world Eve Roberts on the autobiographical writings ofLUCE Lillianprowess, Heilman, theworks famousbased playwright ofpoignant great literary, political and social ‘...it absorbingly as ribald, entertainment’ William A.Henry, III Time Magazine. Aug 7,12,22 19.16.00 00 (20.45) Aug (17.45) £5.00 Aug 2516,20,29 14.00 (15.45) ★named JAMMED BY JOAN HEDDA TEWKESBURY LauraMISSZaneJULIE appears as an actress Tecca,a cue performing GABLER and on alternate She misses that triggers a conversation tangling the characters livesnights. with her own, it brings 16.an00unexpected solution. Aug 8,12,19,26 (17.30) £5.00 Aug 14,21,28 14.00 (15.30) ■EachSYLVIA BY A.R. GURNEY Hilarious comedy! Love triangle side tois right - husband - wife - puzzle. dog (bitch). Psychiatrist & frienderupts. try to offer solutions the chaos of the crazy Aug 9,13,16,20,23,27,30 14.00 (16.00) £5.00 WALLACE BYandJONATHAN MARCedge... SHERMAN ‘.is★. indeed aWOMEN deeplya fresh feltAND playremarkable with an original impressive comic Sherman Aug 9,12,15,19,22,26,29 14.mature 00 (15.30)voice’£5.00Howard Kissel, N.Y. Daily News. ★ MUD /plays TENTexamine MEETING These twoandunconventional contemporary American rural isolation power conflicts within inMeeting’ excitingbyandLarrypowerful theatrical ways.‘Mud’ by Maria Irene Fornes‘families’ and Tent Larson,16.Levi00 (18.30) Lee & Rebecca Aug 11,14,18,21,25,28 £5.00 Wackier. FIREFLY PRODUCTIONS ®0©0 Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 K10 ★ THE WEIGHT OFPop’sSMOKE Jimmo’s outtaandmoney, bug juice andto patience. His store’s bankrupt, spinning in his grave his Phizit wants become aperformances’T/ie man. Could a moldy box from Cuba spell salvation? 1996...‘Powerful Aug 8-23 (not 17)Stage. 15.20 (16.30) £5.00 (£3.00) FIRERAISERSTHEATRE COMPANY OO©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 H10 ★dangerous ■ ANDYandAND EDIE What was it like when drugs were new, sex wasn’t art was still shocking? Fireraisers new play uses music and physical theatre to evoke the glamorous world of Andy Warhol and his wildchild superstar, Ajg 10-30Edie(notSedgwick. 17,28) 22.40 (23.55) £5.00 (£4.00) FIRST AMONG SEQUELS OOO© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 iGO ★When OUTBobOFcomes TIMEtoWho is Bob? How does he know so much about Sylvy? dinner, Sylvy finds a soulmate whilst her husband fails toclimax. appear.The tension rises, till Bob’s relentless revelations provoke a startling Aug 24-30 20.15 (21.05) £4.50 (£3.50)


THCATRC

WING IT THING

. MAX FISHER OO©© ..Ian Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LI4 Kendall1 ★ ALONG CAME A SPIDER by Bradley Capper.theWas Mrs Danziger’s tragic death really an accident? Why would the girl with Selfridges shopping bag commit suicide? Could the Sergeant-Major be another victim of friendly fire? MURDER IS EASY-PEASY. pmms Aug 10 18.00 (19.25) £5.0018.00 (19.25) £7.00 (£6.00) Aug I -14,17-21,25-30 Aug I15,16,22-24 18.00 (19.25) £8.00 (£7.00) The FLYING PIG THEATRE COMPANY OO©© Magic Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 KI3 ★ Shakespearian MACBETH PRUNED AND HENRY V twice PULPED A comedy double bill Show ofthe anarchy. Macbeth performed in twenty minutes... Bard meets Tarantino in Henrybingo! V Pulped...and by popular demand, Reverand Damp’s Ecclestiastical Aug 18-30 (not 24) 13.55 (15.00) £5.00 (£4.00) Highly entertaining... FOOLERY 00©0 impressive magician's Venue 40 - The Quaker Meeting House, 7 Victoria Terrace. Tickets 220 6109 J11 skill." The ★ ■ CYRANO Swords, bells, rubber Noses, papercranes. FourClowns clownswithfrom Scotsman, Virginia (former members Shenandoah Shakespeare Express). swords attacking the tragedy of Cyrano deBergerac - Language and Action Fly me to the moon! Serious adult clowning. No regrets. Attend. £5/4 Aug 11-23 (not 17) 18.30 (19.45) £4.50 (£3.00) FORKBEARD FANTASY OO©© Venue Square6 Aug Theatre, Square.-5pm) Tickets37650- George 2001 (pre 651 George 1332 IOam MI2 ★comic THEcine-theatre FALL OFhitTHEcelebrating HOUSE100OFYears USHERETTES Forkbeard’s 1996 of Cinema.‘ATimemagnificent of‘A inventiveness...ninety minutes of glorious barminess’ Out Critic’sexcess Choice; consummate Aug 20-29 14.30side-splitting (16.00) £7.50treat’(5.50)The Sunday Times.

0131 66 1 2212

FORK TONGUE THEATRE (SHEFFIELD UNIVERSITY THEATRE COMPANY) 00©0 Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 THE FLYING PIG THEATRE COMPANY OLEANNA by David Mamet.A psychological A battle between the sexes,how a comment on■is twisted institution versus individual. play showing conversation suit one’sbreathless. own means or beliefs. It raises and maintains tension leaving17-23 thetoaudience Aug 16.10 (17.40) £5.00 (£4.00) FRESH BLOOD THEATRE OO©© Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 ★areTAPESTRY Weaves several original plays into one. Sex, drugs and clubbing amongst the issues tackled in this innovative collaboration. An international cast presentinclude a stunning montage, with an original dance soundtrack. Mornings breakfast. Aug 18-23 10.30 (12.10) Aug 25-30 17.40 (19.20) £4.00 (£3.50) STEPHEN FROST ©O©© Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 K12 Aug. 18-30 Venue 123 1.55pm Tickets £5.00 \ £4.00 (concessions) Box-Office 0131 5589991 ★in the LEONARDO WAS RIGHT by Roland Topor is a scintilating farce classic Arecriminations weekend in the country, unaccountably lavatory and theFrenchstyle. shit to fly. It’san fast, it’s funny, it’sblocked shitty. Starring8-24Stephen Frostandof£6.50 ‘Whose(£5.50) Line isstart is Anyway?’. Aug 17.15 (18.30) THE FUN FACTORY OO©© Venue 167 - Moray House Theatre, Canongate/St John’s Street Tickets 667 2212 K14 ★ ANYTHING FOR LAUGHS ...followsduring the their relationship and rivalry years between Charlie Chaplin and Stan Laurel early professional working the Englishpersonalities music hallsasandtheireventually Hollywood. onAugtheir18-21,26-30 offstage professional lives. Emphasis is as much 12. 4 5 (13.45) £5.00 (£4.00) Aug 22-25 12.45 (13.45) £5.50 (£4.50) GASP 00©0 Venue 51 - Diverse Attractions Complex, 112 West Bow, Grassmarket Tickets 226 4412 K11 MOTHER COURAGE Single mums! Escape the benefits trap: live off the war! Big profitsandbutcompassion ...the DSSgets doesn’t killGASPyourtreatment. kids. Brecht’s taleandofMisery’ capitalism, conflict the (‘Fear 1995, ‘Our 18-22 Country’s Aug 21.40Good’ (23.20)1996.) £5.00 (£3.00) 86

publicity distribution for fringe companies since 1987 Telephone (0131) 555 1897


ARTS INTERNATIONAL EKCHANGE presents ir TEATR

LUDOWY

Last year they dared to bring MBETH to Scotland THEY TOOK EDINBURGH BY STORM This year they will amaze you with sopbocfes’

A visually stunning production from one of Poland’s most innovative Repertory Theatres. An exceptional and unconventional interpretation of the world famous classic. Breaking language barriers, the play is performed in English, Polish and ancient Greek. George Square Theatre, George Square - Venue 37 8 -18 August, 6.15pm (7.30pm) Tickets £8.50 (£7, groups over 10 - £6) Supported by: The Polish Ministry of Culture and Krakow City Council - The City Where Art is Religion

THCATRC THE GHOST ROAD COMPANY (USA) OO©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6S22 H10 ★Ghost LRGRoad’s LOT darkly GRT VU ‘Large Lot, Great View’. Direct from Los Angeles, it’s funny one-woman tour-de-house, written and performed bysinging, Kimberley Pearce-Haynes. by Pave LaRue,‘the world’s first reorientating psychic’. Special23.10appearance Aug 10,12,15,18,20,22,24,26,29 (00.10) £5.50 (£4.50) ★‘Elektra-LA-LA’ THE LAST VEGAS LOUNGE ACT Ghost Road follows Fringe ‘96 smash (‘Hilarious ...exhilarating!****’Scotsman;‘Funny moving!****’List), with the alate nightpremiere. music-comic antics of ToniandRae and her backbiting backup singers; world Aug 11,14,16,19,21,23,25,28,30 23.10 (00.10) £5.50 (£4.50) GILDED BALLOON ©O0© Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 K12 BEHINDTHE AQUARIUM AT THE LAST PIZZA SHOW Fringe First Winner 1996. Gary meets Graham and they both fall hopelessly in love. touchingproduction love story,thatwarm, funny and tugging’ Scotsman The sort of‘Aquality makes12.30 the(13.55) Fringeheart worthwhile’ Aug 8,10,12,14,16,18,20,22 £6.00 (£5.00) Scotsgay. BEOWULF Bradford Playhousein aTouring Co. bringbytoJonathan life this epic ofof★ heroes, monsters dragons newfrom adaptation Hall.tale A fusion physical theatre andand classic storytelling the company that brought you ‘Nativity’. ‘Wow’ Telegraph and Argus. Aug 9,11,13,15,17,19,21,23 12.30 (13.55) £6.00 (£5.00) ABurgess, CLOCKWORK A play with music. Adaptedtalebyabout Anthony based on ability hisORANGE novella. A the controversial and violent choice: good, evil and the to tell difference. Aug 8-23 15.45 (17.15) £6.50 (£5.50) ROAD RAGE by Andrew A road protest. A wild collection of★ characters. drugs lockLoudon. Classical through modern tragedy. From Sex, Festival hit&‘Ken &on’s. Barb’ team. Ktale& Bweaves Productions havethiscome upAugwith8-30something wildly different again! 17.45 (19.00) £7.00 (£6.00) UNIDENTIFIED HUMAN REMAINS NATURE OF LOVE by Brad Sex,A love, onenew nightplayANDTHETRUE stands, friendship, serial the fearaofculture beingFraser. alone brilliant about relationships inkillers, the15’s.90’s.aids,Set against of promiscuity and violence. Not suitable for under Aug 8-23 13.30 (15.15) £6.50 (£5.50) C’MONpassionate BLACKandA new Kiwi comedy byit’s Roger Hall. Epic in scale, funny, provocative - well, about your average Kiwihimseriously joker Grant Tilly is Dickie Hart, the world’s greatest rugby supporter. Catch if youreally. can. Aug 8-30 12.45 (14.15) £6.00 (£5.00) ★in this SOLDIER ON A MONDAY Gay love becomes an explicit celebration outspoken to thethepeddlers of doom.To cope withfetish. one being HIV positive, two loversrebuke embrace daily sexual ritual of uniform Directed by Lorenzo Mele (two Fringe Firsts directing Starving Artists). Aug 9-30 (not 18,25) 14.30 (15.45) £6.00 (£4.00) CAT ATHEATRE COMPANYimmigrant - DAYLIGHT A newshop tragicomedy by John widow, ROBBERY a Glasgow corner and acceptance. defiance in ‘AtheMaley. faceAntoofAsian discrimination. Memories, relationships andScotsman. a longing for force be reckoned with in Scottish theatre’ The Aug 8-30 18.30 (19.30) £6.00 (£5.00) THEATRE COMPANY PRESENTS MONSTERS Grahamto leave. isLOVE pregnant and worried. Even hisyouimaginary boyfriend is threatening Where’s a good woman when need one ! A tense, imaginative new play from theandwriter of last year’sChristiansen sell-out Fringe hit Stormin’. ‘Bold & intelligent.. Passion8-30 Aug (notenergy’ 18) Rupert 14.30 (16.00) £6.50 (£5.50) ★ AFTEREdler,PENNY meek accountant,‘intoned by Brookside’s Graeme tells hisAcompelling story.twist. Dreams leadmasterfully’ to obsession; Harmless games become stalking;...with a sinister ‘Leaves ‘Crash’ in the slow lane... aAugmodern day spine chiller’ Time Out. 8-30 17.30 (18.30) £6.50 (£5.50) Venue 36 - Gilded Balloon I , People’s Palace, Old Fishmarket Close Tickets 226 2151 <12 ★ PMT THEATRE CO wok PRESENTS I’MteaOKintoYOU’RE OKclassVegetarians Tim and Tish move with their and Herbal a working district and find living next communications. to the Tuffs with their chips and lager. Conflict arises asAugTishthemselves 8-30preaches 13.00 assertive (14.30) £6.00 (£5.00) PRODUCTIONS PRESENTS COW Benreckless Elton’sworld West End hitKCcomedy. An hilarious send-up of 80’sSILLY excess the media.This slick, energetic production comesandtotheEdinburgh after raveof reviews and a sell-out run in Bristol. Aug 8-30 (not 19,24) 15.00 (16.15) £6.00 (£5.00) ★ WEETZIE BATsurfer Weetzie andandDirk‘MyareSecret growing weirdMan’, in LosthisAngeles. With witchfrombabies, ducks, AgentupLover modern fairy tale Lanka Lounge Theatre is an in-your-face, slinkster-cool romp through Aug 8-30pop(notculture. 12,26) 16.30 (17.30) £6.50 (£5.50) GILDED BALLOON continues over the page 87


THCATRC GILDED BALLOON continued ★ BRIGHTON THEATRE EVENTS PRESENT AND TELL BIG TOP Sex, power,hitscorruption, intrigue sleaze... From the- aKISS writer and director of stage ‘FeverofPitch’ and women.‘Sparkling ‘TheandLost Continent’ funny, sharp expose of the ugly business beautiful works of theatre’ The Guardian. Aug 8-30 (not 20,27) 14.15 (15.30) £7.00 (£5.00) ★ STILLbyGAME by and might starringbeFord Kiernan and Greg Hemphill, EXTRAUAGANZA! directed Alan dearewritten Pellette.They in their seventies, butworld Winston, Archie and Victor still game for what’s going on in the big bad outside. Aug 8-30 18.45 (20.00) £6.50 (£5.50) THE MC OF AactSTRIPTEASE ACT GIVE UPhappy. It’s every MC’s nightmare.Your isimprovises, late and you have toDOESN’T He teases, flirts, philosophises, fantasises, butkeepwillthetheaudience stripper turn up?.... AAugbarbed tragicomedy. 8-30 22.45 (23.45) £6.50 (£5.50) ★fluttering LIPPYlikePRESENTS NINE LIVES,TEN TALES a boyfriend a b-moviefromSouthern Belle. Proposes totold a Finds midwife and is thrown inanda fish tank. Stories an East End woman’s life, with searing honesty Augbiting 10-30humour. 14.45 (15.45) £6.00 (£5.00) Venue 139 - The Honeycomb, 36 Blair Street Tickets 226 2151 K12 BRISTOL OLDIS ALSO VIC THEATRE SCHOOL PRESENTS THE CONVERSE TRUE by Hank Schwemmer.A play on words, an exerciseby ainTexan babbleperformed and pretence exploitation of theatrical ambiguity. Written by a and Californian. Poignant and intelligent. Aug 8-30 13.30 (14.30) £5.00 (£3.00) 5 " ★ MANNIX FLYNN IN TALKING TOthrough THE WALL ABorstal man furiously recalls his life, from conception to birth, truancy, and prison, to FOP Mrs his explosive encounter with hilarity the dangerous world of... the Theatre! Mr Flynn’s verbal acrobatics swing from Aug 8-30 16.00 (17.00) £6.00 (£5.00)to horror. GORDONSTOUN YOUTH THEATRE OOO© fBBnt PB/Cf Venue 128 - Youth International at St Oswald’s, Montpelier Park Info/Tix 346 1405 or 229 5562 N6 ★ ■ ASLEEP UNDERplayTHEaboutDARK EARTH Sian Evans. Set inScottish rural Wales in 1830, and faith,ByExuberant labour andphysical love. premiere in Aprilaandpoetic withimages. BT National magic Connections. theatre, rich in language Aug 26-30 15.45 (17.00) £5.00 (£3.00) OfOHt! GRASSMARKET PROJECT (GMP) ©O©© Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 K12 ■returns MADtoJeremy Weller,withwinner of fivethatFringe with the extraordinary GMP, Edinburgh theauthenticity play was theFirstssensation ‘Against thisfirework’ gut-wrenching traditional theatre ofhastheall‘92theFringe. spark ofAug a damp Scotsman, 1992. A DlEflRlNT Bill 9-30 (not 18,26) 14.00 (15.30) £7.00 (£5.00) GRESHAM’S Venue 81 - The GarageYOUTH Theatre, GrindlaTHEATRE y Court Centre, Grindlay St Tickets 228 2215 OOOOK9 ★can■lastSUFFER THE CHILDREN Thefollows scars ofthechildLostabuse labour atime, lifetime. This improvised Boysandonandaforced through exploring issues raisedplayfrom Dickens to Barrie, tojourney child exploitation even now. Aug I 1-15 10.30 (11.50) £5.00 (£2.50) GRID61 -IRON ©O©©J12 Venue The HauntedTHEATRE Vaults, meet outsideCOMPANY The City Chambers, High Street ★‘ New THEadaptation BLOODYof Angela CHAMBER ' I had stumbled into a museum of perversity... Carter’s Bluebeardchambers. tale. Witness lust and murder action, staged dangerous, in Edinburgh’s hauntederotic underground Luscious text, sensual simmering live music. Aug 7-9 22.45 (midnight) £5.00 Aug I I -30 (not Suns) 22.45 (midnight) £9.00 (£6.00) GUANDALINE SAGLIOCCO ©O©© Venue 34 - The Famous Grouse House,5 Chambers St Tickets 220 5606 KI2 ★soloTHE STORY OF THE FALLEN HERO A witty, charming and comical performance, true to the ancient Greek myth of Jason, yet distinctly contemporary.Europe. A highly visualofproduction which has received standing ovations throughout metamorphosis’ Aug 8-30 (not 18,26)‘Master 19.45 (20.45) £8.00 (£6.00)Rein Neckar Zeitung. HANKY PARK PRODUCTIONS OOOO Venue 117 -Viewforth Centre, 104 Gilmore Place Tickets 229 7659 M6 H HANKY PARK Hanky Park is adapted from a play by northern writer Walter Greenwood. Set in Salford during the 1920s it is full of the humour and pathos of those times. Brilliantly directed by David Johnson. A must for any Augtheatre-goer. 11-16 20.15 (21.45) £4.50 (£3.00)

himy MIGHT! FR115, SAT 16, SUN 17 FRI22, SAT 23, SUN 24 The Theatre Big Top Edinburgh Meadows 9.1upm TICKETS £9.5018.50) Fringe Box Office 01312265138 Meadows Box Office 0131667 7367 .jj* www.telegraph.co.uk


HARLAND HAMSTRINGS THEATRE COMPANY oo©o Venue 79 - The Subway, 69 Cowgate K12 BLOOD, SWEAT AND TEARS ‘Good theatre by any standards’ Scotsman ‘96. John Godber Appreciation Society presents this bittersweet comedy drama one ‘well ‘ard’ battle to be the Mirror. best at Judo. Louise fights from Dojo toabout her girl’s Louise!’ AugDisco.‘Smack 10-23 (not Weds) 16.00Mablethorpe (17.45) £4.00 (£3.00) UP ‘N’ UNDER ‘Performance withmeets a sincerity that is truly refreshing’ Scotsman ‘96 John ‘Rocky’ League - But this time it’s a woman’s team.Godber’s What! No! Never! CanRugby the birds wincomedy it for Arthur? Women with balls! Amazing! Aug 10-23 (not Weds) 18.00 (19.45) £4.00 (£3.00) ON THERomance PISTE on‘Muchthe toslopes admire’ Scotsman John(have Godber ski-holiday comedy. - Abba incomedy the ‘96. sauna! wesnowman got a mountain?). No expense spent to bring this hilarious to you.‘The was Wetwang Aug simply 10-23 divine!’ (not Weds) 20.00Evening (21.45)Herald. £4.00 (£3.00) H.D.G. PRODUCTIONS OOO© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 KIO TEECHERS byactors John Godber. Frenetic, energetic, poignant, evocative. Five exuberant present 22 diverse characters in this inspired and insightful Aug 24-30 16.representation 30 (17.45) £5.00of modern (£4.00) school life. HERRICK THEATRE OOOO Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 A‘SAUNDERS SANDWICH’ Award winning Herrick Theatre (Pick of the ‘95) perform ‘After Liverpool’ and ‘ByeTheatre Bye Blues’ byimaginative James Saunders. Atodaysideways look at relationships.‘Herrick bring direction play’ Scotsman, previous Augthe10-16 14.40 (15.40) £4.00production. (£3.50)

HUNDRED HEADS 00©0 Venue 49 - Bedlam Theatre, I lb Bristo Place Tickets 225 9893 LI I * ■scientists E & E MURMUR Edward andJoinEugene Murmur arefor bad scientists. Bad for the next century. them at home this pitch-black comedy, especially written for this year’s Fringe FestivaLYou’d be mad to miss it. No18-23 that’s not(11.30) right. £3.50 Aug 10.30 (£2.50) HUNGARIAN OVERTURES/ INTERNATIONAL THEATRE MERLIN ©o©o Venue aincy Centre, I 1332 BristoI0am-5pm) Square, (near Fringe Club) Tix 650238201- Chapl(pre7Aug65l LI2 ★of the THEunderworld QUEST Intosearch of happiness the lovers fight the dark forces find heaven on earth.vibrantly A 19th century play Zollman. of sublime poetry and(not robust humour by Vorosmarty, adaptedverse by Peter Aug Aug 9-20 21-23 20.30Tues) (21.40)19.30 (20.40) £7.00 (£5.00) KI2 Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 ★ THE TRAGEDY OF MAN by Imre Madach.classic. Ian McLeod’s critically acclaimed translation of the timeless Hungarian Directed by double fringe-first winner John Carnegie, whose previous won the 1996 Martini9-23Award most20.30 outstanding regionalproduction theatre production. Aug (notforSuns) (22.00) British £8.00 (£6.00) Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 K5 ★ WOUNDED WOMEN Virtuoso flesh dark and blood theatre by international director Laszlo Magacs. From Jaros Arany’s ballads, these are tragic stories ofBelaill-fated women, hauntedtranslation by curse, conscience and calamity. Stunning music by and evocative by Peter Zollman. Aug Farago 11-16 17. 4 5 (19.15) £7.00 (£5.00) HOURGLASS PRODUCTIONS OO©© Aug 18-23 19.40 (21.10) Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 GET they A LIFE Whentotwo forty-something women fallandpregnant at the same time, combine face reality, pain, joy, betrayal finally empathy as each discovers worth, mutual respect and they both understand their pressing need 17-30 to getselfa20.50 life. (22.05) Aug £5.00 (£4.00)

Starring SARAH DAVISON One woman’s obsession with the Carpenters “KITSCH WITH KNOBS ON” TIME OUT 8 - 30 August at 4.25pm (excluding 11,18 & 26) ASSEMBLY ROOMS 0131 226 2428

% SPL.ENP2D mPRo BXT-RAVAGANZA" TSMB OUT "EXCEPTIONAL COMEDY''THE SCOTSMAN g4k_3o* AUGUST AT 6.00 PM ASSEMBLY ROOMS 0131 226 2428


afterthoucjht presents in repertory at MARCO'S at 8pm one woman's theatre

ILLYRIA OOO© Venue 49 - Bedlam Theatre, I lb Bristo Place Tickets 225 9093 LI I THE TEMPEST “*****’ The- Scotsman (Macbeth 1996).‘Irreverent, astonishing, clever, funny, moving, cheeky Illyria is all these things’ Herald Express (Much Ado 1996). Following last year’s sellout ‘Macbeth’, nationally acclaimed Illyria present aAug highly25-30 original18.10production of Shakespeare’s (19.50) £6.00 (£4.00) last play. imago ®Q©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 HIO ★Experience DESPERATE LINES What sort of people use telephone dating? obsession and isolation as two guys make contact. A first play, based on a 17.10(18.10) novel premise, by Peter Aug (£4.00)Steadman. Aug 9-16 18-30 (not 26) 15.40£6.00(16.40) IN MEDIAS RES THEATRE COMPANY ©O©© Venue 19 - C, Over-Seas House, 100 Princes Street Tickets 225 5105 110 AandVIEW FROM THE BRIDGE Arthur Miller’s classic tale of passion, jealousy betrayal in the Italian community of I950’s New York. A powerfully intense story of self-discovery and family loyalty set against the backdrop of the American Aug 6-30 Dream. (not 17) 15.25 (16.45) £5.00 (£4.00) IN YOUR SPACE PRODUCTIONS OO©© Venue 45 - Old St Paul’s Church & Hall,Jeffrey Street. Tickets 556 0476 JI3 ACCIDENTAL DEATH OF AN ANARCHIST 1996 five star Scotsman review‘Flawlessly entertaining’. 1997 NSDF Sunday Times Playwriting Award. Now Fo’s political comedy newly updated.through Set amidthethemiregeneral election, aAug thought I 1-30provoking (not Suns)and 14.slapstick 05 (15.45)romp£6.00 (£4.00) of police corruption. JACKNIFE OO©© Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I ★exertPLAYING THE GAME A new spectator sport! WATCH as men try to their authority over their partners; LAUGH as the women take control; WORRY as we realise the future of mankind relies on fools like these. By Mark Townsend. Aug 11-30 (not Suns) 13.35 (14.45) £4.50 (£3.50) JAPAN EXPERIENCE OOO© Venue 55 - Randolph Studio, Inst Francais d’Ecosse, 13 Randolph Cres. Tix 225 5366 H8 ■Nothing’. THEATRICAL COMPANY, GUMBO in Can’t Say Anything About Man/Woman/male/female. Sex is what it’s all about. Everything stems from this.This -isground the truthzero.in Hilarious! a fiction that started as non-deception with starting Aug 24-30point17.00 (17.50) £5.00 (£4.00) JUDY WITH LOVE OO©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 HIO ★ GARLAND A twister and of a myths. life. Sublime andandsedated. Momentous talent, drugs, debts, manipulators Dorothy ruby slippers that couldn’t take herwriter/performer home.The yellow brick road ends, London, overdose, 1969. By award winning Aug 10-30 (not 17) 20.10Gerry (21.25)Gowans. £6.00 (£4.00)

philippa hammond performs pagan philosopher whore genteel pornographer pulp dame, private lover leather-clad walked-over walk-on

writer/director thomas everchild 90

KASSIOPIATHEATRE COMPANY OQ©0 Venue 11 - Diverse Attractions, Riddles Court, off Lawnmarket Tickets 225 8961 j 11 LOVERS Brian and Friel:discuss On a hillside in Ballymore in Ireland a youngHowever, couple study for their exams impending marriage and parenthood. their future hopesafternoon. and expectations are overshadowed by the tragic fate that awaits them that Aug 11-16 17.45(19.15) Aug 18-23 21.45 (23.15) £5.00 (£4.00) KCS THEATRE COMPANY OOO© Venue 126 - C cubed, St John's Hall, West End Princes Street Tickets 225 5105 19 ★TheINSIDE THE ISLAND by Louis Nowra, Australia’s foremost playwright. haunted lonely world of a remote farming society is transformed into an apocalyptic battlefield by‘Holy Fire’ - apremiere. madness from poisoned wheat. A play of terrifying Aug 24-30 theatrical 14.45 (17.00)imagery. £5.00British (£4.00) KEYHOLE THEATRE COMPANY OOO® Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 2257226 KIO ★ SKRIMSHANKER Novworld1915forever and while AlfredtheHargreaves returning from the trenches finds his old changed, neighbours greet the soldiers - but a Skrimshanker is not a hero. Paul Burn’s play returning examines the (15.50) issueasofheroes desertion. Aug 24-30 14.20 £5.50 (£4.00)


"Relentless narcissism"" K.486 (DO©© Venue 126 - C cubed, St John’s Hall, West End Princes Street Tickets 225 5105 19 ■unusual THE about TRIALJoseph by Franz Kafka,he’sadapted by forSteven Berkoff.There’s nothing K. Until arrested doing nothing wrong. His trial begins... Manchester- ‘ anrununmissable comes acrobatics, and madness.From Dark,K.486’s broodingsell-out and seductive dramaticmime experience’ Mancunian. Aug 6-30 (not 9,28) 21.00 (22.15) £5.50 (£4.50) Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★ LIFE’Sinto A GATECRASH A hit and run incident throws Stevetheirandcracked Nicola headlong a world of emotional turmoil.The event exposes relationship1997 and rips apart theStudent seemingPlaywrighting normality ofCompetition. their suburban lives. Winner Manchester Aug 6-30of(not 14,28) 00.30 (01.20) £4.50 (£3.50)(inc. free whiskey) BOB KINGDOM ©O©© Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 ★andELSA EDGAR ‘50’s Manhattan the terrifying Elsa Maxwell, party hostess social power-broker, drags up for her next masquerade as J Edgar Hoover checks his files, astonishing tightens his double grip andactslipson into something Bob Kingdom’s scandal, blacklistsmore and comfortable. paranoia. Preview Aug 8 11.00(12.30) £5.00 Aug 00 (12.30) Aug 9-14,17-21,25-30 15,16,22-24 11.00 11.(12.30) £8.50 £7.50 (£7.50)(£6.50) KISMET THEATRE COMPANY OOO© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 K10 LOW LEVEL PANICwith Hilariously thought provoking, this award winning play crosses Greek tragedy ‘Girls on Top’. Pulling no punches ‘sometimes I just come home and masturbate’ - our three heroines look humorously at the repercussions Aug 24-30 16.of55male (18.10)inflicted £5.00violence. (£4.00) THE LABORATORY ©O©© Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 L13 Hang the expense all the apparatus given for FREE allowing companies to experiment on the Fringe’s new fringe. Protection goggles definitely required... ★ MYstory SISTER THIS ofHOUSE Wendy -Kessleman.The true (FranceIN1930s) forbiddenby passion leading inevitablycontroversial to a shocking climax. Aug 9-21 (not 17) 11.30 (13.40) £4.50 (£3.50) TWO by Jim portrayal Cartwright.of Northern Norfolk andPubGrant A funny, and poignant Life, Theatre with twoCompany. actors playing all sharp fourteen Aug 11-24characters. (not 17,23) 14.00 (15.15) £5.00 (£4.00) CLARA byofArthur Miller. Norfolkmurder. and Grant at its best. A father confronts the Augreality 11-24 (nothis daughter’s 17,23) 15.2brutal 5 (16.40) £5.00 (£4.00) ■withAWAY FAERIES A modern fairytale, visually stunning music,Wl’THE danceCENTRE & amazing by the SOUTHSIDE COMMUNITY group.costumes, Brilliantputshowtogether for all ages. Aug 8-16 17.00(18.00) £3.50 (£2.50) ECLIPSE World poet Simonunder Armitage twists mystery and magic in★ this gripping17.00 tale(18.15) ofClass self £5.00 discovery Aug 18-25 (£4.50) a darkening sky. ★ ADOLF is Adolf Hitler indarkest this chilling portrayal of the man who became(notPipthe28)Utton Twentieth Century’s Aug 8-30 18.30 (19.20) £5.00 (£4.00)evil genius. ★Dallas... JFK OD’D byhours Stevenbefore Nemeth. Eighteen minutes before the shot rang out in Marilyn Monroe’s Aug 9-39Eighteen (not 17,26) 15.30 (16.20) £5.00 (£4.50)superstar suicide... JFK OD’d. BRITANNIA Satirical political frolic about the referendum on★ GAGGING Europe. See Phoney Aug 8-17 16.00 (17.45)Tony, £5.00Closet (£4.50)Major, Paddy Two Shoes slog it out! Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★ THE DISMISSAL routines deadly monotony John NowOffice John’s being down-sized. Can hehasholdwound on to sanity? Aug Stanthorne 24-30 13.40up.(14.30) £5.00 (£4.50) THE LABORATORY continues over the page 0131 556 6550 http://www.telegraph.co.uk 91


THCATRC THE LABORATORY continued Venue 16 - Southside Courtyard, Davie St.Tickets 667 2212 LI3 FEMALE PARTS Blonde and Brunette Strike Back. Devised serio/comedy. Aug 18-20 14.45 (15.20) £4.50 (£4.00) GLEN GARRY GLEN ROSS Youbattle won’tinhear dialogue on the‘youFestival’s stages as(Darkwater these real Productions) estate salesmen the better harsh world where you (£4.00) sell’. Aug 21-23 15.00 are (15.50)what£4.50 HARD piece. POSITIONS (Poker & Jargon) All male company with a serio/comedy devised Aug 18-20 15.25 (15.50) £4.50 (£4.00) MADE IN SPAIN /TONY GROUNDS (Hairy Fairy Theatre Co.) AllAug girl18-20 comedy 14.10play(14.40) £4.50 (£4.00) I MAN 4ofMONOLOGUES (JohnandRamsbottom) Tribute to Stephen Berkoff with twoWomb his& monologues, Actor Xmas, and two new works, Green by JohnHarry’s Ramsbottom. Aug 21-23 14.0Train 0 (14.55)of Thought £4.50 (£4.00) LA FOLIATEATRO (SPAIN) OO©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 H10 ★different MARIDOS Y HUJERES (HUSBANDS & WIVES) Composed of three plays by different authors and several ages of the theatre’s history. Allsee have commonthatthewillrelationships as ina combat never(£4.50) stop.between men and women.‘La Folia’ Augit18-27 14.00 (15.25) £6.00 LAWNMOWERS 00©0 Venue 197 - Leith Community Education Centre, Newkirkgate D18 ★extravaganza. THE RIGHT WRONG The Lawnmowers bring you their latest A group of learning disabled people set off to change parliament. They end up on the wrong side of the law and this results in a riotous courtroom Aug 19-22 drama. 13.00 Aug 21-23 19.00 (14.00) (20.00) £4.00 (£2.00) LAWRENCE LEYTONS MINDF*** ©O©© Venue 189 - The Meadows Big Top,The Meadows, Melvil e Drive Tickets 667 7367 NI2 ■ LAWRENCE LEYTON’S -your MINDF*** Enter a your surrealperceptions atmosphere with awesome visuals. Shake up reality, play with and into the 90%mind-expanding of your brain’s experience. capacity that you don’t normally use for antrip unforgettable Aug 8-30 21.30 (22.30) £9.00 (£7.00) Aug 16,17,23,24 19.15 (20.15) LEAVENERS THEATRE COMPANY OO©© Venue 40 - The Quaker Meeting House, 7 Victoria Terrace. Tickets 220 6109 J11 ★a Gulliver’s ONLY JUST ONLY JUST...hanging on...keeping up...taking action travels panorama of contemporary Britain from treasury mandarins toeffervescent estate vandals. High-octane issue-based music moving, theatre with catchy songs, danceSuns) and sharp Aug I 1-30 (not 15.00 satirical (17.00) comment: £5.00 (£4.00) witty and inspiring. LEICESTERSHIRE YOUTH ARTS 00©0 Venue 65 - St Ann’s Community Centre, South Gray’s Close, Cowgate. Tickets 557 0469 from 6 August KI3 ROMEO ANDtimeless JULIETstory‘A ofpairlove, of star crossed lovers takePresented their life.by. 1. Shakespeare’s conflict and tragedy. The Theatrea record Company (formerly Schools Theatre following breaking tour(£3.50) ofLeicestershire schools throughout Britain. Company), Aug 11-16 14.00 (15.00) £4.50 TEECHERS Godber.A hilarious School asandseenpacyby comedy the peoplefromwhotheprobably know itofbestBouncers, - BytheJohn students! renownedauthor Up ‘n’ Under and Shakers. Loud, fast moving, irreverent and highly entertaining. Aug 11-23 (not 17) 16.00(17.00) £4.50 (£3.50) THE KILLING SISTER GEORGE Frank Marcus.character Fading actress June Buckridge’s careeroffOFstarts to crumble whenit Byher George to boost ratings. And seemssoapheropera turbulent privateSister life isAugaboutI 1-23istokilled follow... (not 17) 18.00 (19.00) £4.50 (£3.50) LEITH EATRE ©0©0 Venue 83 - St Serf’s Church Hall, Clark Road, Goldenacre Al2 KEEP IN A COOL PLACE by William Templeton is a Scots Comedy about aandHighland Chieftain, MacLeod, and his four sons who all marry ‘foreigners’ father.(22.00) A battle£5.00of wits Augsend 9-23them (not home Suns) to19.30 (£4.00)ensues with hilarious results. 92

From New Zealand...

Directed by Lisa Warrington Featuring Anna Cameron, Sarah McDougoll, Jessica Sutherland Aug 8th - 24th Aug 24th - 30th 8:55 to 10:15pm 7:40 to 9pm /no performance 28th Venue Number 21 / The Roman Eagle Lodge / 2 Johnston Terrace Ticket price £5.00 & £4.00 Concessions / Baby Friendly Show Aug 26th Booking: Fringe Box Office & Venue Box Office / Telephone 225 7226 Tfee (jsu/s Aug 24th - 30th/10:25 to 11:15pm 28.H


LEITH GALLERY PRODUCTIONS oo©o Venue 179 - The Leith Gallery, 65 The Shore BI9 GLASGOW GIRL KaraMacNicol Wilson, (1869-1904). actress and painter, re-creates thepaints life ofa★portrait Glasgow painter Bessie Kara talks, sings and in the Leith Aug 11-23nightly (not 17)(as Bessie) 19.00 (20.15) £5.00 Gallery. (£3.50) LES ENFANTSTERRIBLES ©0©0 Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 KI2 ★about TALES FROM A TRAVELLER On his 500th birthday a man has to decide living or dying; a question raised by the author’s own AIDS. Dutch press: ‘unrivalled harmony of gravity, humor, despair and joy...warm and inviting performance’. Aug 9-18 17.15(18.20) £7.00 (£5.00) LESVAGUES FRANCAISES ®0©@ Venue 126 - C cubed, St John’s Hall, West End Princes Street Tickets 225 5105 19 ★innovative ■ LA CANTATRICE CHAUVE from Glasgow University. A decidedly interpretation of Ionesco’s modern classic dance, music, mime a large smattering of weird, behaviour. From tango aerobicorroutines toand seductive firemen with detourssurreal through a passionate two c’est absurde! Aug 6-30 (notIn17)French. 13.30 (14.35) £5.00 (£4.00) LIMB (DO©© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 K10 ★ WEEPIE bysaintliness Chris Goode. Sometimes trueplaying storiesa dangerous are the tallest. Murder and mysticism, and sex, two boys game. Bitingly funny, achingly sad, this is the story you’ll remember when the rest of the Fringe has faded. Aug 8,10,12,14,16,18,20,22,24,26,28,30 18.20 (19.55) £5.00 (£4.00) ★Keener PUCKERLIPS bya Chris Goode.Pretty Promotion at work, loverto end. at home: Still’s makingwork:‘Genius’ fresh start. lousy time for theaThenew world Goode’s previous The Scotsman;‘Visionary’ List;‘Very oddChris indeed’9,11,13,15,17,19,21,23,25,27,29 The Times. Aug 18.30 (19.50) £5.00 (£4.00) LOADED THEATRE COMPANY OOQO Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I ★ WARDROBE MAN Try sharinganda ‘mouse’. flat with It’s‘MrbadMultimedia’ -health with hisliving ‘mobile’, his ‘modem’, his ‘monitor’ for your in‘a rare this house! to the Fringe for a company The Scotsman deemed treat’.(notA return Aug I 1-23 17) 17.00 (17.40) £4.00 (£3.00) LOOKING GLASS PRODUCTIONS ©0©0 Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 ★penetrating ■ THE RAPE OF LUCRECE Dazzling display of the female psyche; the ‘wild zone’ to the frightening core of woman’s multiple personalities.This erotic, forceful play uses Shakespeare’s femalehercharacters; exploring quest£5.50 for answers and her need to escape prison. Aug 8-23 women’s 18.20 (19.10) LUCID PRODUCTIONS OOO© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★TheREADY OR NOT Barry only came home to Ireland to marry Eileen. happiest- a day of hisnewlifeone-man - what could go wrong? Vigorous,Street funny,storyliner wry, unsettling stirring play from Coronation Jim AugO’Hanlon. 24-30 13.00 (14.05) £5.00 (£4.00) THE MAKARS AND DMDC 00©0 Venue 104 - Murrayfield Parish Church Hall,OrmidaleTerrace. HI Outer SHE STOOPS TO CONQUER Oliver Goldsmith, whoromance studiedis medicine in Edinburgh, wrote this classic 18th century comedy.This distinguished by hearty Aug I 1-23good19.30humour, (21.45)likeable £5.00 characters and an exuberant sense of fun. MANCHESTER METROPOLITAN DRAMA SOCIETY OOO© Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 FIND ME Based on Verity Taylor, who suffers from a behavioural disorder, ‘Find Me’ by O Wymark is touching and tragic. As her family falls apart she is plunged for her needs. Aug 24-30into15.1a5world (16.15)unsuitable £4.00 (£2.50) THE MARSH 00©0 Venue 55 - Randolph Studio, Inst Francais d’Ecosse, 13 Randolph Cres. Tix 225 5366 H8 ★funny, UNCLE BOB written by and starring Austin Pendleton. The ferociously articulate Bob had planned to face his mortality alone, but the unexpected arrivalNewofYorkhis Times. unstable nephew ruins all that, in this ‘powerful, risk-taking Aug 10-16 play’ 16.0018)(17.35)16.10(17.45) £5.00 (£4.00) Aug 17-23 (not

For the first time ever the Film Festival is its films. We’re showing an overwhelming 350 films. But don’t worry because we’re choosing six a day that we think you’ll like. And it doesn't cost much to experiment. Your Starter For 10 card gets you into 3 films for only £10. They’re on sale at the Film Festival Box Office at the Filmhouse. The Guardian

Your Starter For 10. A GREAT WAY TO GET INTO THE FILM FESTIVAL.


THCATRC

GtlDIO 8AUOON IN ASSOCIATION WITH CHANNU FOUR TCUVlStON PRtSSNTS. THE STAND-UP COMEDY COMPETITION FOR NEWCOMERS

MASTER ROSENCRANTZ’S LITTLE EYASES OO©© Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 KI3 ★ ■ THEearly TEMPEST (A STORM play IN AasTEACUP) Anby usexuberant and youthful, draft of Shakespeare’s performed in 1608. Filched from Globe Theatre byscrawl. a disaffected actor, this version is handwritten in Will’sthe Aug 11-30own(notidiosyncratic Suns) 10.50(12.00) £4.00 (£3.00) MATHIS SCHRADER OO©© Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I REPORT FOR AN ACADEMY Human freedom...what a mockery of sacred nature! Kafka’s ‘ape’, rescued from his natural environment, escapes by plunging ontooftheenergy’ offensive - in variety. actorin from the former GDR‘presents a show full AugAn(22.50) 22,29 German. Aug 18-30 (notTagesspiegel. 24,28) 22.10 £5.00 (£3.00) MEGALOMANIA ©0©0 Venue 167 - Moray House Theatre, Canongate/St John’s Street Tickets 6672212 KI4 ■performs THE TAMING OF THE SHREW The London Circle Repertory Company Shakespeare’s comedylaughs as performed by ayoutroupe Delllast Arte players.The begin before enteroftheCommedia theatre and into the night. play and the 20.50 Aug 8,10,12,14,16,18,20,22 (23.20) £8.00 (£6.00) ■Shakespeare’s AS YOU LIKE IT The Londoncomedy. Circle Repertory Company returnsfairywithtale the world ofleadanlove adult where ‘ All thepastoral world’s romantic a stage’ and noblesEnter and shepherds a merry Aug 9,1 1, 13,15,17,19,21,23 20.50 (23.20) £8.00 (£6.00) MENAGERIE THEATRE COMPANY OO©© Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 LI 3 Adirect LIFEfromIN THE THEATRE David Mamet’s classic. Professional production European tour introducing Theatrical clashes between the seasonedHollywood pro and theactoreagerRobert noviceLehrer. occur with hilarious glorious Aug 17-30regularity.‘A 17.00 (18.30) £6.50comedy...pure (£5.50) theatre’ NY Times. MIRADOR PRODUCTIONS OO©© Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 ★ ■ HAVE YOUtension; SEENdomestic MY PUSSY? by missing Ronnie moggy; Grant. New dark comedy,and laced with sexual violence; gambling-granny Tio Pepe - bound together with passages of disturbing psychological power-play and humour.‘...Refreshing, terrifying masterful’ Theatre Magazine. Augpiercing 11-30 (not Suns) 22.45 (23.55) £6.00and (£4.00) MODERNISING THEATRE COMPANY OOO© Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 ★Onemindexpandinarsekissinbeerswillindrugtakinlovemakinhagshagginswashbuckli ■ CHAUCER IN THE SKY WITH DIAMONDS ncherrypickinfingerlickinsidesplittinvotewinninhellofarollacoasterrideofaplay..... and donkey.21.00 (22.30) £5.50 (£4.00) Auga25-30 MOLIERE FOR LUNCH OOO© Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 LI 3 ■production MOLIERE’S L’AVARE (THE MISER) Highly visual, extravagant period of a universally recognised classical masterpiece farce and satire combine in oneby ofinternational the most delirious comedies everpantomime written. Original-language performance cast, including masked (English24-30synopsis Aug 16.20available). (18.45) £5.00 (£4.50) HELP & INFORMATION RING FRINGE(June ON 0131-226 Open THE 10am-6pm Et July) 5257 or 5259 and 10am-7pm (during August)

94

pHyoUth/nk,yourepllnny/ iEATS 10,11,12,17,18,19,20 august 10:15PM BACKSTAGE THEATRE FiNAt SUNDAY 24 AUGUST 8:45PM MAIN THEATRE APPLICATION FORMS233FROM: THE GUDED BAUOON COWGAIE EDINBURGH EH IIX2

**raucous A winningcomedy formulaandof raw, often "The in-place forthe thelist live bands in a hip, sociable aatting. If you comedy "The bastcrowd" late night haven’t been yet, check It out’* THE hang-out” THE SCOTSMAN INDEPENDENT GIL.DEEO BALLOON MAIN THEATRE 11 PM-4AM EVERY NIGHT -8-30 AUG (NOT 32 AUG)

[slAOMtMiMlS

HOSTED

MONDAY 25 AUGUST 7:30PM QUEENS HALL FEATURING ALL PREVIOUS WINNERS: 1988 BRUCE MORTON 1989 PHIL KAY 1990 TRIO BROTHERS TROUPE 1991 ALAN FRANCIS 1992 RHONA CAMERON 1993 DYLAN MORAN 1994 MARTIN TRENAMAN 1995 LEE MACK 1996 TOMMY TIERNAN + THIS YEAR'S WINNER GILDED BALLOON BOX OFFICE: 0131 226 2151


!

j

1 1

MPS - GUY MASTERSON PRODUCTIONS ®0@© Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 ★ BYE Winner BYE BLACKBIRD Guy Masterson directs 1996 StageFrom Award Best Actress BETH FITZGERALD in Willard Sims’ (Wright America) moving portrait first flapper, Zelda Sayre, F Scott Fitzgerald’s wife. ‘Fitzgerald revealsofathesexuality of55epic proportions’ Scotsman. Aug 9-14,17,19-21,25-30 12. (14.10) £7.50 (£6.50) Aug 15,16,22-24 12.55 (14.10) £8.50 (£7.50) PLAYING BURTON BURTONdeliriously RETURNS! Guy Daily Mastersonportrait directs ofMark Jenkins’ ‘haunting, mesmerising, literate’ actor Richard Burton. JOSH RICHARDS’ ‘shattering’ portrayalMail of the icon, hellraiser and genius is ‘one not to be missed!’ BBC Radio. Aug 8-14,17-19,21,25-30 14.00 (15.30) £7.50 (£6.50) Aug 15,16,22-24 14.00 (15.30) £8.50 (£7.50) ★ THE BALLAD OF JIMMY COSTELLO NZ IMPORT PREMIERE! ‘Glorious, extraordinarily funny’ Hero. Wellington Evening true story of wild Kiwi prison escapee turned National NZ star TIMPost BALME‘enormous charm...hilarious...moving...A roaring success, firing on all cylinders!!’ NZ Dominion. Aug 8-14,17,18,20,21,25-30 12.00 (13.30) £7.50 (£6.50) Aug 15,16,22-24 12.00(13.30) £8.50 (£7.50) NATIONAL STUDENT THEATRE COMPANY ©O©© Venue 16 - Southside Courtyard, Davie St.Tickets 667 2212 LI3 ■Brotherhood NOBODYputHERE BUTtheir US master CHICKENS bymore Peterchicken Barnes.The Chicken together plan. No McNuggets. No more Mrstaged’The Nice Rooster.This time it’s clucking personal! A NSDF triumph. ‘Ingeniously Sunday 17.10 Times. Aug (£3.00) Aug 9-25 9-30 (not (not Mons Mons oror 17) 17) 21.55 (17.40) (22.25) £4.00 £4.00 (£3.00) Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★ SEX ANDandDEATH ‘Achingly funny1997andNSDF wincingly black...frantic farce...energy agility’SundoyT/mes. triumph, winninglager Sunday Times Playwriting, PMA and acting awards. Euro ‘96, Oscar Wilde, lager, four housemates, a gun, corpses and a copper. Aug 6-23 (not 17) 14.05 (15.45) £6.00 (£4.00) NATIONAL YOUTH THEATRE OF GREAT BRITAIN ®o©o Venue Square6 Aug Theatre, Square.-5pm) Tickets37650- George 2001 (pre 651 George 1332 10am M12 THEY SHOOT HORSES, DON’T THEY? The compelling musical story of‘dance razzmatazz and fame which lured the unemployed to endure the painful marathons’ of America’s depression viewing’ The Times,' A triumph for the NYT What’s Onyears.‘Compulsive (NYT is also at the Pleasance). Aug 8 15.00 (17.00) £5.00 Aug 9-17 15.00 (17.00) £8.00 (£6.00) NEGATIVE EQUITY THEATRE COMPANY ®0©0 Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 ★andKILLING LARRY This moving piece of theatre uses dance, music poetry toprejudice explore the for one’s trueweself.seeBattling gender andsearch social conditioning Larry’sagainst struggleaccepted toAugbe9-23 theroles, woman she really (not Suns) 15.15 is.(16.15) £5.00 (£3.50) THE NEW BUCKENHAM PLAYERS OOOO Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 DANCING ATofLUGHNASA Set intheyDonegal intowered 1936, thisovercrackles with the poetry life. On Broadway said it everything. This said it should go to a festival:‘it would win everything’. Hereproduction’s is. 15.30 press Aug Iit1-16 (17.30) £5.00 (£3.50)

THCATRC

I!

NEWBURY YOUTH THEATRE OOOO Venue 40 - The Quaker Meeting House, 7 Victoria Terrace. Tickets 220 6109 J11 HEROIN LIES Heroin Lies is agirl; sensitive, disturbing looktroublemaker at drugs andordrug dependency.Vicky is an ordinary no secret smoker, truant, and that’s what makes her storyNWN. so frightening! ‘A hard hitting, powerful and Lynn Wilkinson, Augmoving 11-16 play’ 12.15(13.30) £4.50 (£3.50) THE NEW LIGHT BULB THEATRE COMPANY 00©0 Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★ CRITICAL CONDITION Howall does itSometimes feel to be judged, watched, evaluated, assessed? These days we know. you don’t want to put upNickWarburton. with it anymore, do you? A new comedy with music by award-winning writer Aug 11-23 (not 17) 13.00 (14.00) £5.00 (£4.00) NO GREY SUITS OOQO Venue 51 - Diverse Attractions Complex, 112 West Bow, Grassmarket Tickets 226 4412 KM MEASURE FOR MEASURE Comedy? No... Sexual tension, pimps and whores, public- ‘Back executions, violent rape. A biting satirehypocrisy, on political Nineties Britain Basics’? No... Institutionalised sex life. scandals, parliamentary A tobiting on Shakespeare’s Measure for Measure. Aug 18-23 19.sleaze. 45 (21.20) £5.00satire (£4.00) NORTHWEST LEICESTERSHIRE YOUTH THEATRE OOOO Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 OUR COUNTRY’S GOOD Australia 1789. A young lieutenant directs rehearsals of a play with a cast of convicts, and a leading lady about to be hung. The a rough£4.50 power - combine poetry and passion - a must! Aug young I 1-16 cast15.0find 0 (16.30) (£3.50) NOTTINGHAM PLAYHOUSE ROUNDABOUT TIE oo©@ Venue 2 - Fringe Club.Teviot Row, Bristo Sq. Tickets 226 5138 LI I FORBIDDEN FRUIT Fast, upfront play for 12 years plus, with songs, music and dance by Roundabout TIE, resident professional company of Nottingham Playhouse. About youngthepeople - especially,challenges.‘Grabs young women - andtherave cultureTES. and ‘dance’ drugs. Explores audience’, Aug 0 (15.00)issues, £5.00informs, (£2.50) Aug 23,26-29 23,24,26-2914.018.00(19.00) NOTTINGHAMSHIRE EDUCATION THEATRE OOO© COMPANY Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 ‘Distinguished andfreshseasoned Nottinghamshire Education Theatre Company’ Scotsman return, from international success. Featured on South Bank Show’s Festivalquality, documentary in 94, Fringe First Award and Cavalcade winners 91and-95.pace’High TES ‘94. entertaining theatre ‘presented with remarkable verve ROMAN SCANDALS High energy Shakespeare,combined fresh andtoexciting.Two great plays,‘Julius Caesar’ andintrigue ‘Anthony and Cleopatra’, create an incisive portrayal of political and dangerous passions.This young company continues build (19.30) on its outstanding Aug 25-30to 17.30 £5.00 (£4.00)reputation.

GltoAf Road prCACMtA at Hill Street Theatre (Studio) 19 Hill Street Venue 41 Box office 0131.226.6522 @ llMOpm from tltc area tora of "EleUtra-La-La” ★ ★★★ the /Scotsman ★★★★ tltc liAt fringe '96 95


M

THEATRE

NOTTINGHAM UNIVERSITY NEWTHEATRE 00©0 COMPANY Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I MAD FOREST Caryl Churchill’s magicalevents yet brutally real play explores the reactions of two families to the confused of the Romanian Revolution, and the terrible damage done to people’s lives by the years of repression undershows Ceausescu. Aug 11-23 (not 17) 23.10 (00.40) £4.50 (£3.50) 104 THEATRE COMPANY 00©0 Venue 49 - Bedlam Theatre, I lb Bristo Place Tickets 225 9893 LI I ★return WE ARE HERE...ARE YOU THERE? Fringe First Winners 1996, with more spell-binding, visual theatre, including three dimensional effects. Archeologists trappedbanging within an elevator, a man imprisoned inside aAugtelevision and aSuns) caveman 11-23 (not 14.30 (15.30)rocks, £6.00search (£3.50)for answers to everything. OPTIMISM ©O©© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 OLEANNA David Mamet’s award winning and controversial play. Enter the arena ofand sexualstudent politics,escalates where asthetheir claustrophobic powerleadstruggle between teacher conflicting truths to devastating results.6-30Racy18.30 and (20.00) tantalisingly Aug £5.00ambiguous. (£4.00) Talented young company’The Scotsman. ★ VALIUM On two stifling Sunday afternoons, shadowy fingers ofoppressed milleniumemotions fever tearinto fourthecharacters from theirthecomplacency, anddown, drag spotlight. Relationships are strippeddone. hypocrisy laid open: the unthinkable said, and the inconceivable Aug 6-30 (not 17) 11.30 (12.45) £4.00 (£3.00) THE ORIGINAL EDINBURGH LITERARY PUB TOUR ®o@© Venue 178 - Outside the Beehive Inn, Grassmarket Tickets 554 0777 KI0 THE ORIGINAL EDINBURGH LITERARY PUB TOUR JoinofusScottish for a■Literary unique dram fuelled theatrical experience. Walk through 300 years full ofright fun,upfacttoandpresent fiction, combined with the language of Burns, Scott4-30 andhistory, Stevenson Aug 18.00 (22.30) (20.00) £6.00 (£5.00) day. Aug 4-30 20.30 OUTHOUSE PRODUCTIONS ©O©© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ADULT CHILD / DEAD CHILD by Claire Dowie.An emotional rollercoaster ride through the sometimes lonely, often funny inner world of an unloved child.This moving and disturbing drama ‘makes you laugh asAug it kicks you in thetender, teeth’ 6-30 (notThurs) 23.30Guardian. (00.50) £5.00 (£4.00) (Price includes vodka) OUT OF JOINT/ ROYAL COURT THEATRE ®0©© Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 111 SHOPPING AND F***ING Following two sell-out runs at the Royal Court Theatre, DIRECT THE WEST END.aMark Ravenhill’s blackly humorousandmoral fable FROM hitsandEdinburgh prior worldTimes.‘A tour.‘Barbarous, compassionate, shocking callously witty’toSunday southern Trainspotting with more sex’ The Times. Aug Aug 9-11,13,14,17-21,25,27-30 15,16,22-24 19.30 (21.25) £ 19.11.0030 (21.25) (£ 10.00)£ 10.00 (£9.00) OXFORD BROOKES STUDENT UNION DRAMA Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212®o©© M12 ★ WHOclassics IS REGINALD LUMMY From the Chatterley’s author who Liver’ broughtandyou‘Muchsuch literary as ‘Great Expectorations’,‘Lady Ado about awakening Knitting’. A moving story of murder, obsession, revenge, betrayal and semi-professional Augsexual 6-16 20.40 (22.10)and£5.00 (£3.50) quilt-making. AN GARYhalfLINEKER What a fixture! a game ofmatch, twoEVENING halves,a nice andWITH Bil ’s out! other be praying cards,But,anit’sabandoned and meal Terrificwillstuff! Over toforyouredDes.... Aug 17-30 (not 21,28) 20.40(22.10) £5.00 (£3.50) CANT FIND THE SHOW YOU’RE LOOKING FOR? See page one 96

Marcos NEWSREVUE “Slick and assured...satirically brilliant” The Guardian GLIMPSE New writing - new actress - four plays THE FAR CANALS in A CANAL RUNS THROUGH IT Slick, witty revue. “Truly funny” What’s On BECKETTLAND “Mesmerising, imaginative and insightful” Baltimore City Paper THE SEAGULL Checkov’s masterpiece 3 MEN AND 2 DOGS “Accept no substitutes” Rip It Up Magazine BUGSY MALONE Alan Parker’s fantastic family musical DANCING AT LUGNASA Brian Friel’s funny, moving tale of Irish life WITCHES ABROAD Terry’s Pratchett’s package holiday saga with wings. Lawks!! MEMORIES OF THE INVISIBLE Award winning Anglo-Italian murder mystery DON GIOVANI Seduction, deceit and revenge in Mozart’s comic opera BLOOD WEDDING A story ofpassion, lust and betrayal INTO THE WOODS Stephen Sondheim and James Lapine’s fairy tale musical THE IMPORTANCE OF BEING EARNEST A tasty sandwich of a play SUNDAY LUNCH Absurd comedy set in a London flat GET A LIFE “Required viewing for women - and men ifthey dare” WOMEN OF A CERTAIN AGE Career women in their 30s/40s who can’t find mates SILENT WORDS Blade comedy about date rape KILLING LARRY A struggle to be one’s true self BARBYS, BALLS AND HAGGIS...THE COMEDY FEAST Top stand up comedy from around the globe JAQUES AND HIS MASTER Milan Kundera drama THE PIT AND THE PENDULUM A little late night horror EVERY DOG HAS ITS DAY Gun blazingly good show - a Tarantino musical THE RAPE OF LUCRECE An horrific journey through the oppressed feminine psyche OUR COUNTRY’S GOOD Powerful drama UNRELIABLE ROMANCES Free show Mondays - a cabaret noir FIND ME Disturbing true story about behavioural disorder WHOOPS VICAR IS THAT YOUR DICK “An absolute scream” The Scotsman Marcos Venue 98 Box Office 228 9116


OXFORD OUT OF THE BLUE oo@© Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 THE BESPOKE OVERCOAT A modern fable of a Jewish clerk, a drunken tailor, a ghost, a bagel, no soup and some bourbon.There is no sadder and funnier storyfreethanroom-service. Wolf Mankovitz’s Oscar-winning tale where Heaven is a hoteL.with Aug 18-23 17.30(18.20) £5.00 (£4.00) Venue 19 - C, Over-Seas House, 100 Princes Street Tickets 225 5105 110 ■AugTHE OVERCOAT 24-30BESPOKE 14.15 (15.05) £5.00 (£4.00) OXYGEN HOUSE AND MERLIN THEATRE ©O©© COMPANY Venue 30 - The NetherbowTheatre, 43 High Street. Tickets 556 9579 J13 ★FirstDANNY AND THEHouse DEEPjoinBLUE SEA Independent Award and Fringe winners Oxygen Merlin Theatre in producing the Scottish adaptation of this moving, bruising verbal not apache dance between dysfunctional be missed’. Time Outtwo Aug 8-30 (notstar-crossed Suns) 16.00lovers. (17.00)‘Should £6.00 (£4.00) OXYGEN PRODUCTIONS 00©0 Venue 45 - Old St Paul’s Church & Hall, Jeffrey Street Tickets 556 0476 J13 ★electric ■THEtensions EVENING BEFORE THE MILLENIUM AFTER ...unleashes between five characters spiralling towards history’s most overhypedrevelations split second:of suicide, Midnightsex1999. comedyWithpropels new playfrom towards wild and Black apocalypse. guestthisappearance the Antichrist. Aug 11-23 23.15 (00.05) £4.50 (£3.50) PARTIALLY TOTAL THEATRE 00©0 Venue 40 -The Quaker Meeting House, 7 Victoria Terrace. Tickets 220 6109 Jl I ★treesNEVER MIND THE RAIN FORESTS A by-pass is being built. A copse of lies in its bunch. path. High in those assemble bent onensues. saving them. A mixed thetreesground offer the verbalprotesters abuse. Battle Aug 18-23 20.30 (22.30)Guards £4.00on(£2.00) PENN THEATRE ENSEMBLE OOO© Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I is a 1920’s American murder casetheof thedemise time.The playindividual explores aMACHINAL woman’s hopeless search for love, and decries of the human25-30 spirit,10.trapped in a cold, Aug 45 (12.25) £3.00 mechanistic and materialistic world. PEPPERY EDGE PRODUCTIONS ©O©© Venue 19 - C, Over-Seas House, 100 Princes Street Tickets 225 5105 110 ★ SHELF-LIFE by Michael Roberts. A special offerBernstein you can’tmeets refuse.Sigmund Fil your trolley with comedy, music and paranoia. Leonard Freud in a corner shop, where one man realises that nostalgia ain’t what it used toAug be.6-30 (not 17) 10.15(11.15) £5.00 (£4.00)

PLEASANCE FESTIVAL OF THEATRE ’97 ©O©© Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550 LI4 ★FirstTHE LIGHTNING MAN YOUNG PLEASANCE (ONE) 1994 Fringe winning team that produced BUS! present a dramatic new musical of‘Breathtakingly secret passions, magic &Scotsmon.‘Very spectacular storms rockingcompany’ a rural community. skilfulblackdirection’ remarkable BBC Scotland. Preview Aug 8 17.30 £4.00 (£5.00) Aug 30(19.25) (19.25) Aug 9-14,18,20 15,16,22,23 17.17.30 (19.25) £6.50 £7.50 (£6.00) ★(ONE) HAVEAward YOUwinning SEENdramatist THIS GIRL? - NATIONAL THEATRE PeterTerson’s new playYOUTH explores events surrounding the disappearance of a teenage girl. Previous work for NYT includes Zigger Zagger and The Apprentices. See also NYT main heading. Preview Aug 17 17.45(19.15) £6.00 Aug 19,21,24,25,27-30 17.45 (19.15) £8.00 (£6.00) ■ 70 HILL LANE - IMPROBABLE THEATRE (ONE) Phelim autobiographical show (Time Outpuppetry, Critic’s Choice for McDermott’s 5 weeks). Aextraordinary magical & haunting synthesis of storytelling, improvisation, live music .A. &basket sellotape.‘Brilliant,funny, moving and dazzlingly inventive.’ Independent' case genius’ Guardian. Aug 25,27-30 20.15 (21.50) £8.00 (£6.00) ■MARCEL DOCTORSTEINER STEINER’S STRANGERTHAN FICTON SHOW (OTR) buffoonery, spontaneous combustion ...andletVaudevillian sausages, the creator ofmass THErichhypnotism, SMALLEST THEATRE IN THE WORLD loose on the big stage.‘A theatrical experience...’ Independent . ’ NY Post Preview Aug The 7 15.00 (15.55) Truly £5.00 funny. Aug Aug 8-11,13,14,17-21,26-30 15,16,22-24 15.00 (15.55)15.00 £7.50(15.55) (£6.50)£7.00 (£6.00) GUARDIAN INTERNATIONAL STUDENT DRAMA (TWO) Catch the very best of student drama fromof thearound theGuardian worldAWARD atInternational the Fringe inStudent a special performance by the winners 1997 Award. £6.00 Not to(£4.00) be missed - book early. Aug 25 Drama 11.30 (13.30) PLEASANCE FESTIVAL OF THEATRE ’97 continues over the page

PERFORMANCE EXCHANGE OOOO Venue 40 - The Quaker Meeting House, 7 Vittoria Terrace. Tickets 220 6109 J11 ★most■ PUCCINLTHE DREAM OF PUCCINI The last days of Puccini - for the his popular man in the world of opera. Suffering from cancer he is on trial sins and11-16failures.The judge and the Maestro himself. Great play, great music. Aug 21.00 (22.10) £5.00jury;(£4.00) PLASTICACID THEATRE COMPANY ©O©© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★HAPPINESS ■ ARTIFICIAL LIMBS: A DO-IT-YOURSELF GUIDE TO INNER Sellotape and video tape, handbags and jewellery, baby lotion, vodka, and fetishistic, Chekhov. Nine performers, agendaschaos - who’s directing? culture. ARaw.frenetic, multimedia melange:nineclutter, and consumer Humorous. Aug 6-30 (not 17)Unmissable. 17.00(17.50) £4.50 (£3.50) THE PLAYER’S COMPANY OO©© Venue Info/Tix128346- Yout 1405h International or 229 5562at St Oswald’s, Montpelier Park N6 THE LOVE OFATHE NIGHTINGALE Experimental, ritualistic, . ' ‘of■sense-surrounding. talented young team give a challenging interpretation Wertenbaker’s classic. A fantasy of music, movement and mask. Theatre with22.30 no rules. Aug 18-23 (midnight)£6.00£6.00(£4.00) (£4.00) Aug 25-30 21.30 (23.00)

97


THCATRC PLEASANCE FESTIVAL OF THEATRE ’97 continued ★ ■ DUSTY FRUIT - from REJECTS REVENGE (TWO)(PEASOUPER Internationallyacclaimed comic theatreshouted‘Hurrah!’Twice.’ 1995 Fringe First winners ‘deliriously inventive...! The Times) all new gags. Same trousers. ‘Supply more laughs than any comedianGuaranteed on the Fringe.’ London Evening Standard. Preview Aug 8 12.30 (13.40) £4.00 12.30 (13.40) £6.00 (£5.00) Aug Aug 9-11,13,14,17,18,20,21,26-30 15,16,22-24 12.30 (13.40) £7.00 (£6.00) ■theGRACE COMPANY (TWO) Anarchicsynthesis comedy about desires clowning, of- JADE a 90’s THEATRE woman turning 30. ‘hilarous...a triumphant offluid,physical jazz-like improvised script and funky soundtrack-frantic, tough,Augtouching very very Time Out, Critic’s Choice. Preview 6 14.00and(15.20) £5.00original’ Aug 14.00 (15.20) £6.50 (£5.50) Aug 7-11,13,14,17,18,20,21,25,27-30 15,16,22-24 14.00 (15.20) £7.50 (£6.50) 4 4 What 1 ★ ■ DEADto ON THEandGROUND - HOIPOLLOI (TWO) Sometimes impossible forgive forget. Bizarre black farce about a man accidentallyit’s was it like killed by a novice angel.‘ingenious ...snortingly funny physical comedy’ when drugs Independent. you happy to be alive! Previews AugA show 8,9 15.that45 will (16.50)make£4.00 were new, Aug 45 (16.50) Aug 10,12-14,17-21,25,27-30 15,16,22-24 15.45 (16.50) 15.£7.00 (£6.00) £6.00 (£5.00) sex wasn't dangerous ★trilogy ■ ZERO FRANTIC ASSEMBLY (TWO) Concluding the Generation (KLUB 1995,most FLESH 1996). Asmoment the new millenium FRANTIC confront history’s contrived a needwiped toapproaches, indulge, and revealAug all before the(20.00) clock £5.00 strikes and thewithslate’s clean. confess Preview 7 18. 5 0 Aug 18.50(20.00) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 18.50 (20.00) £8.00 (£7.00) £7.00 (£6.00) ★ SWAN SONG BY JONATHAN HARVEY (TWO) Front (The Venue 41 Theatre Day Today,byAlan Partridge) stars inofthehitworld premiere ofTHING a Rebecca stunning bittersweet Hill 14 HillStreet Street comedy the acclaimed author filmofBEAUTIFUL andStandard. West End Edinburgh sell-out BABIES:‘The new theatrical voice his generation’ Evening Previews Aug 6,7 20.25 (21.40) £5.00 20.25 (21.40) £7.00 (£6.00) August 10th - 30th 1997 Aug 8-II, 13,14,17,19-21,25-27,29,30 Aug 15,16,22-24 20.25 (21.40) £8.00 (£7.00) ★ ■ poetry.‘Their RED ZONEtheatrical - DEREVO (TWO)is faultless-explosively Russian: part theatre,slypart& hugely clowning, part bravado talented. Sunday Times ‘They are a remarkable company-work that is full ofPreview pain yet‘Aug is also visually compelling.’ Guardian 7 23.30 (00.30) £4.0023.30 (00.30) £6.50 (£5.00) Aug THE STAND COMEDY CLUB Aug 8-11,13,14,17,19-21,25-27 15,16,22-24 23.30 (00.30) £7.50 (£6.00) THE LONG GOOD FRIDAY -into THEfastCORPORATION (ABOVE) The cult presents British gangster movie translated moving theatre, with rough diamond dialogue, dramatic tension, choreographed action, evocative music and underworld intrigue a classic piece of modern-day storytelling. Previews Aug 7-9 11.00(12.20) £4.00 Aug (12.20) £5.50 (£4.00) i.oom RITA, SUE (f BOB TOO Aug 10,12-14,17,19-21,25,27-30 15,16,22-24 11.00(12.20) £6.5011.00(£5.00) BLUE REMEMBERED HILLS ONLY HUMAN THEATRE CO. (ABOVE) The longouthotthesummer of 1943.The of Dean.ofAbeing group7. ofOr children excitement, adventuresForest & tragedies 4.00pm H0VIS PRESLEY beingplay human.14.00Dennis Augof7,14,21,28 (15.00)Potter’s £6.00remarkable (£5.00) play - Thursdays only. ★has■memorised MEMORYtheMAN - PAUL CLARK (ABOVE) A vaudeville entire Kansas Telephone Directory and can giveperformer theofnumber 5.30pm LUMBERJACKS ON ICE for any name, except for one which he can never remember.Terrified being exposed, he heads to40 Kansas for£5.00 a showdown! Preview Aug 7 12. (13.40) Aug Aug 8-10,12-14,17,19-21,25,27-30 15,16,22-24 12.40 (13.40) £7.5012.40 (£6.50)(13.40) £6.50 (£5.50) ★(ABOVE) TOMORROW IS A LOVELY DAY ONLY THEATRE 0.00pm JOHN GILLICK A homage to Dennis Potter.a parliamentary It’s -1964 and HUMAN Derek Peters, satirist andCO thrusting young politician, is fighting election. He’s also fighting illness, imperialism, self-hatred and these bloody hallucinations... Previews Aug 6,7 14.00(15.10) £5.0014.00 (15.10) £6.00 (£5.00) 9.10pm SCARLET HARLOTS Aug Aug 8-10,12,13,17-20,25,27,29,30 15,16,22-24 14.00 (15.10) £7.00 (£6.00) ★English ■ PRUFROCK: LIVE! -comedy, EMPTYimpro, SPACE CO (ABOVE) Literature, stand-up clown.THEATRE Is poetry boring? 10.30pm THE STAND Culture meets cutting edge. Willmaking it hurt?the Fringe First winners unpackT.S.EIiot spiralling round his love song, words soar, with passion, humour, guts & peaches. COMEDY CLUB Preview Aug 2018.18.30 (19.40)£7.00£5.00(£6.00) Aug 30 (19.40) Aug 21,25-30 22-24 18.30 (19.40) £8.00 (£7.00) FIVE ACTS FOR A FIWR ★ ■ THEMusical TEARSplayOFexploring FRIDAYtheEVENING -landscape SEDUCTION OPERA (ABOVE) emotional of Brecht. A dramatic ALL SHOWS £4 (3) journey combining mime,tender cabaret with theFriedl’s evocative ofWeill & Eisler. LATE NIGHT CLUB £5 (4) ‘Bawdy, bitterly satiric, or£5.00funny; voice music is superb.’ Newsweek Preview Aug 9 18.30(19.40) CHECK PROGRAMME ENTRY Aug 10,11,13-17 18.30 (19.40) £6.00 (£5.00) rftt FOR DETAILS 98


THCATRC BBC Radio 4 celebrates 5 years at the Fringe i—

-

1993 Ian Hislop, Arthur Smith, Harry Hill 1994 John Hegley, Jeremy Hardy 1995 Jenny Eclair, Eddie Izzard 1996 John Shuttleworth, Julian Clary, Ardal O’Hanlon

1997 Come and see who’ll be joining Paul Merton this year!

Kaleidoscope msr of the msrs FRINGE FIRST 1997

★Highly BEYOND ECSTASY - VENUS PRODUCTIONS (ABOVE) charged comedy about love &a ecstasy. A young prostitute escapes her psychotic pimp boyfriend. Featuring liveofDJtwenty and clubsomething visuals. ‘Gripping very funny’ What’s On.‘Brilliant portrayal neurosis’stuff, Time Out. Preview Aug 8,9 22.40 (00.05) £5.00 Aug 10,12-14,17,18-21,25-30 22.40 (00.05) £6.00 (£5.00) Aug 15,16,22-24 22.40(00.05) £7.00 (£6.00) ★ KANZERSTIK - DOUBLE (OTR 2)ofExciting new blackCigarette comedy enjoying its Edinburgh premiere. InEGO anisoutpost the Kanzerstik Empire, this ignorance reigns, butjustchange imminent. Seduction & murder entwine, proving femme is not fatale, she is positively fuming. Aug 8-10,12-17 12.00 (13.00) £5.00 (£4.00) ★ YOU AREofMYprize-winning MOTHERDutch - BACKCHATTHEATRE CO (OTR 2) UK premiere play by mother Joop Admiraal, explores the disconcerting fusion of identity between & son; with Richard Earthy. ‘Best play’ awards - The Netherlands, Germany, Austria. Delicate...compelling... highly19-21 recommended. Aug 12. 0 0 (13.00) £6.50 (£5.50) Aug 22,23 12.00 (13.00)£7.50£7.50(£6.50) (£6.50) Aug Aug 2425-3014.3014.(15.30) 30 (15.30) £6.50 (£5.50) ★ URBAN MINEFIELDS - images OSCARandMCLENNAN (OTR 2) A talecreating of foura cities, with soundtracks unique visualstunning theatrecanprojected show ofbeexplosive andasextraordinary surrealhallucinations’ humour, ‘leavesFestival an audience experiencing what only described verbal Times. Preview Aug 7 14.40 (15.40) £3.50 £6.00 (£4.00) Aug 8-10,12-14,17-21 14.40 (15.40) Aug 15,16,22,23 14.40 (15.40) £7.00 (£4.00) ★ ■ MISTERV.CAMPAIGN TO FREEofVanunu.the VANUNU (OTR 2)technician Theatrical collage. An actor’s journey in the footsteps nuclear who revealed the Isaraeli nuclear weapons programme in the Sunday Times back in 1986 and imprisoned for£5.0018 years. Preview Aug 9 17.20 (18.20) Aug (18.20) £7.00 £6.00 (£6.00) (£5.00) Aug 10-14,17-21 15,16,22,23 17.17.2020 (18.20) ★JAFFA MISSPRODUCTIONS BROADMOOR - (OTR LANDLADY TO their THESPIANS - LAFFAKISS 2) Following last hit FRENCH (‘A deliciously appealing show’ Scotsman), Penelope Solomon invites you where to stay atblackMisspudding Broadmoor’s theatrical boarding house. A star-studded universe meets black comedy. Previews Aug 7,8 18.45 (19.45) £4.50 Aug 18.45(£6.00) (19.45) £6.50 (£5.00) Aug 9,10,12-14,17-21,25,27-30 15,16,22-24 18.45 (19.45) £7.50 ★to YOUNG PLEASANCE GOES STORE CRAZY 18 minutes spare?mixThenof catch allsongs the glamour and ‘Who heartache of Broadway the(OTR high 2)street in this sublime original and scenes. needs with this company around?’ Scotsman Aug 25-30 (not 28) 20.15 (20.35) £1.99 (£0.99) IAN SHUTTLEWORTH: CRITICAL (‘COMIC -THE INDEPENDENT) (UPSTAIRS) When to MASS eata minefield, - where toimplausibly go -GENIUS’ whatrespected to sleep with and during which shows. If Edinburgh’s theatre critic Fringe Ian Shuttleworth is your beagle. he smokes more. The survival guide....with FREEOnly DRUGS! Aug ultimate 10,11,13,14,17-21,25 Aug 15,16,24 12.15(13.15) 12.15(13.15) £5.00 (£4.00) £4.00 (£3.00) LATIN! BYSchool’s STEPHEN FRY COUNTERWEIGHT PRODUCTIONS (UPSTAIRS) ‘out’, as are- the teachers,about for prep the silliest hour’s detention ever. Fry’s Fringe first is a spanking comedy school jiggery-pokery. Fringe veterans Mitchell &Webb are in a class of their own... Previews1,13,14,17-21,25,27-30 Aug 7,8 13.30 (14.25) £4.00 Aug 13.30(£6.00) (14.25) £6.00 (£5.00) Aug 9-115,16,22-24 13.30 (14.25) £7.00 ★squabbling ■ HUMMINGBIRDS CAMBRIDGE ADC (UPSTAIRS) Squawking, birdpeoplemagical on a Latin-American rubbish dump are transformed bycolour, a Hummingbird’s song. Prancing peacocks, sharp-eyed magpies, clowning, clever and carnival rhythms - a feathered fiesta for families! ‘Funny, touching, sheer originality’ Varsity. Previews Aug 6,8 14.40 (15.50) £5.0014.40 (15.50) £7.00 (£5.00) Aug 10,14,16,18,20,22,24,26,28,30 ★Funny, DR.thrilling JOHNSON’S DICTIONARY ADCfrom (UPSTAIRS) play about Dr. An Johnson’s life- CAMBRIDGE andexperience work, travelling the aOuter Hebrides to literary London. unmissable for anyone with love ofPreviews words or7,9an 14.40(15.50) appetite for new and challenging theatre. £5.00 14.40 (15.50) £7.00 (£5.00) Aug 11,13,15,17,19,21,23,25,27,29 ■music, RICHARD IIIvisual- ODDBODIES (BELOW) An intriguing blend of text,Richard live imagery andmaestros physical performance. ‘Aardtwo-person I(More I fromstunning the striking tragi-comedy behind Sykes Nancy: damn theatre I’ve seen in many an hour and a half.)’ Time Out. Preview Auggood 7 14.00 (15.25)than£4.00 Aug 10,11,14,15,18,19,27,29,30 14.00 (15.25) £6.00 (£5.00) Aug 15,22,23 14.00 (15.25) £7.00 (£6.00) PLEASANCE FESTIVAL OF THEATRE ’97 continues over the page 99


‘A DANCE GENIUS: IN SHAKTI, THE FIERY EMO NON OF ANCIENT INDIA CONTRASTS WITH THE CALM REALM OF ORIENTAL BUDDHISM.’ THE NEW YORK TIMES

NOT TO BE MISSED’

#

‘SHAKTI DANCES WITH DEMONIC DRIVE’

GRAmn - VENUE 90 CORNER OF BROUGHTON STREET AND EAST LONDON ST 8-30 AUGUST 10PM (11PM) BOX OFFICE: 0131 557 8330 TICKETS: 15-30 AUGUST E7/E0 (8 ■ 14 PREUIEWS tilts) H (111 J11: li>J I MU; t^! KnmTK I IKI!1 A VARIED PROGRAMME OF AWARDIAP4N FXPFR FNCF WINNING THEATRE, QSjflrflM LAI LniLllUL MUSIC ANDDANCE, ART FROM JAPAN. FILM, AT THE RANDOLPH STUDIOS, INSTITUT FRANCAIS D’ECOSSE, 13 RANDOLPH CRESCENT FOR PROGRAMME AND BOX OFFICE DETAILS 0131 225 5366 100

PLEASANCE FESTIVAL OF THEATRE ’97 continued ■of SYKES & NANCYjostle - ODDBODIES A veritablesuccessful feast Dickens characters for attentionCritic’s in(BELOW) this Choice tremendously visually stylised production.’ appalling Independent in London & Chicago, don’t miss this ‘wonderfully and vulgar...sheer black comedy...splendidly done.’8,9,13,17,20,21,25,28 Eastern Daily Press 14.00 (15.15) £6.00 (£5.00) Aug Aug 16,24 14.00 (15.15) £7.00 (£6.00) NIGHTSHIRT - SHEEPreturns THRILLS COMPANY (BELOW) Sell Comedy/Thriller fromTHEATRE Stephen ‘Anorak oftorment. Fire’ Dinsdale. DavidoutLynch meetsthreatens Bet Lynchpersonal in deserted mini cab office Telephone stalker visit.‘Dinsdale, a writer to watch, Brignall24-30 an actress to cherish’ Aug 17.05 (18.10) £6.50Times. (£5.50) ★ ■ THEFrom POST OFF young POEMSpen- ofNICK E EZINC PRODUCTIONS (ATTIC) the angry NICK MELVILLE.These sardonic and ad amusing poemsaccompanied are very Scottish while dealing with universal themes. A great for Scotland, by slides and a soundtrack. ‘Witty and succinct verse’ Minerva Press. Previews Aug 7-9 11.30 (12.25:) £3.00 Aug 10,12-14,17-21,25,27-30 11.30 (12.25) £5.00 (£3.00) ■ FORCES PEACE - ARTTS (ATTIC)kind Horrors ofof★ war in BosniaareOF have beenonlyrevealed theINTERNATIONAL world.Fringe Horrors another inhumanity known in theoftoUN. These Firstofwinners again raise questions about the use and abuse power. Aug 6-10,12,13 12.40 (13.50) £4.00 (£3.50) MOLLOYOn- GARE STof ‘unlawful LAZAREattitude PLAYERS (ATTIC) Beckett’s charges while at rest.players ‘ WANTED Lasthave seengotcycling onMOLLOY. crutches in Bally, Ballyba, Ballybaba.The legendary the Irish recluse to speak. Can anyone(13.50) get him£4.00 to shut up? Previews Aug 16-23Aug12.5014,15(13.50)12.50£5.00 (£4.00) AT THE -AIDAN his★ BLUE acclaimed poembeTHROAT ‘Vale Royal’.‘If theremore wasDUN sucha(ATTIC) arock showstarAidan asthan ‘Topperforms of the Poets’ Aidan Dun would on it. He looked like McCartney.’ Guardian Aug 24-30 12.50 (13.50) £5.00 (£3.00) MAEcurtain WEST:risesALLon OF - HOME IS WHERE THEone ARTliners IS (ATTIC) The the ME queen of innuendo & notorious Snow White but I drifted’. Mae West daughter, sister, lover an angel‘I used alone.to be Previews Aug 6,7 14. 0 5 (15.20) £4.00 Aug 05 (15.20) £5.50 (£4.50) Aug 8-10,12-14,17,19-21,25,27-30 15,16,22-24 14.05 (15.20) £6.0014.(£5.00) ★George SHOOTING AN ELEPHANT H PRODUCTIONS Orwell’s classica young tale brought to theH must stage for the 1st time.(ATTIC) Burma, 1927: The Empire is dying; British sell-out‘Kenny officer face his conscience.... The same team as I996’s acclaimed Carries On’. Previews Aug 8,9 15.35 (16.20)15.£4.50 Aug 10-14,17,19-21,25,27-30 35 (16.20) Aug 15,16,22-24 15.35 (16.20) £6.00 (£5.50) £5.00 (£4.50) ★starlet THEgetsRIPPLE EFFECT REVELATIONS 50’sDoll’ Hollywood the chance of aherlifetime. Before you can(ATTIC) say ‘Baby she’s& lollipops caught upabound in a nightmare beyond wildest expectations. Sand, mint juleps in this darkly comic murder mystery. Previews Aug 6,7 16.35 (17.45)16.3£4.50 Aug 5 (17.45) Aug 8-14,17,19-21,25,27-30 15,16,22-24 16.35 (17.45) £6.50 (£5.50)£5.50 (£4.50) THE NAKED GUEST ANIMUS (ATTIC) snowslover. outside StPowerful, Petersberg. Pushkin selects his pistol to desire, duel January withfocusing his l837.The beautiful wife’s touching new play about human on the last days and haunting poet. Previews Augpoetry 6,7 19.of45Russia’s (20.45)greatest £5.00 Aug 19.45(£6.50) (20.45) £6.50 (£5.50) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 19.45 (20.45) £7.50 ★ ‘GASP!’ giant silver jellythemselves 26ft- ECONOMICAL in diameter is theTRUTH settingself-obsession.You’ve in (COURTYARD) which EconomicalAheard Truthofinflatable expose &thatexploit obsessed with the show shook the world this is the show that just shook. Preview Aug 10 16.00 (17.00)16.&0018.(17.00) 45 (19.45) £3.00 Aug I I -14,18-21,25,27-30 & 18. 4 5 (19.45) £5.50 (£4.50) Aug 15,16,22-24 16.00 (17.00) & 18.45 (19.45) £6.50 (£5.50) POUNDS, DOLLARS AND CENTS ®0©0 Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 K10 ■dynamics ABSENT FRIENDS Ayckbourn’s satirical exploration of thethesocial within a group of middle class friends. Capturing both humour and comedy the darkerof undercurrents of the play,‘Pounds, Dollars and Cents’ present this manners with subtlety and charm. Aug 8,10,12,14,16,18,20,22 16.55 (18.10) £3.50 (£3.00) ★ BORN TOtown BE WILDE One woman’s Oscar Wilde, anlatest evacuated andto the a sinister secret all fascination combine towith formthis Oliver Snowball’s play. Intriguing end and charged with humour, sharply written drama9,11,13,15,17,19,21,23 is an absolute must. 17.00 (18.05) £3.00 (£2.50) Aug


THCATRC PROMINENT THEATRE ®0©© Venue 19 - C. Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★ElsaFEEL REAL - A PLAY ABOUT FROTTING REALITY by AlexDaron Evans. f***s her imaginary friend. Adam makes art of casual sex. Lovers and NickLove’ try escaping reality... can they? From the creators of 1996’s hit ‘Making Scotsmen. Adults Aug 6-30 (not- ‘excellent’ 14,28) 23.00(00.25) £5.00 only. (£4.00) PULSE ©GOO Venue 82 - Southside, Southside Community Centre, 117 Nicolson St. Tickets 667 2212 M12 ★Interactive A KINDDating. HEART AND A BIG DONGER Prince Charming is waiting at Along with sixcabaret womenwillwhohavebareyoutheirgrabbing souls and theirkleenex bums. This newways Australian one-woman for the inAugmore than one. 6-16 19.15(20.15) £5.00 (£4.50) "Nothing short QMWTHEATRE COMPANY OOO© Venue 45 - Old St. Paul's Church & Hall, Jeffrey Street Tickets 556 0476 JI3 CU °f magic" VINEGAR TOM Caryl Churchill’s ‘play about witches with no witches in it’ THE IRISH INDEPENDENT sets up a dialogue between ‘history’ and the present. Who were the witches then they now?£5.00Physically Aug and 25-30who16.are15 (18.00) (£4.00) vibrant with live music. 7 shows only ROAD Jim Cartwright’s contemporary classic hasrepresentation been revampedof the andslide moulded into a 90s setting.This a powerfulinandBritish moving of thepast working class toisunderclass Society which has overshadowed Gilded Balloon the decade. Aug 25-30 18.30 (20.00) £5.00 (£4.00) 17-23 August ★ TWO PAIRS OF SHORTS Four new pieces of comedy - one in a beach hut, one in a biscuits, car, one gold in a rabbit and hutch and one in the war. Includes industrial wheeley 8.45pm Aug 25-30bin,20.30 (21.45) toilet £5.00 (£4.00)special guests Elvis and Adolf. Box office 0131 226 2151 8UEEN MARGARET COLLEGE DRAMA An RBM Presentation EPARTMENT ©OOO Venue 24 Queen Margaret21 College, Tickets 317 3546 (from July) Drama Dept, Clerwood Terrace. HI Outer BETTY ANDMcKellan BOBBY’S MACBETH Humourful version of the Beard’s mantelpiece. jist done Richard 3, Branagh only executed Hamlet. We do Big Mac. sell-outsy ‘Bouncers’ (5 stars, Scotsman) and ‘Abigail’s Party’ (‘Excellent’, EveningFollows Bruce Morton Aug 7-16 (not 10)Nevvs).Thrice 19.35 (21.00)Capital £5.00Award (£4.00)winning Andy Mackie directs. show RE-ACT THEATRE OO©© Venue Bristo10am-5pm) Square, (near Fringe Club) Tix 650238201- Chapl(preain7cyAugCentre, 651 I 1332 L12 SCRAPS This bittersweet comedy is an intense, thought-provoking insight into the relationships between five leaves friends.youIt successfully comedy with grief atof itshuman most base level.‘Scraps’ in no doubtblends about the frailties Aug 21-30nature. 18.15 (19.45) £5.00 (£3.00) REALLY NECESSARY TRAVELLING ACTORS ©OOO Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 THE CANTERBURY TALES A hilarious, bawdy update ofwhimsical the classicmorality Chaucer tales with songs and all the rude bits intact! All the of the Pardoner’s Tale and the outrageous indecency of the Miller’s contribution theatre Aug 6-16for the 15.45broad-minded. (16.50) £5.00 (£4.00)

“Morton has an appeaP that transcends fashion

RED EYE PRODUCTIONS OO©© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 2257226 KI0 THE DUMBWAITER Harold Pinter’s darkly humorous study of human relationships. Charged with psychological tension the hour long play focuses onComedy, the changing relationship between two men and their uncertain future. and maybe Aug 17-30suspense 13.00 (14.15) £5.00murder! (£3.00) RED FISH THEATRE COMPANY OO©© Venue 45 - Old St Paul’s Church & Hall, Jeffrey Street Tickets 556 0476 J13 ★for■another.The JEALOUSYtaleAofghostly legend of love, and the tale of trading one life man haunted ghosts, ofthisthehorror story from 12th Century China is aa bitingly relevantby£5.00 expose Aug 12-17,20-24,27-29 22.00(23.00) (£4.00) set/ch for happiness.

101


COMEDY

UNCLE BOB by AUSTIN PENDLETON VENUE 55 (RANDOLPH STUDIO) Aug.l0-16@4:00pm / Aug.17-24@4:10pm “...a powerful, intelligent risk-taking play.” -The New Yvrk Times “Intense... very funny... riveting.” -The New Yorker “Fascinating....absolutely riveting.” - The Chicago Tribune Mentyn Stutter’s PICK OF THE FRINGE A daily showcase of the BEST OFTHEFEST “All the Fringe in an hour and a half’ The Scotsman 9 - 25 August I pm - 2.30pm PLEASANCE 0131-556-6550 102

Adam Bloom Al Murray Alistair McGowan Arj Barker Ben Moor Boothby Graffoe Cambridge Footlights Charlie Chuck Cheese Shop Club Seals Cluub Z Comedy Zone Dallas & Packer Dave Gorman Dylan Moran Edinburgh Revue Frank Skinner Greg Proops Ian Shuttleworth Instant Sunshine Jason Freeman Jo Enright Junior Simpson Kevin Gildea Kissing the Goldfish L’Ultima Recital League of Gentlemen Lee & Herring Lenny Beige A Little Fight Music Liz Webb Mark Maier Mervyn Stutter Mel, Sue, Gerry & Emma Milton Jones Mitchell & Webb Parsons & Naylor Punchline Rich Fulcher Scott Capurro Sean Lock Sir Bernard Chumley Stewart Lee nn Tiny Mo’s Kilkenny Kabaret (HUME SIS & BBC Radio 4 PLEASANCE 0131 556 ASSEMBLY + GILDED BALLOON6550 + PLEASANCE


RED JAM OOOO Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I ★ ■ POTS OF make RED JAM Most people find youth. older Awomen vital, sexy,joyous, wise. Institutions them cling on to their collage of sad, whimsical scenes andfeminism, songs about image, older women’s themes - invisiblity, menopause, health, work. Aug 11-16 family, 15.00(16.00) £5.00body(£4.00) RED SHIFT THEATRE COMPANY OO©© Venue 2 - Fringe Club.Teviot Row, Bristo Sq. Tickets 226 5138 III LES MISERABLES Powerful new interpretation of Hugo’s classic.All the excitement, invention and compassion which make Red Shift shows ‘Highlights of the Award Fringe’ 1996.‘Resonant, Scotsman. Live music. Ingeniousperformed’ design. BARTLEBY: Actor immaculately Guardian.Winner Best ‘Recommended’ Times. Aug (not Fringe 18,25) Club 16.00 Membership (18.30) £8.50 for (£6.50) Ticket10-30 includes the evening RED SOX (DO©© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 THEname PIGSTY bySeeKevin Williams.Two naked men shovel over a ton of shit in-★andthe of Art. this world premiere a black, comic, heart-rending piece discover of shit(22.10) can become paradise. Aug 6-30 (nothow 14,28)a life20.55 £5.50 (£4.50) RICHARD MEDRINGTON’S PUPPETS OOO© Venue 30 - The Netherbow Theatre, 43 High Street Tickets 556 9579 J13 ★In which ■ NOW WE ARE VERY OLD: AN AUDIENCE WITH A.A. MILNE we return to the Enchanted Place where a little boy and his bear are always playing. Poetry requests, a story - your childhood revisited. (Adults25-30 and over Aug 18.00 12s) (19.10) £6.00 (£4.00)

THE SCOTTISH THEATRE AND MUSIC SCHOOL oo@© Venue 88 - St Stephen’s Centre, Foot of Howe Street Tickets 556 2661 FI0 ONCE A CATHOLIC Mary O’Malley’s witty, warm-hearted comedy about growing up in a convent school for girls in the 1950s as the 5th form begin toAugdiscover there’s24)more19.50to(22.20) life than£6.00 O’levels, 18-30 (not (£5.00)the Virgin Mary and original sin. ★ HAGGIS, NEEPShelping AND ofBURNS An exciting menu of traditional Scottish fare with a generous poetry and animated rompwhisky. through the life of Robert Burns’andThesong.‘An Scotsman.amiable Ticket includes a meal and Aug 11-22 (not 16,17) 12.10(13.35) £6.00 (£5.00) 2ND NATURE 00©0 Venue Info/Tix128346- Yout 1405h International or 229 5562at St Oswald’s, Montpelier Park N6 ★ WALKING ‘Weandlearnt to piss on ourtale feet.ofSoft skinwhois hopeless, entirely useless.* A poetical darkly humorous those ‘follow’. Created by John ‘AEggleston. Directed double Fringe First award-winner Donalh18-23 Macneil. masterpiece’ Venueby(Bristol) Aug 18.00 (19.10) £5.00 (£4.00) SECOND THOUGHTS OOOO Venue 166 - Bruntsfield Primary, Montpelier N6 ■about THEa boy GOLDEN PATHWAY ANNUAL A nostalgic and hilarious comedy growing from- ortheanywhere end ofWW2.‘One funniest thingsfor all I have ever seen on aupstage else’ Stratfordof the Herald. Suitable and old. ROWAN TREE COMPANY 00©0 young Aug 11-16 19.00 (21.30) £5.00 (£4.00) Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 K12 ★ humour ■ FISHTALES Attentionwithall those anglers!of master No fishingstory-teller tales canJohn compare SEVENTH SON PRODUCTIONS OO©© inSpend and imagination Buchan. Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I your lunchtime by the Tweed as Rowan Tree’s John Nichol brings them ★ THE PARADOX OFshowINSANITY! I MEAN HUMANITY!! toAuglife.10-19 Hilary13.00 Bell’s(14.00) songs complete the piscatorial celebration. Rick Almada’s one-man takes audiences on a comical journey of intense £6.00 (£4.00) and wonder inexquisitely eight character ‘Off the comic deep enduniquemystical and (not beguiling... subtlesketches. performance’ SCHHH!THEATRE COMPANY 00©0 Aug 11-30 17,24,28) 21.30(22.45) £5.00 (£4.00)Chicago Reader. Venue 45 - Old St Paul’s Church & Hall,Jeffrey Street. Tickets 556 0476 JI3 ©O©© ROMEO & JULIET Thea ‘physical’ Bard at chorus Brunch-time: love,indeath, leather, fire, original KERRY SHALE music, songs, ten Juliets, combined an inventive adaptation 3 - Assembly Rooms, 54 George Street Tickets 226 2428 111 ofAugShakespeare’s totally(£2.00) theatrical experience for eyes, ears and minds. Venue ★Comedy, THE PRINCE OF WEST END AVENUE from Alan Isler’s novel. 18-23 12.15original. (13.45)A£4.00 tragedy, desire and death in a Jewish Retirement Home as the residents theirGuardian version of‘Extraordinary’ HAMLET. ShaleTimesplays‘Electrifying’ 18 characters. Past reviews: SCOTTISH POETRY LIBRARY OO©© attempt ‘Magnificent’ Independent 8-11, 13,14,17,18,20,21,25,27-30 16. 2 5 (18.10) £7.50 (£6.50) Venue 56 - Scottish Poetry Library,Tweeddale Court, 14 High Street. Info 557 2876. Kl3 Aug ■to COURTYARD to allpoems. and inOnthealternate open.Youdays, are before welcome Aug 15,16,22-24 16.25 (18.10) £8.50 (£7.50) participate, readingREADINGS your ownDance orOpen others’ SHATTERED WINDSCREEN THEATRE COMPANY the reading, Cerridwen Bhuto perform ‘Sea and Cliff Face’ to words oo©o by poetI 1-30George Aug (not Bruce. Suns) 14.00 (15.30) Free Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 ★ the ■ THE PITInquisition AND THEis unveiled. PENDULUM Latebridenightmarries horror.The terror offamily. Spanish A young into a torturer’s Somewhere in the castle there is a dark secret. A blend of Poe, LOST IN THE CITY? Hammer Berkoff. Aug 17-23and22.30 (23.20) £5.00 (£4.00) See our map inside the back cover

^presents TruckStop Godde/s „ , .sur. U[.l dWeautif u ,11996-Fri ulflstudy, told anyway which is quite mesmerizir Aug. t8,20, 22,25,27,29 0 19. Aug. 8flfftifisfl9*21,23,26,28,30 0 18

Viewforth Centre Office: 0131 229 7659 104 Gilmore Plao Venue #17 running in rep inge Box 0131 226 103


THEATRE THE SHOESTRING PLAYERS ©O©© Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 2257226 KIO THE SERVANT OF TWO MASTERS Youngandlove, mistaken identities, a tricky servant and twenty-four hours of action laughter in this classic Italian comedy. A sassycompany. colorful show for the entire family presented by this Fringe First winning Aug 8-10 18.10(19.25) £5.00 (£4.00) £6.00 (£4.00) Aug 11-13,18-20,25-27 Aug 15-17,22-24,29-30 18.10 18.10 (19.25) (19.25) £7.00 (£5.00) SHORT BACK & SIDES OQ©0 Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 KI3 cfl SRtl&Ua/ JyP| THE IMPORTANCE OF BEING EARNEST A trivial play for serious people. Short Back and Sides ‘A reminder of what the Fringe should be about’, Scotsman back in Edinburgh with Oscar Wilde’s hilarious comedy of manners. WITH THE GRACE AND BEAUTY OF . j Aug 11-23 (not 17) 11.45 (13.30) £4.50 (£3.00) balletic Choreography, boisterous SLEEVE PRODUCTIONS OO©© MELODIES OF AUTHENTIC RUSSIAN MUSIC, Venue 98 - Marcos, SS Grove Street. Tickets 228 9116 K7 Thrills and Excitement of Spectacular SUNDAY LUNCH Absurd comedy set in London flat. Will Alan get to work? Are Charlotte’smixture parentsofstillthree alive? Is B.B the new results King ofinRock’n’Roll? Russian Circus Artistes, zany humour The a Sunday from hell. Aug explosive 17-30 (not 26) 16.30 (17.30)manic£5.00flat-mates (£4.00) OF AWARD WINNING CLOWNS - ALL CAREFULLY BLENDED TO CREATE A CLASSIC CULTURAL SMALL PLANET PRODUCTIONS OOQO PERFORMANCE Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 K5 ★Weight ■ THE DAY OF THE 43 SUNSETS ‘What then shall we choose? or lightness?’This is weather the Littlereports. Prince inWith freefall.This is a daywhoofarenightnot flights, phone conversations, those people farAugaway, but 13.00 too far(14.30) to touch. BOOK NOW! 11-16 £5.00 (£3.00) Aug 18-23 12.00 (13.30) FESTIVAL FRINGE BOX OFFICE 0131 226 5138 SMASHING THEATRE COMPANY 00©0 Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I ★ PINTER REVUE! Start your day the Pinter way withRequest a hilariousStopwhirlwind tour of four of his plays:The DumbWaiter, Night School, and Special Offer. Come and see this unusual revue style performance. | dial-a-seat 0131 667 7367 | Quite unforgettable! Aug 11-23 (not 17) 11.35 (13.15) £5.00 (£3.50) On-site Box Office open daily 9.30am-8.30pm from 23rd July SOL SURVIVOR ©O©© SEE MAIN BODY OF PROGRAMME FOR Venue 23 Chapl a i n cy Centre, I Bristo Square, (near Fri n ge Cl u b) FURTHER DETAILS! Tix 650 8201 (pre 7 Aug 651 1332 I0am-5pm) LI2 ★explores WORDAfrican-American PLAY Inspired culture by the voices of his ancestors, the Sol-Survivor through an journey exhilarating mix ofofdrama, poetry liiaiiiinim and musical rhythms. A powerful, celebratory in search self-respect and identity Augspiritual 9-15 16.30 (17.30) £5.00 (£3.00) 0 bizarre and incredible head trip. Venue 38 - The Gilded Balloon Theatre, 233 Cowgate. Tickets 226 2151 K12 The X-Files come to life, ★AugWORD PLAY 15-24 12.00 (13.00) £5.00 (£3.00) the ultimate adrenaline rush" Venue 36 - Gilded Balloon I , People’s Palace, Old Fishmarket Close Tickets 226 2151 KI2 Dean Mann - LB Times ★ WORD Aug 25-30 PLAY 15.45 (17.00) £5.00 (£3.00) SOUP KITCHEN THEATRE ©OOO Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 KIO ★by MEDEA Euripides’ portrayal of a woman driven to extremes of violence her sexual and passionate nature is given new life; Soup Kitchen Theatre presents a frightening look into the mind and motives of the mother who kills her children. Aug 8-16 14.30 (15.30) £4.50 (£2.50) ★ THREE-PIECE SUITE- theSoupPandora’s Kitchen Theatrehuman perform an entirely new work for the festival emotions The mysteries ofall.human love, anger, despairBoxandof rage at the futility isofopened. life are revealed to Aug 8-16 15.40 (16.40) £4.50 (£2.50) SOUTHERN LIGHT DRAMA OOQO Venue 68 - Blackball St Columba’s Church, MuirdaleTerr.Queensferry Road,Blackhall. Cl Outer OUT OF FOCUS Overbooked church hall Brownies, badminton, table slide show etc for theirbarney ‘spot’. What carry-on! party Solution? Unitetennis, forgeta pantomime! A bitall ofvying a backstage at theaaftershow when all their cum-uppence! Aug 18-23 19.30 (22.00) £5.00 104

DIAL SEAT 0131 667 7367


SPELLBOUND PRODUCTIONS ®0©@ Venue 117 -Viewforth Centre, 104 Gilmore Place Tickets 229 76S9 M6 ★ TRUCKSTOP GODDESS Atasty multimedia creation mythwithtoldan byurgejazzyto slides, sensous choregraphy and a score. Flow wakes create everything from the galaxy to 18.00 the guys hangin’ out at the Lizard Lounge. Aug 1, 13,15,19,21,23,26,28,30 Aug 8,17,9,12,14,16,18,20,22,25,27,29 19.00(19.00) (20.00)£6.00 (£4.00) SQUARE WATERMELON PRODUCTIONS ®G©© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★andOFGreat CAKES, MEN AND ANGELS They’re essential, they’re irresistible Aunt Mary lets you taste all three. Come into the intimacy ofsextheafterkitchen, where baking the issues are hot: confession, yogis, Comebread’s hungry - sconesand£5.00 served! Aug 6-30sixty... (not 17,28) 16.30 (17.20) (£4.00)

STRAY DOGS THEATRE COMPANY OO©© Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6522 H10 WHALE MUSIC Anthony Minghella’s tender, comic,todrama with an all female cast takes us through Caroline’s unplanned pregnancy the accompaniement ofWhale and newexperience. rally round, providing the support she needsMusic. duringOld thisfriends life-changing Aug Aug 10-16 18-30 17.18.0355 (19.55) (18.25) £6.00 (£4.00)

STRAY THEATRE COMPANY ®0©0 Venue 34 - The Famous Grouse House, 5 Chambers St Tickets 220 5606 K12 COLUMCILLE lain Crichton Smith’s new play celebrates the 1400th anniversary of St Columba’s death the Irish Prince turned priest whose faith challenged a nation. FeaturingCeltic Johnworld. Purser’s music which captures the sounds and of the(18.50) ancient Augmystery 8-17 17.30 £7.00 (£5.00) STRUT & FRET THEATRE COMPANY OO©© Venue 167 - Moray House Theatre, Canongate/St John’s Street Tickets 6672212 KI4 THE BEAUX’ STRATAGEM Edinburgh’s smash-hit 5-star favourites. (‘Perfect timing.... brilliantromance comic characterisation..’ Scotsman) effervescent Restoration hurtles heart-first into theandFarquhar’s sexy, saucy, swinging Sixties. Beatles,jivin’.What beehives, boutiques. Krays, Quant couture. Rockin’, rollin’, twistin’, a wonderful world! Aug 18-30 (not 24) 14. 2 0 (16.00) £6.00 (£4.00) Special Double-Bill with Cinderella £10.00 (£7.00) CINDERELLA Summertime pantomime? The 5-starfrom theatrical STAN LEY THEATRE GROUP ®Q©© ‘a★ rare, refreshing sight’ Scotsman - transformfoot-stomping, tradition rags totrailblazers riches their ground-breaking, thigh-slapping, chart-topping. Venue 47 - The Cafe Royal, 17 West Register Street Tickets 556 2549 112 with Buttons-popping, happy-ending, best-ever panto on the Fringe. Oh yes it is! ACCIDENTAL DEATH OF AN ANARCHIST bycorruption Dario Foinis I960’s a notorious (not 24) 16.10The (17.50) £6.00Stratagem (£4.00) West End Hit.theAcase sharp and hilarious satire onworker policewho, Italy.his Aug Special18-30Double-Bill with Beaux’ £10.00 (£7.00) Itdeath concerns of an anarchist railway it’s claimed,‘fell’ to from a police HQ window. THE STUDIO THEATRE COMPANY ®C©© Aug 8-30 17.15 (18.50) £5.00 (£4.00) Venue 167 - Moray House Theatre, Canongate/St John’s Street Tickets 667 2212 K14 STERNBERG THEATRE ACTORS REPERTORY ★ TIME-SHARE A triple-bill of exciting new writing presented by this year’s SOCIETY OOO© graduates from Drama Studio London: Including a frantic comedy developed a newspaper article and haunting drama inspired Venue 98 - Marcos, 55 Grove Street Tickets 228 9116 K7 from ‘An ethereal delicacy too£5.00 rarelya(£4.00) found’ Scotsman 96. by a lovesong. ■mostBLOOD WEDDING by Federico Garcia Lorca. Experience one of the Aug 8-30 19. 1 5 (20.30) innovative plays written this century, a true story ofportrayed love,powerful lust andandbetrayal. The passion and dramatic tensionbased are ondynamically SUTTON COLDFIELD COLLEGE 00©0 Aug 24-29in 16.this30stylish (18.15)production. £5.00 (£3.50) Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 LI3 ★ STRIKER! by Ian McShane is a gem of theatrical writing, excellently staged STRAIGHT UP THEATRE COMPANY OG©0 and superbly acted. It contains moments of hilarious comedy and high pathos a hugely energetic, roller-coaster of a production. Please note: Striker Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 KM incontains ★ ■ ONE OFdangerous THE BOYS Boxing hero Freddie Mills stayed loyal Ato new his Aug 16-23some21.00strong (22.00)language. £5.00 (£4.50) friends; even ones. So who fired the fatal shot? And why? play with looks(16.20) afresh at£4.50an unresolved Aug I 1-23songs, (notwhich 17) 15.20 (£3.50) real-life mystery.

STAGE 2 OOQO Venue 49 - Bedlam Theatre, I lb Bristo Place Tickets 225 9893 LI I Amasterpiece’ CHORUSSunday OF DISAPPROVAL Alan Ayckbourn’s‘serious comic Times, charts the rise and fall of Guy who just can’t say noOpera, to wine, women OR beckon... song! In a (very) amateur production of the Beggar’s fame(not and 17) infamy Aug I 1-23 12.15 (13.50) £4.50 (£3.50) THE STAND COMEDY CLUB ®0©© Venue 9 -Tron Ceilidh House, 9 Hunter Square, High St. Tickets 220 1550 KI2 RITA, SUE AND BOBTOO Directed by Mark Attwood.The original you hilarious play by Andrea Dunbar that became a hit film. Adults only.‘Makes feel deeplyTheashamed to be British’ Daily Telegraph.‘Filthy, ugly and downright depraved’ Aug 5-24 14.00Times. (15.30) £4.00 (£3.00)

WRITE YOUR OWN REVIEW on the Fringe web site http://www.edfringe.com

CREDIT CARD SALES RING 0131-226 5138 (10Et July) lines) Open 10am-6pm 9am-9pm (during (June August)

105


★Happy THEPrince HAPPY spoilt Infanta, the lovesick Student and the springPRINCE life inThe this touching of Oscar Wilde’s fairy stories. Music andtomust. magic combine withadaptation Wilde’s heart-rending words.classic Bring the kids, if you Aug 15.15 (16.15) £5.006,7,9,11,13,15,19,21,23,25,27,29 (£4.00 SUOD)(£3.00 C) SYNAESTHESIA AND THEATR IOLO GOCH OO©© TAMAR THEATRE COMPANY, WEST LEIGH OO0O Venue 47 - The Cafe Royal, 17 West Register Street Tickets 556 2549 112 Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 K13 ★ THEDedwydd MAN INJones THEmakes WELSH LUNATICdebut ASYLUM Firebrand Welsh ★trilogy ■ TRILOGY OFMelSORROW TamarClare Theatre Company,West Leigh present writer his Edinburgh with the story of a sane man a of plays by Shepherd and Barstow onTheaScotsman. sticky wicket in a sick society. Or something like that.‘endlessly inventive’ The Critic.The Condemmed Man, Looking Towards a New Horizon that and emotional abuse and their effects. Aug 12,14,16,18,20,22,24,26,28,30 13.30 (14.25) £6.00 (£4.00) Aug encapsulate 18-23 19.15mental, (20.45)physical £5.00 (£3.00) ★pieceTHEto ‘Welsh MAN INLunatic’.The THE ENGLISH LUNATIC ASYLUM A companion two markvenue Synaesthesia’s firstbring Edinburgh TEATR LUDOWY - KRAKOW, POLAND ©O0O appearances since bannedshows their in ‘94. They new Venue Square6 Aug Theatre, Square.-5pm) perspectives to thethey ideawere of theatre’ Theby13.30List. Tickets37650- George 2001 (pre 651 George 1332 10am MI2 Aug I 1,13,15,17,19,21,23,25,27,29 (14.25) £6.00 (£4.00) ■ ANTIGONE A visually stunning production froma one of Poland’s most Repertory Theatres that last year caused sensation with Macbeth. TAGUS THEATRE LISBON OO0O Aninnovative exceptional andbarriers, unconventional interpretation of the world famous classic. Venue 40 - The Quaker Meeting House, 7 Victoria Terrace. Tickets 220 6109 J11 Breaking performed Aug 8-18language 18.15(19.30) £8.50 (£7.50) in English, Polish and Ancient Greek. ★by MAGDALENA A tragi-comedy with resonances of Beckett and Pessoa a contemporary playwright English. A woman, hesitating between freedom andPortuguese survival the doorsinofaround a convent, TEATR SNOW (THEATRE OF DREAMS) ©0©0 past passions through clutterat(3.50) of objects her. conjures up her Venue Scottish International at the Quad, University Old College, South Bridge Aug 18-23 12.00 (13.00)the £5.00 Tickets192220- 5606 KI2 ★it and THEpacifies TIE Ait,man, alone in his room, talks to his tie. As he rages against ★ ■ THEjourney GARDEN World renowned PolishAcompany invoyage an epicin outdoor he confronts the dilemmas of consumerist urban society. theatrical set in stunning surroundings. fantastic a flying ship Funny, physical, thought-provoking. A world premiere in English of a new - but 8-14,17-19,21 is it the ‘ship of20.00(21.15) fools’? Dazzling£8.00visual(£6.00) exploration of humanity. Portuguese Aug Aug 18-23 play. 13.30 (14.30) £5.00 (£3.50) THEATERTENTEN OOO© TALL STORIES ©O©© |Sf LI I Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 |SEj| Venue 49 - Bedlam Theatre, I lb Bristo Place Tickets 225 9893 ★ APHRA BEHN & NELL GWYN I7TH CENTURY CAREER ★theALICE AND MR DODGSON A funny and moving play, adapted from GIRLS Bawdy, lively, humorous! 2 of history’s most fascinating women. best-loved dialogues the ‘Alice’backbooks. Mr Dodgson Carroll) Relish an evening captivated by their charms.‘A Thousand Merry Conceits’ takes the join real Alice, now ingrown-up, to White Rabbit and(Lewis Wonderland. Will 8,10,12,14,16,18,20,22,24,26,28,30 you the dance? Aug 15. 1 5 (16.15) Aug 25-30 22.10 (23.55) £6.00 (£5.00) £5.00 (£4.00 SUOD)(£3.00 C)

BOUND &GAggED presents Julian Clarij mith barbs The Independent Sell Out'94'95'96 Pleasance [33] 10.30pm August 7-30 [notll.18.28] Tichets ®hc Znil0131Ctr556Ugrai6550 Bh B

106

QVfe

written & directed, by Pat Condell performed by Andy Linden Barry’s progress from idle sexist pig to helpful sexist pig; a story of darts, deceit and fried-egg sandwiches. GILDED BALLOON 8 - 30 AugUSt 0131 226 2151 at 7.45pm (Except 13 & 28) Preview 8 Aug-i


THCATRC L THEATRE DE SIMPLICITE OOO© Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I THE ISLAND Thesurreal, discovery of two existence male castaways on a remotefemale tropical island disturbs the yet tranquil of its‘new-age’ inhabitants. James Saunders’ ‘male chauvinist comedy’convincing’ is revived Theby all-Scotsman. female company.‘Individually Aug 25-30 12.45 (14.15) £5.00marvellous...uniformly (£4.00) THEATRE OF ETERNAL VALUES OO©© Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I ★treatment. ■ THEThe IMAGINARY INVALID Moliere’s play gets a sparkling new tonic prescribed by the multi-cultural Theatre of Eternal Values isinnocence an exhilarating mix of classical vaudeville comedy, in which the theatre day.£6.00 and Aug 18-30and(nottrue24)love18.1win5 (20.15) (£5.00) THEATRE TRANSFORMATIONS OOOO Venue 62 - Continental Shifts at St Bride’s, 10 Orwell Terr Tickets 346 1405 K5 ★some■ C’EST LA VIE! Cest La Vie follows the roads taken by seven characters routesthechosen, others imposed.AAlively collage of experiences both comic and tragic: realities of existence. combination of full face expressive mask,I music, text.(£3.00) Aug 1-16 19.movement 45 (21.00)and£5.00 THEATRE WEST OOOO Venue 41 - Hil Street Theatre, 19 Hil Street. Tickets 226 6S22 HIO ★ HOLDING HANDS WITH ANGELS Theatrea tense, Westbitterly kick in the doors and come in like an explosion.This new play takes comic look atSeeevents leading to an execution. A riveting drama of barely contained ferocity. Augit.10-16 00.30 (01.20) £5.00 (£4.00)

"Always head spinningly funny" NM "Stand up mind games with the darker recesses of our imagination" Guardian Guide mxmmmm mlSmm

August 6th - 30th at 8.00pm (Except 12th & 26th) PLEASANCE Box Office: 0131 556 6550

presents an outstanding programme of international theatre 1 2 Look Out 4 Aurora Repertory Theatre (USA) Backstage Theatre Breakwith Productions Company Theatre Daedalus Theatre Firefly Productions (USA) First Amongst Sequels Fox Youth Theatre Grin Reaper HDG Productions Keyhole Theatre Kismet Limb Theatre Pounds Dollars & Cents red eye productions Sarah McDougall (NZ) Shoestring Players (USA) Soup Kitchen Theatre Studio Theatre (Germany) The Fabulous Fourmel'dytiides (USA) West End Theatre 107


THEATRUM BOTANICUM - THEATER OF PLANTES ®o©@ Venue 193 - Royal Botanic Garden, Entrance West Gate, Arboretum Place Dl I ★Devour ■ LIVINGSTONE QUEST FOR THE SOURCE OF THE NILE cult secrets of Gulewamkulu, terrifying masked dancers of Malawi. Livingstone’s questhistory for commerce, Christianity and thethrough sourcetheofmusic the THEATRE WORKSHOP ©O©© Witness Nile.myths Discover Scotland’s in ancient Egypt and Africa of its people. Venue 20 - Theatre Workshop, 34 Hamilton Place. Tickets 226 5425 F9 and The passion, colour Theatre. and magicTheof best Nicaraguan Carnival.The returntheof world Poland’s- Aug 8-24 (not 17) 20.30(22.00) £9.00 (£5.00) powerful Wierszalin new theatre from around New York, Managua, Warsaw, London, Liverpool, Inverness and Kirkcaldy. THINKTWICETHEATRE COMPANY 00©0 All day cafe/bar. Come and join the festival! Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 DESIRES AND DREAMS THE GOLDHAY GROUP What is your desire? ★ STAGES Pretence is abandoned as two men, unable to communicate Actors with learning disabilities display bitter sweet honesty that will make you a script, funny face upandtohard-hitting Leukaemia and their finalwhether weeks together. laugh andsomecrycome Fromtrue the lottery to relationships, they explore a world of desires without David Howard’s newreplay play questions all the where but£4.50 others remain dreams. world really is18.30 a stage. Aug 11-16 10.30 (11.30) (£2.50) Aug 18-23 (19.35) £5.00 (£4.00) CLEO NYEUSI, Liverpool’s first professional company Henry,Teeloves and bestCleo.friend Shamwoman are allblack inpresses love with In fact everyone THIRD STAGE PRODUCTIONS ®0©© Cleo,Cleo’s except A young the Cleo. self destruct button, never Venue 3 - Assembly Rooms, 54 George Street. Tickets 226 2428 III asking for compassion or pity. Aug 18-24 10.15 (11.35) £4.50 (£2.50) ★ WASPandBYfilmSTEVE MARTIN Thereaches unique the writing talent of international comedy star STEVE MARTIN UK stage for first time ★ RATS IN byTHEBinaTUNNEL LOWER LEVELS OF SOCIETY written inBITTER-SWEET..VERY this play set around ‘theFUNNYThe perfect nuclear family’ in I950’s America.‘SURREAL, and examining violent-Levels and ofdisturbing Beat, Sydney. plightdirected of twoEnterprises. homelessSharif. menAindark Newcomedy York. Presented bytheLower Society Aug 8-14,17,18,20,21,25-30 15. 1 5 (16.25) and Kevin Aug 15,16,22-24 15.15 (16.25) £9.00 (£8.00)£8.00 (£7.00) Aug 11-25 (not 17) 12.00 (13.35) £6.00 (£3.50) ★ FECUNDGLASGOW THEATRE’S1968-1996,27Years 27 By John Keates.Old.A PREMIERE. Commission: THOSE THEATRE PEOPLE OOO© TRAMWAY, personal retrospective, J13 fecund The impact with which the flying saucers arrive in Independence Day’ Venue 45 - Old St Paul’s Church & Hall, Jeffrey Street Tickets 556 0476 What’s On. fecund. Progressive. Challenging.Vital.‘must be seen’ Guardian MATILDA LIAR! Parents on a bender. Brother round the bend, Sister on her Aug 11-25 (not 17) 15.45 (17.00) £6.00 (£4.00) mobile, Matilda just pretends.Those Theatre People seduce the truth with Debbie Isitt’sgreat comic cautionary tale: Fish tanks, fairy tales, little white lies ★ ■ DIRIAMBA! theatre NIXTAYOLEROS /THEATRE WORKSHOP WorldHumorous Premiere. and Hispanic/American collidesandwith Hawick’s Common Riding. Augbloody 25-30 12.30 myths! (13.40) £5.00 (£3.00) exploration of patriarchy, power cultural resistance in a carnival collaboration between Theatretheatre Workshop and Nixtayoleros. Dance, music, stories, street and Nicaraguan traditional masks. TOMEE THEATRE OO©© Aug 8-25 (not 10,17) 17.30 (18.30) £6.50 (£3.00) Venue 40 - The Quaker Meeting House, 7 Victoria Terrace. Tickets 220 6109 J11 NAKED WEDDING FOURSIGHT THEATRE COMPANY A striptease ★ ■ last A STORY WITH ANyoungENDING From thetheirbook‘Elegy’ by Michalakea. of ourheart hiddento cream agendas.cheese. A taleAnof true love of‘he’ in the and‘she’ nineties, guaranteed to turn The moments of two women before execution.The play is a your unveiling on their way hymn toPanoutsou. life, love, friendship and faith. A solo performance from Greek actress toAugbecoming Maria 8-23 (nota ‘we’. 10,17) 19.15 (20.15) £7.50 (£6.00) Free 25-30 Preview Aug(13.30) 20 10.30£5.00(12.00) Aug 12.00 (£3.00) ★ SHADOW BOXING INbetween COMPANY One ofboxing Scotland’s most exciting theatre companies. Moving two worlds, and nightclubs, the play explores the journey from youth to manhood. Joy, sadness, winning, losing, right THE TOTALLY PORTABLE THEATRE COMPANYoo©o and to choose time(£4.00) comes! Augwrong... 8-25 (notwhat10,17) 22.45 when (23.55)the£7.00 Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 UNREAL ESTATE INVISIBLE BOUNCERS Theatre collides with ceilidh headGOODNIGHT DESDEMONA (GOOD MORNINGplayJULIET) UK hottest on.The island of Ruist is up for sale and I997’s Guinness Pub Theatre Award premiere & FREE post-show BEER!! The award-winning by Canada’s winners make a fullcafe/bar). bodied plea for Scotland’s soil as the islanders bid for our new writer! Constance Ledbelly is magically transported into two Shakespeare inheritance tragedies, wrecking theiradventure. plots, in Ann-Marie MacDonald’s hilarious Aug 21-25 (in21.30the(22.30) Free and Augbeautifully 10-23 15.written 15 (17.15) £6.50 (£5.00 SUOD) (£4.50 C) ■GetDIRIAMBA! NICARAGUAN CARNIVAL AND WORKSHOPS the beat for the Diriamba! Street carnival (Aug 24). Nicaragua’s leading community theatreIf company workshops THE TOURING COMPANY ®0©© (2 sessions daily). you have anNixtayoleros instrumentwillbringleadit music along. and Phonedance for details. Venue 30 -The NetherbowTheatre, 43 High Street Tickets 556 9579 JI3 Workshops 1-22 (not Carnival AugAug24 I 14.00 (17.30)17) ★ MACBETHdefamation SPEAKSofThehis infamous Scottish King rejectssurprising master story. Shakespeare’s character and tells his own 1994 Fringe First Winners , play For Anby John EnglishCargill Education, return to The Netherbow with Aug another 7-30 (notwitty, Suns)moving 14.00(15.10) £6.00 (£4.00)Thompson. A Bit of Rough Theatre Company presents

UNPINE Currently shortlisted by the BBC. Southside (Venue 82) 6th-30th August at 10:30pm Box Office 0131 667 2212 108


guy masterson & tasman ray present

THCATRC

written and performed by tim

From 8 August For 22 Performances

“glorious extraordinarily funny!’ Wellington Post “a roaring success firing on all cylinders’ NZ Dominion ASSEMBLY ROOMS 0131 226 2428

STELLA ARTOIS From 8 August ASSEMBLY ROOMS FOR 22 PERFORMANCES 0131 226 2428 AT 3.15PM

TRAVERSE THEATRE (DO©© Venue 15 - Traverse Theatre, Cambridge Street, off Lothian Road Tickets 228 1404. J9 Set your theatrical pulse racing an explosive mix of Scottish and international new work.‘the place to be... one of the most important theatres in Britaingood food,forgood Call now yourbeer.’ FREEObserver brochure.‘Where should you turn but the Traverse?’ Times ★psychological ANNA WEISS TRAVERSE (Worldof‘False Premiere)Memory ThrillingSyndrome’. drama exploring theTHEATRE repercussions ByPreviews Mike Cullen. Directed by Vicky Featherstone. Aug(20.30) 6 19.00£ 10.00 (20.30)(£6.00) Aug 7 14.00 (15.30) £6.00 Aug 812,1619.00 Aug 19.30 (21.00) Aug15 13,17,22,27 Aug 14 13.15(14.45) Aug 15. 45 (17.15)11.00 Aug (12.30) 19,23,28 14.30 (16.00) Aug 20,24,29 17.00 (18.30) Aug 21,26,30 20.30 (22.00) KNIVES INofHENS THEATRE‘Cancel all engagements’ for this taleAug love andTRAVERSE language.‘Astonishing.’ Guord/on.‘Sensual’ TimeIndependent Out. Previews 3 20.00 (21.15) Aug 5 19.00 (20.15) £6.00 Aug 7 19.00 (20.15) £ 10.00 (£6.00) Aug 8 14.00 (15.15) Aug 12,16,21,26,30 14. 3 0 (15.45) Aug (18.15) Aug 14 19.30 20.30 (20.45)(18.15) Aug 13,17,22,27 15,20,24,29 17.11.0000 (12.15) Aug 19,23,28 THE SUICIDE (Scotland) Hilarious, through the life andCOMMUNICADO adventures of a little man with heroic death-defying potential romp (posthumously)! Aug 12,16,21,26,30 11.00 (13.40) Aug 13,17 13.15(15.55) Aug 1419,23,28 15.45 (18.25) Aug ISAug18.20,24,29 15 (20.55)19.30 (22.10) £10.00 (£6.00) Aug 17.00 (19.40) Aug 22,27 13.30 (16.10) ★ CELLE-LA THEATRE (World Premiere) The(Scotland) blood-redpresents story ofa three Award-winning CRYPTIC hauntingindividuals. and emotional text(21.15) accompanied by live music. Aug 9 20.00 £ 10.00 (£6.00) Aug 12,16 17.00(18.15) Aug 13,17 19.30 (20.45) Aug Aug 1415 11.00(12.15) 13.30 (14.45) ★ JOHN HEGLEY (WorldmythsPremiere) Verse, sung, recited and Little improvised. Some moving. Sack-racing and meths-drinkers, no maths. French. ‘Peculiarly funny’ Herald Aug 8-17 22.00 (23.10) £9.00 (£6.00) Aug 19-24 23.00 (00.10) ★ BLUE HEART (World Premiere) OUT OF JOINT (UK), with the Royal Court.Two disruptive and Aug surprising by Caryl£6.00 Churchill. Previews Augfunny, 19 (13.15) 11.00 (13.15) 20 13.30plays(15.45) Aug 23,28 11.00 £ 10.00 (£6.00) Aug 24,29 13.3017.00(15.45) Aug (19.15) Aug 21,26,30 22,27 19.30 (21.45) ■string THEplayers GOGMAGOGS GIGAGAIN (UK) This group of acclaimed young combine physical Directed/choreographed Lucydaring Bailey.with musical brilliance. Aug 26-30 23.00 (00.10) by£8.00 (£6.00) ★ ■ THE inventive... CORRIDOR (World Premiere) BENCHTOURS (Scotland)point. ‘stunningly ground-breaking’ Guardian. Life at the cracking ‘Lies masquerade as truth and vice-versa’ (Borges). Aug 7,12,16 11.45 (12.55) £8.00 (£5.00) Aug 8,13,1716.414.15(15.25) Aug Aug 9,14 10,15 19.515(17.55) (20.25) ★STARVING EARTHQUAKE WEATHER (World Premiere)ofFringe Firstdanger Winners ARTISTS (USA/Scotland) An exploration love and inAuga seismic new play by Godfrey Hamilton. (15.45) £8.00 (£5.00) Aug 7,12,16,19,23,28 8,13,17,20,24,2919.114.16.5 (20.45) 4155 (18.15) Aug Aug 9,14,21,26,30 10,15,22,27 11.45 (13.15) ★ HELLCAB (UK Premiere) TAMARIND Grittyandcomedy about anpassengers. anonymous cabbie driving the meanTHEATRE streets of(USA) Chicago, his strange array of Aug 7,12,16,19,23,28 16.19.4155 (18.00) £8.00 (£5.00) Aug 8,13,17,20,24,29 (20.30) Aug (13.00) Aug 9,14,21,26,30 10,15,22,27 14.11.1545(15.30) ★RoyalTHECourt.’ CUBA(World Stephanie McKnight.JFK ‘an itinerant woman...Premiere) raspberrybyice-cream... an intruder... and(UK)a runaway skateboard. Aug 7,12,16 19. 1 5 (20.45) £8.00 (£5.00) Aug 8,13,1714.15(15.45) 11.45(13.15) Aug Aug 9,14 10,15 16.45(18.15) TRAVERSE THEATRE continues over the page 109


Avalon Promotions Presents

A NEW PLAY ABOUT LOVE, DEATH AND ARCHAEOLOGY “Witty, tense and ^ whollyTheenthralling Herald

TRAVERSE THEATRE continued ★ DISCO PIGS (UKPigPremiere) CORCADORCA (Ireland) WinnerSunday of Dublin Festival go wild in Pork Sity.‘Astonishing’ Times Aug 7-30Fringe 21.451996. (22.50) and £8.00Runt(£5.00) ★(Scotland) THE HANGING TREE (World Premiere) LOOKOUT THEATRE A town thedancing. edge. A hero on the brink. Sinister comedy about revenge and19.1online Aug 19,23,28 5 (20.45) Aug 20,24,29 14.11.1455 (15.45) (13.15) £8.00 (£5.00) Aug Aug 21,26,30 22,27 16.45 (18.15) THE DESIGNATED THEATREFestival (Canada) Leading contemporary companyMOURNER with Wallace TARRAGON Shawn’s play featuring ‘96 awardwinner Clare Coulter. Aug 19,23,28 14.11.1455 (15.55) (13.25) £8.00 (£5.00) Aug 20,24,29 Aug 45 (18.25) Aug 21,26,30 22,27 19.116.5 (20.55) TRESTLE THEATRE COMPANY ®0©@ Venue 33 - Pleasance, 60The Pleasance. Tickets 556 6550 LI4 ★in an■ Amsterdam FOOL HOUSE Number 67 Doverstaat seems an everyday house street. Hapless tenants fall in love, out of windows and through comedy, mask work, original soundtrack and a tall, thin housefloors. withA7,8steep stairs.combining Previews Aug 15.15(16.55) £4.50 Aug 1, 13,14,17,18,20,21,25,27-30 15.15 (16.55) £7.00 (£5.00) Aug 9-115,16,22-24 15.15 (16.55) £8.00 (£6.00) 20TOTHEATRE OOO© Venue 49 - Bedlam Theatre, 11 b Bristo Place Tickets 225 9893 LI I MISS JULIE Fusing bold emotional performances with imaginative staging, 20toTheatre radically revamp Strindberg’s sexual tale of social decline. ‘20toTheatre innovationgripping and tradition allowing the ascent classics toand treat’ Thebalance Augbreathe...a 25-30 12.real15 (13.45) £5.00List.(£4.00) THE UGLY DUCKLING THEATRE COMPANY OOO© Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ★ THEandCAGEBIRDS Six women inGuzzle,Twittering a world of their and own:Thump trappedquestion in their tutus confined in a cage. Gossip, their shelteredtragic existence expose the denial of basic human rights in this hilarious play. and Aug 24-30but 12.30 (13.45) £5.00 (£4.00) THE UNDERGROUND THEATRE COMPANY LTD. oooo Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 K11 ★passion, TO BEcruelty, REMEMBERED Have you ever really wanted someone? Obsession, love. A poetic twentieth century Wuthering Heights. RADA studentscompanies - female writer. Recent ReviewStudent. ‘promises to be one of the best young theatre in London’London Aug 11-16 19.00 (19.40) £4.00 (£3.00) Go see it. THE UNSEAM’D SHAKESEARE COMPANY OOQO Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 KI3 ★ John THEFord’s BROKEN HEART Lust, crimes of passion and endurance loom large inthe startling tragedy.The U.S. Pittsburgh-based troupe complements poetic beauty with stunning imagery and raw acting, typical of their daring approach lost classics. Aug I 1-23to(not 17) 23.15 (00.55) £5.50 (£3.50)

year’s iy&,

s f Mattered inclacreen

G

The Pit 1 LAST V i: A K ' S EDINBURGH PUNK S NOT DEAD’ August 6th - 30th SUPPORTED BY at 3.30pm (Except 12th & 26th) COMEDY PLEASANCE CHANNEL Box Office: New BritisnihgComedy ht at 11pm 0131further 556 information 6550 call Everthey week For (Calls cost 50p per minute at all times)Richard Herring hotline on 0891 887766 110

Marco's (Venue 98), 51 Grove Street August 17th - 23rd 10.30pm Box Office 228 9116 http://www.ukfirenet.co.uk/shattered/


VALVONA & CROLLA (DO©© Venue 67 - Valvona & Crolla, 19 Elm Row, top of Leith Walk. Tickets 5S6 6066 GIS ★ SURELY YOU’RE JOKING MR Feynman, FEYNMAN - ADVENTURES OF A CURIOUS CHARACTER Richard Nobel prize-winning physicist and bongo-player via thestories, Courtdrummming, of Sweden to Tuva orphysics bust! with Mike- from Maran,Copacabana Rick Bamford, &- laughter. Aug 8,9,11-16,18-23,30 18.00 (19.10) £6.00 (£4.00) Aug 16 13.00(14.10) ■Simon CHRIST STOPPED ATContini. EBOLIDirect by Carlo Levi, with Maran, Dick Lee, Thoumire and Philip TheMorning HongMike Kong ‘A wholly charming, evocative, literary musical’ SouthfromChina Post toFringe Edinburgh ‘AAug delightful experience’ The Scotsman. 8,9,11-15,18-23,30 13.00 (14.10) £6.00 (£4.00) ★ THE VANDEGRIFTER byFanny JamesVandegrift Bowman.Stevenson, Robert Louis Stevenson his American wife, asone-woman a dark woman, adescribed peasant soul, a violent friend. Gill Bowman is Fanny in a musical show8,9,11,12,18-23,25-29 set in 19th century Samoa. Aug 20.00 (21.10) £6.00 (£4.00) Aug 25,26 18.00 (19.10) Aug 30 15.00 (16.10) VENUE 13 (DO©© Venue 13 - Harry Younger Hall, Lochend Close, Canongate J15 ■is itsMARRIAGE OF CONVENIENCE by Ian Rowlands.Theatr y Byd.Wales language and the language is Wales. Wales’s more complicated than that! Atheatrical tour de force by a leading Welsh writer at the vanguard of the Welsh Aug 8-23 renaissance. 12.15 (13.30) £5.00 (£4.00) ■celebratory ELEEMOSYNARY by American playwright Lee language Blessing. A warm and confronting the possiblities ofbeboth ‘We(and havecurse) thisplayexpectation about ourselves.To extraordinary’andisfamily. the rallying cry of the Westbrook women. Aug 8-30 14.15 (15.30) £5.00 (£4.00) ■ FAUSTmotion FLAMBE! 6 do theFaustsoul,in 66I to(minutes).Take 6 performers in★ perpetual take lose it) set cooker for 66 minutes and man(5 tosweat. Augwatch 8-30 the 16.20big(17.30) £5.00Cover (£4.00)with spirit and light - Flambe! ★ ■ river... HOPSCOTCH Ugly Productions presents Hopscotch byterrible, Ken Edmonds. ‘The crushing... suffocating.* Betha isreporter mute, hersearches story too but it must be told. Her mother frets, out the truth... and who is Beth’s sinister new friend Joe? Aug 10-16 18. 0 5 (19.00) £4.00 (£3.00) Double Bill with The Yankee Doodle Dandies (on the same night) £5.00 (£4.00) ★ moving ■ LIVESstoryWORTH LIVING UglythatProductions presents‘Lives Worth Living’. AThis with gentle humour tellspressures of frustration, guilt and joy.where piece shows the internal and external placed on a family one member18.has05 learning Aug (19.00) difficulties. £4.00With(£3.00) Double17-23Bill with Wrestling Demons (on the same night) £6.00 (£5.00) ★‘The■ Yankee THEYANKEE DOODLE DANDIES Ugly Productions presents Doodle Dandies’ by Martin J Morgan.‘He’ll House’. Two assasins, atolobyist andthefourfabric million dollars innever bloodmake money.the White AAug conspiracy is about unravel of America. 19.05 Hopscotch (20.00) £4.00(on(£3.00) Double10-16Bill with the same night) £5.00 (£4.00) ★God■ inWRESTLING WITH DEMONS by Martin Smith. Does Danny want his life or Jez in his pants? Ugly full of17-23 spunk 19.- which may leave a(£3.00) bitter productions taste. presents a powerful play Aug 0 5 (20.00) £4.00 Double Bill with Lives Worth Living (on the same night) £6.00 (£5.00)

Voices of the South present Featuring the literature Eudora Weltywith andof Joan Williams William Faulkner 9-29 August (not 12,14, 16, 18,20-22) at

THEATRE ★ ■ THE CASE OF INMATE DR JECKYLL AND MR HYDEASYLUM AS TO STRANGE BY AN ATOLD newStageplay byCARL MarkJUNG Ryan, Equinox Theatre,‘NowOFthisBROADMOOR is what Fringe is all about’ The 1996. Aug 8-16 20.15 (21.30) £5.00 (£4.00) ■(Associate SMALLDirector, CHANGE Funny,Theatre) hauntinglooks and touching, PetersideGill National at familyofthis lifetwoonplaymothers thebyeast ofsons. Cardiff through the lives and childhood memories and their Aug ‘Passionate 18-23 20.20and21.30evocative’. £5.00 (£4.00) ★ ■ 50 WAYS TO KILL YOUR byLOVER - Maverickleading Cymru.The latest outstanding innovative production onecouldn’t ofWales’ newboyscompanies. ‘I’d18-Club She’s the premier league I walk past the telling them ‘ £4.00 (£3.00) Augonly7-23kissed 21.45her.(22.15) VENUE 123 OO©© Venue 123 - South Bridge Resource Centre, Infirmary Street Tickets 558 9991 KI3 DEATH AND THE MAIDEN 1991 Olivier Award winner. Paulina kidnaps the doctor who brutalized her during the old dictatorship...but will her politically ambitious husband ofthwart her only drama11-23 exposes the savagery unlimited power.chance for justice? This terrifying Aug £5.00 Age (£4.00) Double bill(not with 17)Don13.40 Juan(15.20) Hits Middle £8.00 ★ GONE FISSION Stalwart boy detectives Franknuclear and Dinkanchovies. Hardly face the evil Dr Doom in a race to save the world from Hilarious, breakneck, Monty Pythonesque romp; an ‘Offbeat comedic casserole that good name!’ Valley Advocate Aug gives 18-22experimental 17.00 (17.50)theatre £5.00 a(£3.00) ★ LIFEa RUSSIAN WITH IDIOTS ART-VIC Russian Theatre). Would you like to meet BEAUTY, Beckett’sLIFE(Anglo GODOT, Erofeev’s IDIOT, lost RUSSIANDon’tSOUL? Experience WITH IDIOTS every weekevenwithChekhov’s its alternating. be afraid it’s only Theatre! Aug 11-30 (not Suns) 18.00(19.00) £6.00 (£5.00) Aug Double11-30bill(not £10.00Suns) (£8.00)19.10 (20.00) £6.00 (£5.00) Alternate show ★reached DONmiddle JUANage!HITS MIDDLE AGE!oneDonmanJuanplayis reflects in a different hell, he’s amusing new life and11-23 adventures: aThis new15.30 version with£5.00 a novel(£4.00) twist in the tale.upon Don Juan’s Aug (not Suns) (16.45) Double bill with Death & The Maiden £8.00 ★ THREEWEEKS FRINGE Ten special showcasing the finest new worksareSHOWCASE onchosen the fringe by theperformances ThreeWeeks’ reviewing team. Performances byandtheirchosen outstanding scripts, performances, and production to celebrate encourage newnew writing. Advance reservations recommended. Aug 27,29 12,14,19,21,23,26,28,30 Aug 19.00 (20.50) 17.00 (18.50) £6.00 (£4.00) VOICES OF THE SOUTH & THEATRE WHATSIT©O©© Venue cy Centre, (near Fringe Club) Tickets23650- Chapl 8201ain(pre 7 AugI 651Bristo1332Square, I0am-5pm) LI2 ★ BEGINNINGS - FROM VOICESandOFsouthern THE SOUTH Back ondynamic the Fringe. Voices explores writing, relationships childhood. This duo brings to Eudora life the Welty’s meetingslifelong of William and Joan Williams and delightfully recounts ofFaulkner words.Voices Aug 9-11,13,15,17,19,23-29 12.love 15 (13.40) £4.00 (£2.50)is ‘electric’ Scotsman 96. Venue Chaplaincy Centre 1 Bristo Square Box Office (0131) 650 8201 £4.00 (£2.50) Venue

Theatre Whatsit, Youth Collective present

A New American Musical! 12-22 August (not 13. 15, 17. 19) at 12.15 (1.45)


RAISED ON SONGS & STORIES Tales from past & possible futures; dark happyMcPherson endings allcarry brought you onthethe of angels. Davidtruths Jamesand& Russ the totraditional torchtongues of wholesome family entertainment. Aug I 1,12,14,15 15.15(16.10) £2.00 (£1.00) ★ PLACE -- HOME! TIME - UNKNOWN is confused. He Why knowsare all he isbroken? but when is another matter! Did Steve he really killor hismuch, wife? VOLCANO THEATRE ©O©© where the glasses An everyday story of advertising folk, much more? Venue 33 - Pleasance,60The Pleasance.Tickets 556 6550 LI4 Aug I 1, 12,14,15 17.50 (18.45) £2.50 (£2.00) ■T.TTHE TOWN THAT WENT MAD Where Under Milk Wood finished, .T.W.Mdigs. begins.Visually stunning physically inventive, andtheverybawdiest funny; WHITE RABBIT COWBOYS OO©© Volcano upyou’ll the green, green grass of home... Venue 150 - The City Cafe, 19 Blair Street. Tickets 229 5600 K12 performances ever(00.15) see.‘Exceptional theatre’oneTheofGuardian. Preview Aug 9 23.00 £5.00 ★ LUSH Sophie has a hair of the dog whilst awaiting the return of Radio Firth Aug 1 1, 13,14,17-20,25,27-30 23.00(£6.00) (00.15) £7.50 (£5.00) DJ Phil.happening They haveandproblems. rise in thisis gin-soaked Aug 10,15,16,22-24 23.00 (00.15) £8.50 ‘Hip, decidedlyWatch funky’tensions /ndependent,‘Life transformedcomedy. into hilarious theatre’ Scotsman. Aug I 1-28 (not Suns) 20.00 (21.15) £5.00 (£4.00) SANDY WALSH OO©© Venue 33 - Pleasance, 60The Pleasance.Tickets 556 6550 LI4 WIERSZALIN 00©0 ★an DANCING IN SHADOWS Fringe First winner Sandy Walsh returns with Venue 20 - Theatre Workshop, 34 Hamilton Place. Tickets 226 5425 F9 evocative glimpse of the 1930s. Combining real memories, songs and radio voices tochallenging portray this turbulent between decade, this wry and poignant production ■ DYBBUK by Szolomej An-sky presented in English by double Fringe First makes comparisons that era and ours. Winners (Roll-a-Pea, Merlin). Eerie classic Jewish tale about love beyond death. Aug (13.45) £5.50 (£4.50) Superblymusic, performed withchoral a masterful blend of hauntingtheatricality. imagery, beautiful live Aug 10,11,13,14,17,19-21,27-30 15,16,22-25 12.30 (13.45) £6.0012.30(£5.00) Jewish incredible singing and outstanding Aug I 1-23 21.15 (22.30) £8.00 (£6.00) WAXEN PATIENCE THEATRE ©O©© Double Bill (with Doctor Felix) Aug 11-13,18-20 £9.00 (£7.00) DOCTORstory-telling, FELIX performed in English.andA visually mixture folk Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 of★ ■spell-binding, charming strikingboystunning simplicity. ★ HYSTERIC STUDS Fromaspirations the writerandof sperm smash-hit‘Saucy Jack & theGARDE!’ Space fable in thehelped exquisite Wierszalin style. Anmusic impoverished becomesA amoral great Vixens’ comes the fame, pain, donations of‘EN physician by Death his Godmother. boya testosterone band supreme.dream Drag- queens, fishermen and performance artists transform Aug 11-23 (not 17) 14.00 (15.00) £7.00 (£4.00) to-Aug leather-clad and adored. Brace yourselves...! Double Bill (with Dybbuk) Aug 11-13,18-20 £9.00 (£7.00) 6-30 (not 14,28) 22.30 (23.30) £5.00 (£4.00) WITH WINGS & NEMESIS THEATRE COMPANIES THE WEIRD SISTERS ©O©© OO©© Venue 36 - Gilded Balloon I , People’s Palace, Old Fishmarket Close Tickets 226 2151 K12 Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I ★fast-paced IT’S UNCANNY! Innocent females and amoral witches collide in vibrant, ★ OBLIVIOUS Techno, jungle, drum ‘n’ bass, pumping beats driving two lovers tale of friendship, sexuality and evil demons. Great music, exuberant through a drugged up world they’ve of clubs,gotlovetheandlot.sex. Speed, acid, ecstacy, humour, endless invention.highly ‘A must for anyone interested in intelligent, mushrooms and each emotionally-charged physical theatre’ Aug 18-30 (not 24) other, 14.50 (16.00) £5.00 (£3.00)What more could they need? Aug 8-30 (not 12,26)and12.00 (13.15) £6.00 (£5.00)Arts Talk. THE WORKS THEATRE COMPANY ©OO© PHILIP WELLS 00©0 Venue 81 - The Garage Theatre, Grindlay Court Centre, Grindlay St Tickets 228 2215 K9 Venue 28 - Greyfriars Kirk House, Candlemaker Row Tickets 225 3626 Kl I THREADS OF LIFE April 1937,Wallace Carothers, inventor of nylon found ★withTHE FIRE POET Performance poet Philip Wells fireworks imaginations in a hotel room.This movingdrove solo performance life, inspired, dramatic poems featuring vigilantes, dead affairs and the despair him to take hischarts life. Carothers First performed dragons, nipples, gorillas,entertainment.Twenty tapeworms, beervision’ and eight babbling.‘Full of surprises, atlove Science Museum, London.which life and art’ Ted Hughes;' A true bard of Piccadilly Poets. Aug 8,9,25-30 15.00(16.00) £4.00 (£3.50) Aug 11-23 (not 17) 20.10 (21.10) £4.00 (£3.00) THE WOTJACALLEM PLAYERS 00©0 WEST END THEATRE COMPANY 00©0 Venue 98 - Marcos, 55 Grove Street. Tickets 228 9116 K7 Venue 21 - Roman Eagle Lodge, 2 Johnston Terrace. Tickets 225 7226 KIO ★ ■ TERRY PRATCHETT’S WITCHES ABROAD Ever beenanda don’t AN EVENING WITH GARY LINEKER The comedy is fever pitch as Bi l godmother? A real fairy godmother? Trouble is, they come in two’s and marriage crumbles.They over,Gary but itsLineker? a game of two always agree... puppetry, pyrotechnics, dwarves, witches, cats, frogs and vampire halvesMonica’s - should20.15 Monica loverthink Danitsorallhero bats do17-23battle14.00(16.00) with headology, Aug 18-23 (21.50)score £5.50with(£4.00) Aug £6.00voodoo (£5.00) and mirrors. Lawks! (Bugger??) THE WEYVALLEYTHEATRE COMPANY OOOO YES & NO THEATRE CO ®OOQ Venue 58 - Royal Mile Primary School, Canongate Tickets 0831 153545 / 0860 456195 J15 Venue 16 - Southside Courtyard, Davie St. Tickets 667 2212 LI3 ★Death BALLAD OF ATIN MAN Wrecks & Wreckers,Tin STinners, ★ CHRISTMAS IN JULY One’s for sorrow, two’s for joy, three’s too many & Disaster. All in a days work for a Cornishman who finds his craft for any boy. If love is a box of chocolates, why does lust always get stuck is not11,12,14,15 enough. Can 16.30 he go(17.30) against£2.50 all he(£2.00) believes? Will his gamble pay? in your8-16throat? in July - £6.00 a fast,(£5.00) funny, feelgood comedy. Aug Aug (not Christmas 10) 19.15 (20.20) Si

112


YOUTH INTERNATIONAL AT ST OSWALD’S ®0@© Venue Info/Tix128346- Yout 1405h International or 229 5562at St Oswald’s, Montpelier Park N6 Having excelled inand ‘96,Youth International returns withtheaward-winning, innovative theatre dance from Scotland, England, USA and Latvia proving young people have an exciting and dynamic contribution tooncemakeagainto that the arts. YOUTH THEATRE - LATVIA OOO© Venue Info/Tix128346- Yout 1405h International or 229 5562at St Oswald’s, Montpelier Park N6 SWAN LAKE - THE BALLET OF CLOWNS These taleselements ofof★ ■ballet, imagination, based on music by Tchaikovsky, making fun with the pantomime, opera andDreaming. commedia del’Arte,forarealltelling the Art of£5.00 Fascinating ages. about Augmysterious, 25-30 17.30magic (18.30) (£4.00 SDC) Y TOURING THEATRE COMPANY OO0© Venue 41 - Hil Street Theatre, 19 Hil Street Tickets 226 6522 H10 ★singer CRACKED Mickey Mitch, the Bedlam Runners charismatic troubled lead is missing, possibly adead... nobody knows. Two monthsbeenlaterrighta schoolgirl ofheard17 goes missing.‘She’s hugesays.fan of Mickey’s, she hasn’t since she the news’, her mother Aug 19-30 (not 24) 10.00 (11.15) £3.00 (£1.00)

WRITE YOUR OWN REVIEW onhttp://www.edfringe.com the Fringe web site

THCATRC ZTHEATRE COMPANY ®0©0 Venue 19 - C, Over-Seas House, 100 Princes Street. Tickets 225 5105 110 ■Lorca. BLOOD WEDDING -‘BODAS DEHughes’ SANGRE’ bytranslation Federico Garcia Passion, beauty, heat, poetry: Ted modern of Lorca’s classic receives performance outside London.Two by feuding familiesits first in a sultry fusion Flamenco rave. lovers frustrated Aug 7,9,11,13,15,17,19,21,23 18.00of(19.35) £5.50and(£4.50) ★ ■ ACID REIGNofsponsored bybehind the Manchester Evening going down?’ This expose the truth theage.Madchester musicNews.‘What’s scene explores the manufactured pleasures of a technical A computerised, chemical, musical experience - welcome to the pleasure factory!£4.50 (£3.50) Aug 55 (18.40) Double6,8,10,12,14,16,18,20,22 bil with Life Stories £5.5017.(£4.50) ★ ■ LIFE Four new writers present a this darklypiecehumorous look before death.STORIES Bothcharacters physically and vocally powerful, explores the atlifelife ofhumorous six courageous whose strength lies in their ability to remain in the face of adversity. 45 (19.30) £4.50 (£3.50) Aug Double6,8,10,12,14,16,18,20,22 bill with Acid Reign £5.50 18.(£4.50) ★ ■poetry, FACESevoking OF WAR Getandyourfear,ticket to theCenturions, front line!Lancaster Using prose and humour Roman tail-gunners and grizzled veterans take leave to answer your questions. Join this exhilarating campaign on a march from glory to the graveyard. Aug 6-23 (not 17) 14.15(15.05) £5.00 (£4.00) Venue 126 - C cubed, St John’s Hall,West End Princes Street Tickets 225 5105 19 ★ ■ THE MECHANICALS Under therepertoire watchful -gaze of Quince,presentation Shakespeare’s mechanicals extend their a panoramic ofBottom’s the Bard’s besttobits. A refreshing combination of Shakespearean snippets from Hamlet’s turmoil£5.00 by way Aug 6-23 idiocy (not 17) 14.45 (15.35) (£4.00)of the Wars of the Roses.


VISUAL ART THE ADAM POTTERY Venue 135 - The Adam Pottery, 76 Henderson Row. “C E R A M I X” SEVEN VARIATIONS ON C LAY EXHIBITION OF EXCITING NEW WORK BY JANET ADAM, MICHELE BILLS, EMMA GROVE, EMMA HOLLANDS, LUCINDA MTTRRAN, CRAIG MITCHELL & LARA SCOBIE FUNCTIONAL FUNKY FABULOUS WIDE RANGE OF PRICES ADJOINING WORKSHOPS WELCOME VISITORS 4™ - 30™ AUGUST : MONDAY - SATURDAY : 10AM - 6PM

ARCHITECTURE ON THE FRINGE II EIO Venue 132 - Royal Fine Art Commission for Scotland, Bakehouse Close, 146 Canongate 2-29 August lOam - 4pm, every day Admission Free Poole Harbour Bridge Design Competition Anthe beauty, exhibitioinnovation n of modelsandandenvironmental drawings highlightinofg theworld'competition entries from new talentconcern and the s leading designers.

ROYAL FINE ART SCOTLAND COMMISSION/or Bakehouse Close, 146 Canongate, Edinburgh EH8 8DD Architecture on the FRINGE

ARCHITECTURE ON THE FRINGE III THE ALDRIDGE GALLERY Venue 155 - R.I.A.S.Gallery, IS Rutland Square. Venue 96 - The Aldridge Gallery, 124 Morningside Road ” ‘ SelecteFNqectsFy Gillian McDonald James Stirling Michael Wilford Highlands and & Islands Associates Watercolours & Limited Edition Prints The Royal Incorporation 11th to 30th August of15Architects in Scotland Rutland Square Mon - Sat 10am to 5.30pm 4th August 2nd October y= Sunday 1 pm to 5.00pm 0 Monday - Friday 9.oo - S.oo Saturday (during Festival) 10.oo - 4.oo FREE ADMISSION Do ADMISSION FREE THE BLACKADDER GALLERY AQUA - CRAFT FROM THE ISLAND OF FUNEN G9 Venue 169 - The Blackadder Gallery, S Raeburn Place Venue 163 - Danish Cultural Institute, 3 Doune Terrace AQUA Craft from the Island of Funen Blackadder gallery AN EXCITING ft COLOURFUL EXHIBITION OF CONTEMPORARY ARTS ft CRAFTS An exhibition of Danish contemporary craftwork by the group "Fynske Paintings, prints, designer jewellery, Kunsth&ndvasrkere". The exhibition ceramics, cards, textiles Et toys. features glass, jewellery, ceramics, New work by photography, and textiles. Aliisa Hyslop Et Sheila Mclnnes 10 - 5.30pm • Free Admission 5 RAEBURN PLACE 0131-332 4605 August 9-September 20 10.00-5.00 (not on Saturday and Sunday) 4th - 31st August ADMISSION FREE ARCHITECTURE ON THE FRINGE I Venue 172 - The Matthew Architecture Gallery, 20 Chambers Street ERNST GISELBRECHT ARCHITECT

i - September 19th Mon - Fri 9am - 4.30pm

KIS

CAMERA OBSCURA Venue 160 - Camera Obscura, Castle Hil , Royal Mile. CAMERA OBSCURA Step inside this unique 1850s 'cinema' for a experience of Edinburgh. Aasunique brilliant, live,tellsmoving, panorama unfolds your guide the story of the city' s historic past. HOLOGRAPHY ' 9 7 New, enlarged3D International Exhibition of astonishing images disappear before you. which appear and Plus: PINHOLE PHOTOGRAPHY; Award-winning OPEN EVERY DAY gift 9.30amshop- 7.00pm Admission: - £3.75 - £3.00 Child - £1.95AdultConcession


VISUAL ART THE CLOTHES OFF OUR BACKS Venue 119 - Granny’s Green, Castle end of the Grassmarket

THE EDINBURGH PHOTOGRAPHIC SOCIETY KIO Venue 130 - The Photographic Exhibition Centre, 68 Great King Street THE CLOTHES OFF OUR BACKS Now new work created especially for Edinburgh includes lines from Dante to Bob Marley

Gl I

International Photography Prints from photographers worldwide 135th Annual Exhibition AUGUST 10-30 Presented by THE EDINBURGH PHOTOGRAPHIC SOCIETY (Scottish Charity SCO 17042) OPEN DAILY:Mon-Sat 10am-8pm. Sun 1pm-5pm Admission (including catalogue) £1.50 Concession £1.00 Children under 12 Free.

DAZZLE CONTEMPORARY JEWELLERY EDINBURGH PRINTMAKERS WORKSHOP & GALLERY GI4 Venue 15 - Traverse Theatre, Cambridge Street off Lothian Road J9 Venue 144 - Edinburgh Printmakers Workshop & Gallery, 23 Union St EDINBURGH PRINTMAKERS WORKSHOP 'It is a welcome surprise to find the FESTIVAL EXHIBITION avant garde sharing close proximity to Picasso precious stones and its 15th year and now a sleek minimalism.' InFestival (in collaboration wiSELECTED th the BericeleGRAPHIC y Square GallerWORKS y. London) fixture, Dazzle shows Scotland on Sunday 9 August -1} September 1997 again in this spectacular atrium A fialnesoselsupet ectiobncontof Piecmporary asso's limpriitendtsedifromtionartpriisntstsworki . All work s forlsaland.e, 'Unmissable' space. 48 top international ng in iScot Financial Times designers show jewellery, Festival Open Studio: bettourwseenaro2pmund t-4pmTuesday he primmaldng stFruiddiayo watches and unique clocks. ‘Don't miss this All 1,000 exhibits are for sale. exhibition' Hours: Tuesday - Saturday 10am - 6pm 8th-30th August 7 days a week Time Out the Playhouse Theatre) EDINBURG! 1 0131 557 2479 JANETPERRYSilver/gold rings lOam-midnight ADMISSION FREE EDINBURGH COLLEGE OPART Venue 73 - Edinburgh College of Art, Lauriston Place.

EDINBURGH ZOO Venue 78 - Edinburgh Zoo,Corstorphine Road Tel:0131334 9171

HI Outer

Time to Stand and Stare An exhibition of paintings and sculpture by Sue Beach and Ian Finan Artists-in-Residence, Edinburgh Zoo 1997 “Watching animals. Watching people watching animals. Watching animals watching people. Animals and the way they affect us all!” 25 July-5 September 1997 9.00 am - 6.00 pm (Sundays 9.30 am) Edinburgh Zoo entrance gallery ADMISSION FREE EDINBURGH CONTEMPORARY CRAFT FAIR Venue 196 - Edinburgh Inti Conference Centre, Morrison Street BEDE First time giant contemporary craft fair of international stature to rank with Chelsea Craft Fair. 140 top designers at ARTI Edinburgh's most exciting new building. See also entry for "Artisan in Action" for lectures, workshops and associated events. SAN Supported by Scottish Arts Council CATALOGUE £1.00 CALL 0131 225 2059 FOR MORE INFORMATION

EDITH SIMON GALLERY 4 EDITH SIMON WORKS - and how! Unimaginable. Indescribable. Has seen. Ask tothebedevotees! ictures, Scul Graphics, V Festival Exhibition 10-30 August Admission Free Mon-Sat 10am-6pm Venue 23 Chaplaincy Centre, Bristo Sq. tel: 650 2595 115


GALERIE MIRAGES Venue 149 - Galerie Mirages, 46a Raeburn Place. MOROCCAN TAPESTRY A stunning selling exhibition of textiles, rugs, ceramics and decorative artifacts illustrating the wide diversity of cultural influences that make up Morocco presenting a rich tapestry of colour and design 1st August - 17th September 10am - 6pm Admission Free

INHOUSE Venue 174 - Inhouse, 28 Howe Street DESIGNED by ARCHITECTS Architects have helpedatchange ourofworld from CRto Mackintosh the startend the century Norman Foster at the - over 30something exhibits,about all in the production today, reveal authors, their clients and the world they inhabit. Aug 9th - 30th Mon - Sat 9.30 - 6.00 pm r Sundays 10th 17th 24th-12.00-5.00 pm £_

GALERIE MIRAGES JENNERS Venue 149 - Galerie Mirages, 46a Raeburn Place. E8 Venue 154 - Jenners, 48 Princes Street JEWELLERY VIII Now an important feature of the Festival ADAM+LILITH Fringe, our 8thjewellery exhibition presents: “BEFORE THE FALL” The Jewellery of The Tuareg, the blue men of the Sahara, PROTEAN MOSAIC SCULPTURES also Antique Amber and a stunning selection of Designer Jewellery WILL LORIMER 1st August - 17th September JENNERS 10am - 6pm Admission Free GALLERY MACCOLL Venue I S3 - Gallery MacColl, 117 Comiston Road PASI KUTVONEN Contemporary Finnish Art New drawings and paintings by an established Finnish Artist, frequently exhibiting in many European cities. This will be Pasi Kutvonen's first exhibition in Scotland. Kutvonen has a distinct technique and the show comprises of work made in Edinburgh and Lahti. 8-31st August • 10am-6pm Tel/Fax: 0131 452 8580

JUDITH GLUE INTERIORS AND GALLERY P6 Outer Venue 175 - Judith Glue, 60 High Street on the Royal Mile SCOTTISH ECCENTRICS FESTIVAL EXHIBITION 6 June -1 October A selling exhibition of captivating Scottish Arts and Crafts ranging from the traditional ; to the eccentric and quirky. Also visit our Interiors Department where you will find a wonderful selection of interesting gifts and furnishings for your home. ADMISSION FREE Mon-Sat 9.30am - 7pm Sunday 10.30am - 6pm

HOLYROOD ART CLUB Venue 157 - The Candlish Hall, First Floor, St George's West, Shandwick Place HOLYROOD ART CLLU Art Exhibition and Sale of Paintings Mon-Sat 10am-7.30pm (closes 4.30pm Sat 23rd) Admission Free • Cafeteria

ALAN MCPHERSON Venue 198 - Ugston Mil Barn, Ugston Mil , Spit alrigg, Haddington Alan McPherson Painter in residence & Exhibition Ugston Mill Barn 10am-6pm Sat Aug 16th & Aug 18th - 23rd Also at Fringe Sunday 1m W of Haddington | on A199 (Old A1) Interventions 20, 1997 Tel: 0589 470351 Acrylic on canvas 30” x 40 Map Ref:NT 479 736


THE MERLIN SOCIETY (SCOTLAND) Venue 53 - Festival Club, 9-15 Chambers Street MERLIN IN SCOTLAND An exhibition by Gordon Strachan celebrating centenary of Merlin-Lailoken, the Scottish druid, the seer 14th and shaman. Also ‘Come Dance the Maze’ by Alex Abbey; Pictish wall hangings by Marianna Lines; Sculptures byoriginal Chris Hall; Flag Cosmicfor Swirls by Gordon Strachan; ‘TheandUnion Jock: A New Scotland’ by George RankinPerceval. ‘StonehengeChartres: the Celtic Connection’ by Oliver August 11 - 30: 10am-5.30pm daily (not Sun): Free Daily 1pm: ‘Merlin’s Moment’ (30mins): Music, shamanic dance, etc. (Details from Venue) Fridays: 29: O’Keefe. 5.30pm - Saturday ‘Merlin and Future’:Field Lecture Strachan,Aug flute15,by22,Karen AugustScotland’s 23, 10am-6pm: tripbyto Gordon Merlin Sites (book in advance). Evenings: live music in bar lounge (Details from Venue)

MIEKO NISHIMURA Venue 55 - Randolph Studio, Inst Francais d’Ecosse, 13 Randolph Cres. Mieko Nishimura ‘DANCING GODDESS’ — Paintings — Japanese Lanterns Riding on the winds ofthe orient It's festival time! comes the dancing goddess Come see and dance with me. painted on the Japanese lanterns. Won't you like to try painting on -a colorful play of lightsJapanese lanterns yourself 1 -a symbol ofpeace and happinessRandolph Studio Gallery a taste of JapanAugust 17-30 sakelrice wine) 11 i 00a.m.-ll i 00p.m. admission free available TEL 225-5366

MONTRESOR THE OLD TOWN BOOKSHOP Venue 134 - Montresor, 35 St Stephen Street F9 Venue 105 - The Old Town Bookshop, 8 Victoria Street ^ 31 iJULT TO 31 AUGUST iqhu mi tb ihbd ph-zhud pm ts shbb pm IN A ill Ur OLD BOOKS, OLD ALZHEiHEt 5EUTLANI1 GONATiDNS INViTEQ PRINTS & Paintings of REMEMBER ^ SCOTTISH CASTLES big selection at akelite? The OLD TOWN A RETEDSPECTiVE DF BAKEUTE& EARLY PLASTIC JEWELLERY& BOOKSHOP FASHION ACCESSORIES 8 VICTORIA STREET, EDINBURGH (Smins from Edinburgh Castle) FROM IS ID TO ISSO Open 10-30 -6pm Mon- Sat. Tel 0131 225 9237 NATIONAL GALLERY OF SCOTLAND Venue 63 - National Gallery of Scotland,The Mound National Gallery of Scotland 8 August -19 October 1997 THE PORTRAIT OF A LADY SARGENT & LADY AGNEW Admission £3, concessions £2 Open Monday to Saturday ioam-5pm and Sunday 2-5pm. Extended hours during the Edinburgh Festival Exhibition sponsoredHotels by GNER and Orient-Express

The Photographic Journeys of John-Thoimon (1837-1921)

CLARITY OF COLOUR TRIBAL RUGS OF SOUTHERN IRAN Our 15th Festival selling exhibition features the wonderful carpets, rugs, kilims, animal trappings and bags of the Afshar, Qashqa'i, Bakhtiari and Luri tribes. August 5 - September 7 Mon - Sat 10-5 (Sun 12-4)

PERSIAN VILLAGE Venue 190 - Persian Vil age, 98 Morningside Road THE GOLDEN CRESCENT STORY National Library of Scotland 1 JUNE TO 28 SEPTEMBER Come and see the carpet making arts of the Golden Monday(Fest-ivFriday 10.00-17.00 Crescent weavers. al 10.00-20. 30) Films and artefacts will be exhibited. Saturday 10.00-17.00 Sunday 14.00-17.00 August 2 - September 5 Open 10.30am till 7.00pm Free Admission Persian Village ^ NationalIVLiBribrarydgeofEdiScotnburgh land George \ 98 Momingside Road,T:0131 466 7071 Tel: 0131-226 4631 e-mail: persia(d).heimdall-scot.co.uk

NATIONAL LIBRARY OF SCOTLAND Venue 115 - National Library of Scotland, George IV Bridge CAPTURED

OUT OF THE NOMADS TENT Venue 142 - Out of the Nomad’s Tent, 21 St Leonard’s Lane.


VISUAL ART PORTFOLIO GALLERY Venue 42 - Portfolio Gallery, 43 Candlemaker Row

ROYAL COLLEGE OF SURGEONS OF EDINBURGH Venue 146 - Royal College of Surgeons, (Top Floor) 9 Hil Square LI

CALUM COLVIN Pseudologica Fantastica Calum Colvin creates a futuristic imaginary landscape in a series of new, large-scale colour digital photographs. 12 - 30 August Monday - Saturday 10.00 - 5.30 Admission £1 (50p)

Royal College of Surgeons of Edinburgh, 9 Hill Square, Edinburgh (Top Floor) The Art of the Dentist The exhibition displays a unique and world-famous collection of 18th and 19th century dental paintings and lithographs, presented to the College by Dr J. Menzies Campbell. 12 - 30 August 1997 10.00am - 4.00pm (not Sundays)Free Admission The College is a Registered Charity

PROVINCIAL BOOKSELLERS FAIRS ASSOCIATION SCOTTISH NATIONAL GALLERY OF MODERN ART Venue 89 - Roxburghe Hotel, 38 Charlotte Square. I Venue 66 - Scottish National Gallery of Modern Art, Belford Road H5 Scottish National Gallery ofModern Art Edinburg ;h Festival 5 July-9 November 1997 SURREALISM & AFTER BOOK ¥/ JR THE GABRIELLE KEILLER Roxburghe Hotel COLLECTION uire i Admission free August 4th to 30th August Open Monday to Saturday ioam-5pm Noon-6pm First day Si. Sundays and Sunday 2-5pm. Extended hours 10am 6pm other days during the Edinburgh Festival Thousands of Antiquarian & Secondhand Books, Maps ExhibitionDonald sponsoredSolicitors by McGrigor & Prints for Sale Free Admission QUAKER FESTIVAL COMMITTEE SCOTTISH NATIONAL PORTRAIT GALLERY Venue 40 - The Quaker Meeting House, 7 Victoria Terrace. J11 Venue 44 - Scottish National Portrait Gallery, I Queen Street Quaker Meeting House 7 Victoria Tee Scottish National Portrait Gallery THE FACE OF Contemporary Work by Quaker DENMARK Women Artists 19 JUNE - 31 AUGUST 1997 All three weeks - not Sundays - free Admission £3 • Concesssions £2 Open Monday to Saturday ioam-5pm and Sunday 2-5pm. Extended hours Art of Silence during the Edinburgh Festival ROGUES’ GALLERY Venue 133 - Rogues’ Gallery, 58 St Stephen Street

ETCHINGS & LITHOGRAPHS with a collection of contemporary political & social cartoons AUGUST 2ND TO 30TH, 11.30-5.30PM TUE-SAT ?WufliicgGallery ♦ Admission free ♦All work for sale

SCOTTISH ATTHE RSANATIONAL Venue 64 - RoyalPORTRAIT Scottish Academy,TheGALLERY Mound A Scottish National Portrait Gallery exhibition at the Royal Scottish Academy J RAEBURN 1 AUGUST - 5 OCTOBER 1997 Admission £4, concessions £2.50 Open Monday to Saturday ioam-5pm ; and Sunday 2-5pm. Extended hours during the Edinburgh Festival This exhibition ukhasplc beeninsponsored Elf associationby with ElfExploration Aquitaine


VISUAL ART SHOWSTOPPERS Venue 88 - St Stephen’s Centre, Foot of Howe Street

WEST END CRAFT AND DESIGN FAIR Venue 127 - St John’s Church, West End, Princes Street WEST END CRAFT AND DESIGN FAIR Mon 4 to Sat 30 August Open 11am-6pm Closed Sundays FREE ADMISSION An absoluteworkmust, ke buying contemporary directif you fromlicraftworters designer-makers. Oneoftheand Festival’s liveliest daytime venues. Bp] 75 Exhibitors every day, change-overs each weekend

Theatrical Gifts and Promotions present a THEATRICAL BOOK EVENT on Saturdays 23rd & 30th August 12 noon to 6pm and before, during and after shows at the venue from 6th - 30th August COME, SEE and BUY! I Theatre booksfrom 'A&C Black' and 'Applause' Plays, Educational, Technical and General Interest Books on HUGE RANGE OF THEATRICAL CARDS & GIFTS FOR • DANCE • DRAMA • MUSIC • MUSICALS • STOCKBRIDGE BOOKSHOP Venue 156 - Stockbridge Bookshop,26 Northwest Circus Place COLIN BAXTER'S EDINBURGH LIMITED EDITION PRINTS ON SHOW AND FOR SALE! FREE admission STOCKBRIDGE BOOKSHOP 26 N.W. CIRCUS PLACE EDINBURGH Tel (0131) 225 5355 Mon. - Sat. 9am-10pm

ARTHROB Venue 118 -Arthrob.The Old GPO Building, North Bridge ■designers, POST film Videomakers installations and group show of work by visual artists, graphic fashion designers. Aug 10-25 10.00 (20.00)and Free THE193BIG / ANeith DEALBH MOR Venue - RoyalPICTURE Botanic Garden, Inverl Row D11 THE BIG PICTURE / AN DEALBH MOR The major visual artsphoto-collage project from this year’s Highland Festival takes the form of a monumental set inlifestyles a‘stone circle’. Complimented by AndyThorburn’s the of the Highlands and Islands. soundscape.it reflects Aug 8-Sep 5and10.00landscapes (17.00) Free

Sun. 11am-8pm

STUDIO ONE GALLERY Venue 129 - Studio One Gallery, I0 Stafford Street, THE COLLECTED WORKS OE FIFTEEN YEARS OFARCHIVES CUTTING-EDGE ILLUSTRATION OFBRITISH ROGER LAPUBLISHING BORDE, FROM THE THEINNOVATIVE HOUSE RESPONSIBLE FOR REVOLUTIONISING GREETING CARD DESIGN DARING TO PUBLISH WORK BY CONTEMPORARYBY ILLUSTRATORS. ALL WORK FOR SALE. AUGUST 4-AUGUST10am30- 6pm MONDAY - SATURDAY SUNDAY 2 -FREE 5pm ADMISSION WEMYSS WARE AND ITS HISTORY Venue 171 - Griselda HillWemyss Pottery, 89 West Bow,Victoria Street EMYSS WAI and its history A well known Scottish Potteiy, established 1882, and revived in 1985, welcomes you to compare the old with the new. 1882 . open every day 10.00-6.00 during festival. 1997 GRISELDA HILL 89 WEST BOW EDINBURGH EH1 2TPPOTTERY TEL: 0131 226 1479

1

DEMARCO EUROPEAN ART FOUNDATION Venue 220131- Demarco Tickets 558 7330European Art Foundation, St Mary’s School,York Lane/Albany St HI ■forthVISIBLE SOUNDfrom - JEFF LORBER &TOM REYER Moving backartist and with inspiration colours, sound and live interaction between and musicians,fromwhatfirstis note left on stage defiesstroke. linguistic translation. Watch the programme last brush Aug I 1-30 (not Suns) 21.15to (22.30) £ 10.00 (£8.00) DIVERSE ATTRACTIONS Venue 11 - Diverse Attractions, Riddles Court, off Lawnmarket ■....What FESTIVAL...WHAT Snapcorp Photography 1,2 andFestival 3). on theFESTIVAL? weekpresents Aug 10-30Festival? 09.30Life (21.30) Freeedge of cultural capital (cafe - weeks FRINGE POSTER EXHIBITION Venue 73 - Edinburgh College of Art, Lauriston Place. ■annual FRINGE POSTER The topwhich entries to itsthe competition findEXHIBITION the idealFeaturing imageAlways forfabulously thea winner! Fringecolourful Poster, way onto walls acrosstoallthe globe. entries finds from 5-18 year olds from over Scotland. Aug 10-29 10.00 (17.00) Free GAY MEN’S HEALTH Venue 145 - Gay Men’s Health, 10a Union Street ■group UNDER (PINK)artists FRINGE Selection of painting and sculpture by a of gay(notTHE or Sats,Suns) bisexual and working Aug 4-29 10.0living 0 (17.00) Free in Lothian. Admission free. JAPAN EXPERIENCE 00©« Venue 55 - Randolph Studio, Inst. Francais d’Ecosse, 13 Randolph Cres. F ■Mieko EXHIBITIONS Flowers and women are the themes for 2 female artists. Misawa “Jungle Mom” contemporary graphic posters of a surrealistic nature. Aug 10-16. (LitMieko - “Dancing Japanese inNishimura the evening) Aug 17-30Goddess” paintings on Aug 10-30lanterns. I 1.00 (22.00)up Free oo©@ ALEX MILLIGAN Venue 194 - Kirk o’ Field Church Hall, 138 Pleasance (entrance on Brown Street) ■ I TOart.I with AlextheMilligan. Welcome to thework. weirdMeet and thewonderful world of tactile evolving artist.learning Interact. Touch, sight,Watch sound andcontinuously light. Used for partially sighted, disabled, difficulties. Art for all. Aug Suns)7 days 11.00entry. (19.00) £1.50 (£1.00) Ticket11-29 price(notallows


Apex kio Venue 29 31-35 Grassmarket Tickets 0171 278 9908 Talks <£ Events • Aug Cut!13,Censorship 20 11.00 (17.and30) self-censorship £7.00 (£5.00) in the media LM Magazine page 66 Disabled: Details not available Arthrob,The Old GPO Building 113 Venue 118 10am North- 9pm Bridge Tickets 558 7559 (0171 591 5900 pre 8 Aug) Box Office: Defining a nation a two week intoxicating verbal mix, beats, DJs, bar, performance, film, dance and dancing, contemporary music,hooligan, video installations, silence, commentary, talks, fashion. . , tomato,classical glamorous K Foundation, guerillachemical theatre-hedonism. Talks <£ Events • Aug Arthrob 10-25Defining 10.00 (05.a00)Nation £5.00 (£3.Arthrob 50) (Freepageentry64 before 6pm) Visual Arts • Aug Post10-25 Arthrob page00)119Free 10.00 (20. Food and drink: Licensed Disabled: Lift access bar Assembly Rooms in Venue 3 54I George Street. Tickets 226 2428 Box Office: I am midnight Stella ArtoisatAssembly - a powerhouse of creative energy - 1000 performances in a gem of abrochure building, on the 0131heart 226 of5992.the Fringe. Bars, tapas and six happening spaces. Call for a free Comedy <£ Revue • AllPreview Classical Rainer Hersch page 23 Aug 8 Music 16.00 (17.Explained:The 00) £5.0000 (17.0Masterclass Aug Aug 9-14,17,19-21,25,27-30 15,16,22-24 16.00 (17.00)16.£8.50 (£7.0)5£7.50 0) (£6.50) • A-Z ofTaboo Poulter and Duff20.55page(21.3055) £7.50 (£6.50) Aug Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 20.55 (21.55) £8.50 (£7.50) • JoAugBrand 26 22.00Benefit (23.05) Assembly £10.00 Rooms page 11 • Aug Brighton1Theatre Events:The00)Blues Brother Assembly Rooms page 10 £7.50 Aug 9-12, 15,16,4,22,17-19, 23 17.2140 17.(19.4000)(19.£8.50 (£7.50)(£6.50) • The Britcom Benefit The Channel Aug 20Paramount 22.00 (23.Comedy 05) £10.00 (£8.00)presents The Britcom Benefit page 30 • Chicks With Flicks Jackie Clune page25)15£7.50 (£6.50) Aug 8-11,13,14,17-21,25,27-30 22.25 (£7. (23. Aug 15,16,22-24 22.25 (23.25) £8.50 50) • Glynn Nicholas - Crossing the30 22.Line15 (23.Glynn Nicholas page 29 Aug 8-1 1, 1 3, 1 4, 1 7-21, 2 5-27, 2 9, Aug 15,16,22-24 22.15 (23.15) £8.50 (£7.50)15) £7.50 (£6.50) • Aug Hattie17-21,Hayridge: Random Abstract Memory 13.1350)(14.£8.50 30) (£7. £7.5050)(£6.50) Assembly Rooms page 10 Aug 22-24 213.5-3015 (14. • Amnesty ‘Just a Tickle’ from Amnesty International International Aug 10 midnight (02.30) page £12.0010 (£10.00) • Aug Mark Little: Psychobubble Assembly50)Rooms page 10 Aug 8-14, 15,16,17-21 22,23 20.20.2255 (21. (21.335)5) £8.50 £9.50(£7. (£8.50) • Aug Max8-14,17-21,25-30 MavemThinking23.in35Person Assembly Rooms page 11 35) £7.50 Aug 15,16,22-24 23.35 (00.35)(00.£8.50 (£7.50)(£6.50) • Aug Northern Broadsides: Anthony and 16-30 13.30 (15.45) £8.50 (£7.50) Cleopatra Assembly Rooms page 11 • Aug Graham Norton page 29 23.10 (00.10) £7.50 (£6.50) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 23.10 (00.10) £8.50 (£7.50) • Aug Ole!8-14,17-21,25-27,29,30 page 29 05 (23.(£7.20)50)£7.50 (£6.50) Aug 15,16,22-24 22.05 (23.20)22.£8.50 • Owen O’Neill 22.00 - Off my Face Owen O’Neill page 30 Aug Aug 8-14, 15,16,17-21 22-24 22.00(23.(23.000)0)£7.50 £8.50(£6.(£7.550)0) • Perrier Perrier Pick of theFringe Fringepage Award 30(£9.Shows Aug 27,2Pick9,30OfThe 22.00 (23.15) £10.00 00) • Aug The9-14,17,19-21,25,27-30 Right Size: Do You Come Here15)Often? Assembly Rooms page 10 00 (19. Aug 15,16,22-24 18.00 (19.15)18.£9.00 (£8.00)£8.00 (£7.00) • Jerry Sadowitz Assembly Rooms page 11 Aug 8-11,13,14,17,18,20,21,25,27-30 £8.00 (£7. (£7.000)0) Aug 8-11,13,14,17,18,20,21,25,27-30 20.12.500500)(12. (21.555)5) £8.00 Aug Aug 15,15,116,6,222-24 2-24 20.12.5050 (12. (21.555)5) £9.00 £9.00 (£8. (£8.00) • Aug Scared Weird Little Guys 19.page (20.31 530)5) £7.50 (£6.50) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 19.30 (20.35) £8.5030 (£7. 120

• Sub-Post Death Spontaneous Combustion page 32 Preview AugOffice 8 18.0of0 (19. 15) £5.00 Aug 15) £7.50 Aug 9-14,17-21,25-30 15,16,22-24 18.00 18.(19.0015)(19.£8.50 (£7.50)(£6.50) • Aug Talkin’Vagabond Jazz Assembly Rooms page 10 Aug 8-10,12-14,17,19-21,25,27-30 15,16,22-24 21.50 (22.50) £9.0021.50(£8.(22.00)50) £8.00 (£7.00) • The Topp Twins page 33 20.00 (21.25) £7.50 (£6.50) Aug Aug 8-10,12-14,17,19-21,26-30 15,16,22-24 20.00 (21.25) £8.50 (£7.50) • Vice and Rooms Verse:ThepagePoetry Lachlan Young Assembly 10 of5 (21.Murray Aug 8, 2(£7.5) £7.50 Aug 15,9,116,1-14, 22-2418-21, 20.2255-30 (21.220.5)2£8.50 50) (£6.50) • Vinyl Anorak Graham Duff 12.page00 (13. 17 Aug Aug 9-11,13,14,17-21,25,27-30 15,16,22-24 12.00 (13.00) £8.00 (£7.000)0) £7.00 (£6.00) Dance/Physical Acrobat Assembly page (£7. 34 Aug 22.00(23.Rooms (23.05)05)£10.00 £9.00 Aug 8-14, 22,23,221,42522.00 (£8.000)0) Tbilisi Assembly Rooms page 34 Aug 10-12Ballet, 13.30Georgia (15.45)45)£9.00 Aug £9.00(£8.(£9.(£8.000)0)00) Aug 14,15,1167,111.8 311.0 3(12.0 (12. 45) £10.00 Music • Aug Paul 15,Brady: Assembly 16 23.Solo 45 (01.in15)Concert £11.00 (£10. 00) Rooms page 39 • Aug Club8,29,30 Latinomidnight and ‘Sonora La Calle’ Assembly Rooms page 39 30) £5.00 Aug 915,midnight (03.30)(03.(03. £4.00 (£3.£8.0000)(£4.(£6.00)00) Aug 1 6, 2 4 midnight 3 0) Aug 25-28 midnight 30) (£7. £7.0000)(£5.00) Aug 22,17-21, 23 midnight (03.30)(03.£9.00 • Aug Steve25-30 Harley Assembly Rooms(£8.00)page 39 20. 2 5 (21. 3 5) £9.00 Aug 24 20.25 (21.35) £10.00 (£9.00) • Joburg Streets Assembly (01. Rooms page 39 Aug 00) £7.50 Aug 8-14,17-21,25-30 15,16,22-24 23.3023.30 (01.00) £8.50 (£7.50)(£6.50) • Aug Loyko15-19 The22.00 Russian (23.0Gypsy 5) £8.00Band (£6.00)Assembly Rooms page 40 • Aug Mika8-14,17-21,25-30 Assembly Rooms23.50page(01.3915) £8.00 (£7.00) Aug 15,16,22-24 23.50 (01.15) £9.00 (£8.00) • Aug Opera26-28Circus Shameless! 17.00- (18. 00) £8.50 (£7.Assembly 50) Rooms page 39 • Opera Circus King Stag Assembly Aug 29,30 16.40 (18.25) £9.50 (£8.50) Rooms page 39 • Aug Ray Davies:The Assembly Rooms page 39 17-21,25-30 23.Storyteller 4155)(01.£12.50 15) £11.00 Aug 22-24 23.45 (01. (£10.00)(£9.00) • Aug Sharon Shannon Assembly Rooms 8,9 23.45 (01.15) £10.00 (£9.00) page 39 Musicals/Opera • Aurelius,The Apprentice National Youth Music Theatre page 62 Aug 910,16.11,3013,(18.17,Valiant 415)8,2£7.00 Aug 1,0 2(15. 5 16.45)30£9.50 (18.45)(£7.£9.50 (£7.00) Aug 14, 1 8, 2 0, 2 5 13. 3 Aug (18.445)5) £10.50 £10.50 (£8. (£8.000)0) 00) Aug 16,15,2232 13.16.3300 (15. • TinPanAli National Youth Music Theatre page 62 Aug 1213,116.7,139,0 2(18. 45)30£7.00 Aug 1 13. (15. 5) £9.50(£8.(£7.00)00) Aug 15,14,213,9,2240 13.16.3300 (18. (15.445)5)4£10.50 Aug £9.50 Aug 16,22,24 16.30 (18.45) £10.50(£7.(£8.00)00) Theatre • The Ballad of Jimmy Costello00 (13.MPS30)- £7.50 Guy Masterson Productions page 95 Aug Aug 8-14,17,18,20,21,25-30 15,16,22-24 12.00 (13.30)12.£8.50 (£7.50) (£6.50) • Aug Boy’s Life Assembly 14.Rooms 7/ 0page 0) £7.00 Aug 8-14,17-21,25-30 15,16,22-24 14.35 (16.3500)(16.£8.00 (£7.00)(£6.00) • Aug Bye 9-14,17,19-21,25-30 Bye Blackbird MPS12.-55Guy(14.Masterson Productions page 95 Aug 15,16,22-24 12.55 (14.10) £8.5010)(£7.£7.50 50) (£6.50) • The Chairs Assembly Rooms page 7 / Aug 05) £7.50 Aug 8-14,17-21,25-30 15,16,22-24 14.50 14.(16.5005)(16.£8.50 (£7.50)(£6.50) • Close to You page 77 Preview Aug 8 16.25 (17.40) £5.00 16.25 (17.40) £7.50 (£6.50) Aug Aug 9,10,12-14,17,19-21,25,27-30 15,16,22-24 16.25 (17.40) £8.50 (£7.50) • Aug Denise Stoklos in Casa Assembly Rooms page 71 45) £8.00 Aug 8-14,17-21,25-30 15,16,22-24 13.30 13.(14.3045)(14.£9.00 (£8.00)(£7.00) • Elsa Edgar Bob Kingdom page 91 Preview Aug 8 11.00 (12.11.300)0 (12. £5.0030) £7.50 (£6.50) Aug Aug 9-14,17-21,25-30 15,16,22-24 11.00 (12.30) £8.50 (£7.50) • Aug I Can’t10-14Remember Anything Assembly Rooms page 7 / 17. 0 0 (18. 1 5) £8.00 (£7. 0 0) Aug 15,16 17.00 (18.15) £9.00 (£8.00) • Jump to Cow Heaven Assembly Rooms page 7 / Aug 00) £7.50 Aug 8-14,17-21,25-30 15,16,22-24 18.35 18.(20.3500)(20.£8.50 (£7.50)(£6.50) • Aug Krapp’s Last Tape Assembly Rooms page 71 Aug 8-14 15,16 13.13.1155(14.(14.330)0)£7.50 £8.50(£6.(£7.550)0)


• • • • • • • •

Playing Burton MRS - Guy Masterson Productions page 95 Aug 8-14,17-19,21,25-30 (15.30)(£7.£7.50 Aug 15,16,22-24 14.00 (15.14.30)00 £8.50 50) (£6.50) The Prince of West End Avenue Kerry page (£6. 10350) Aug 16.2550)(18.Shale 10) £7.50 Aug 8-11,13,14,17,18,20,21,25,27-30 15,16,22-24 16.25 (18.10) £8.50 (£7. Rapscallion Productions: Bring20)Me£8.50Sunshine Assembly Rooms page 71 Aug Aug 8-14,17-21,25-30 15,16,22-24 14.00 14.(15.0020)(15.£9.50 (£8.50)(£7.50) Rodney Bewes:Three Men in a Boat Assembly Rooms page 71 Aug 15) £7.50 Aug 8-14,17-21,25-30 15,16,22-24 16.00 16.(17.0015)(17.£8.50 (£7.50)(£6.50) Shopping and F***ing Out of Joint/ Royal Court Theatre Aug 19.30 (21.(£10.00) 25) £ 10.00 (£9.00) page 96 Aug 9-11,13,14,17-21,25,27-30 15,16,22-24 19.30 (21.25) £11.00 Steven in Massage Rooms page 71 Aug 19-21,Berkoff 211.5,237-30 (12.45)Assembly Aug 22-24 0 (12.11.45)30£10.50 (£9.£9.50 50) (£8.50) Surfing Assembly Rooms page 7 / Aug 7-21,219.5-3035 (20. 19.3355)(20.£8.5035) (£7.50) £7.50 (£6.50) Aug 11-14, 15,16,212-24 Think No Evil of Us...My Life With Williams David9-11,13,14,17-21,25,27-30 Benson page 73 11.45 (13.Kenneth Aug 1 5) £7.50 Aug 15,16,22-24 11.45 (13.15) £8.50 (£7.50) (£6.50) • Wasp by Steve Martin Third15 Stage page 108 Aug (16.(£8. 25)Productions Aug 8-14,17,18,20,21,25-30 15,16,22-24 15.15 (16.25)15.£9.00 0£8.00 0) (£7.00) • The Wrestling School: Wounds to the Face Assembly Rooms page 71 Aug 17-21,217.5,207-30 (18.20)(£8.00) £9.00 (£7.00) Aug 22-24 0 (18.17.20)00£10.00 Food and Ent: drink:5ydFulI lStr.Wildman y licensed BarRoom: and cafe5ydalFlat. l day.Ballroom & Music Hall: Lift available. Disabled: Supper Room: 7yd Fl a t . WC (adapted ground level). 30yd. Aud: 20yd. Drawing Room: Lift available, 2 str. Edinburgh Suite: Enter by side lane

if • The Talking Cure The Cambridge Mummers page 76 Aug 11-30 (not Suns) 20.15 (21.45) £5.50 (£4.50) • The Tempest Aug 25-30 18.10 Il(19.lyri5a0) page £6.0090(£4.00) • Timon Edinburgh University Aug 11-23 (not 17) 18.15 (19.4Theatre 5) £5.00 Company (£3.00) page 83 • We Are You 104 Theatre Aug Are 11-23Here... (not Suns) 14.30There? (15.30) £6.00 (£3.50) Company page 96 • Will You Remember? Better00) Out Aug 18-30 (not 24) 16.15 (18. £5.00Than(£3.In00)Theatre Company page 73 Food and Ent: drink:3ydCafe, bar alAud: l day.30yd 2+5 Str. Disabled access & toilets. Disabled: 2+3 Strlicensed WC (+2). Berties Venue 80 7 Merchant Street, off Candlemaker Row Music • Aug Psycho Zydeco 5400) £5.00 (£4.00) 22.30page(02.£5.00 Aug 1612-15, 21.0017-22(midnight) (£4.00) Disabled: Details not available

ki i

Blackball St Columba's Church Cl Outer Venue 68 MuirdaleTerr. Box Office: 7pm - 10pm Queensferry Road, Blackball. Augustine Church kii Theatre Venue 152 10am George- 6pm IVUnited Bridge Tickets 226 7246 • Out of Focus Light Drama page 104 BoxAugustine Office: Aug 18-23 19.30 Southern (22.00) £5.00 The United Church i s a recently renovated nineteenth century church i n the heart of the Old Town.The sanctuary and gallery are beautiful spaces for exhibitions with Food and drink: Tea and coffee at interval. an excellent acoustic for music. Disabled: Ent: I lyd + I.Aud:5ydWC. Music • The DOM(notConcerts Bonnington Resource Centre ci6 Aug 11-30 Suns) 20.00DOM(21.Festival 15) £5.50of Art, (£2.5Music 0) and Animation page 42 Venue 48 200 Bonnington Road Food and drink: Cafe al l day Disabled: Venue on street level Dance/Physical • War! - What17.0is0 (18. it Good For?(£2.Zendo Aug 19-21 30) £4.00 00) Martial Art Show page 37 BBC Scotland hii Food and drink: Cafe Venue 57 Studio One, 5 Queen Street. Disabled: Ent: 12yd ramped front & back. Aud: 16 Str HR. Lift.WC adapted. Box Office: 9am - 6pm Comedy <fi Revue Broughton High School ev • Aug Radio11-15, 5 Live18-22at 23.00 the Fringe BBC Radio Scotland page 12 (23.30) Free Venue 69 I Carrington Road. Tickets 336 1081 • The Usual(notSuspects Box Office: 19-23 Aug: 6.15pm-8.15pm, 24 Aug: 2.15pm-8.15pm Aug 11-29 Sat,Suns)Live22.10BBC(23.Radio 30) FreeScotland page 12 Musicals/Opera Music • Aug Brigadoon(notEdinburgh • Aug Brian17Kay’s Sunday Morning BBC Radio Scotland page 40 17) 19.£5.00 15Youth (21.(£3.4Music 5)50)£6.00Theatre (£4.50)page 61 09.00 (12.15) Free Aug 16I 1-1915.15(17.45) • Aug Mr Anderson’s Fine Tunes BBC Radio Scotland page 40 • Hot Mikado Edinburgh Youth Music Theatre 19-21 14.00(16.00) Free Aug 15 (21.(£3.45)50)£6.00 (£4.50) page 61 Aug 22-30 30 15.1(not 5 (17.24)45)19.£5.00 Food and drink: Licensed, snacks at time of performance. Disabled: Ent: level left of main door. Aud: 20yd flat.WC adapted. Completely accessible to Food and drink: Licensed bar 6.30pm - 9pm. Coffee, tea and snacks wheelchairs. Disabled: Ent: ramped entrance. yd.WC adapted 4 Str HR. Prior notice appreciated but notCarrington essential.RdSpace for upAud: to 310wheelchairs. Bedlam Theatre l i i Venue 49 119.30am b Bristo- 12.30am Place Tickets 225 9893 The191Brunton TheatreTickets 665 2240 K22 Outer Box Office: Venue High Street,(I0am-8pm Musselburgh Five minutes fromenergetic the Fringe Office, dominating GeorgeRecognised IV Bridge, theas anneo-gothic Bedlam Box Office: I0am-5pm on performance evenings) offers exciting, and innovative entertainment. established venue 304 seat theatre newly transformed by \#/631.8m refurbishment offering first with a fully licensed and welcoming cafe, the Bedlam is THE place to visit this Fringe. iminutes n terms from of comfort design. Situated on thebysplendid of Forth coastline,classonlyfacilities centralandEdinburgh. Easily reached car or Firth bus. Free parking. Comedy <£ Revue Comedy <£ Revue • Aug Improverts Theatre page 17 11-23 (notEdinburgh IT) 00.15 University (01.15) £3.50 (£2.5Company 0) • Aug Out of Order Eskmouth (22. £6.00Theatre (£4.5cones) 0)Company page 17 Theatre Aug 11-14 15,16 19.19.3300 (22. 000)0) £6.00 (no • The Accident Brentwood Theater Company page 74 Food and Fuldrink: Coffees, lteas and licensedgallery; loungeinfra-red and confectionary Aug 11-16 16.30 (17.35) £6.00 (£4.50) Disabled: ly accessible; ift; wheelchair loop system;kiosk tactile signage. • Aphra Behn & Nell Gwyn - 17th Century Career Girls Theater Ten Ten page 106 Aug 25-30 22.10 (23.55) £6.00 (£5.00) • AAugChorus of Disapproval 2 page Bruntsfield Primary N6 11-23 (not 17) 12.15 (13.5Stage 0) £4.50 (£3.50)105 Venue 166 Montpelier • Aug E & E18-23Murmur 10.30 (11.Hundred 30) £3.50Heads (£2.50)page 89 Theatre • Aug Lies,25-30 White10.Shirts a Bottle • The Golden19.0Pathway 30 (11.and 40) £5.00 (£3.5of0) Bleach ACTS page 68 Aug 11-16 0 (21.30) Annual £5.00 (£4.Second 00) Thoughts page 103 • Aug Miss25-30 Julie 12.20toTheatre page 110 15 (13.45) £5.00 (£4.00) Disabled: Details not available • Slavs! Edinburgh University Theatre Company page 83 Aug 11-23 (not 17) 22.15 (23.15) £5.00 (£3.00) 121


C 19 Over-Seas House, 100 Princes Street. Tickets 225 5105 no Venue Box upOffice: 9amshimmy - latewith Shakespeare and cruise to the coolest of cabarets. Edinburgh’s Pick a poet, mostCcentral stimulates all yourFestival sensesat ithen twoforefront theatres,of artthe gallery and cubed venue - the most happening Fringe.and cafe-bar. C Children’s Shows • The Little(notMermaid 7 (£4.00 SUOD) (£3.00 C) Aug 6-30 17) 11.30 C(12.page 20) £5.00 Comedy <fi Revue • Aug Music6-30in (not my Mouth a Well(£4.Oiled 14,28) 20.A15Perret (21.05)and£5.00 00) Limb page 30 • Torch! Aug 6-30 Melody (not 14,Cooper 28) 21.20 page (22.20)16 £5.50 (£4.50) Music • The New(notThurs) York Broadway Rosemary Aug 9-30 17.30 (18.Duo20) £5.00 (£4.0George 0) & Richard Shadroui page 55 • Aug Straker 8-30 Sings (not 14,Brel28) with 22.15 4(23.Fenders 00) £5.00Red(£4.Sox 00) page 54 Theatre • Acid Aug 6,Reign 8,10,12,1Z4,Theatre 16,18,20,Company 22 17.55 (18.page40)113£4.50 (£3.50) • Adult / Dead 23.30 Child(00.Outhouse 96 vodka) Aug 6-30Child (notThurs) 50) £5.00Productions (£4.00) (Pricepage includes • Alice and Mr Dodgson Tal l Stories page 106 Aug 8,10,12,14,16,18,20,22,24,26,28,30 15.15 (16.15) £5.00 (£4.00) (£3.00 C) • Artificial Limbs:ACompany Do-It-Yourself Guide to Inner Happiness Plasticacid Theatre Aug 6-30 (not IT) 17.00 (17.50)page£4.5097 (£3.50) • The Bespoke Overcoat Aug 24-30 14.15 (15.05) £5.00Oxford (£4.00)Out of the Blue page 97 • Aug Blood7,9Wedding Theatre(£4.Company ,11,13,15,1-‘Bodas 7,19,21,23de18.Sangre’ 00 (19.35)Z£5.50 50) page 113 • The Cagebirds The Ugly Duckling Theatre Company page 110 Aug 24-30 12.30 (13.45) £5.00 (£4.00) • Caliban Aug 24-30- Marcos 18.00 (19.de20)Azevedo £5.00 (£4.&00)Eduardo Bonito (Brazil) C page 75 • Critical Aug 11-23Condition (not 17) 13.The 00 (14.New00)Light £5.00Bulb(£4.Theatre 00) Company page 95 • Aug Eyes6-23 and(not Teeth17) Active Performance Productions 12.30 (13.45) £5.00 (£4.00) page 68 • Aug Faces6-23of War page00)113 (not 17)Z Theatre 14.15 (15.Company 05) £5.00 (£4. • Aug Feel6-30 Real(not- a play reality(£4.0Prominent 14,28)about 23.00 frotting (00.25) £5.00 0) Theatre page 101 • The Happy Prince Tal l Stories page 106 Aug 6,7,9,11,13,15,19,21,23,25,27,29 15.15 (16.15) £5.00 (£4.00 SUOD)(£3.00 C) • Here I Paint Myself,with Frida Kahloby way of Kensal Green page 77 Corazon Aug 6-30 Productions (not 28) 22.30 (23.Paradise 30) £5.50 (£4.50) (Free tequila) • Aug Life’s6-30a Gatecrash K. 91 (£3.50)(inc. free whiskey) (not 14,28) 00.30486(01.page 20) £4.50 • Aug Life 6,Stories Z Theatre Company 8,10,12,14,16,18,20,22 18.45 (19.page30) 113 £4.50 (£3.50) • Of Cakes, Aug 6-30 (notMen17,and 28) Angels 16.30 (17.2Square 0) £5.00Watermelon (£4.00) Productions page 105 • Aug Oleanna Optimism page 96 6-30 18.30 (20.00) £5.00 (£4.00) • The Pigsty(not Red Aug 6-30 14,2Sox 8) 20.5page 5 (22.10310) £5.50 (£4.50) • AAugQuestion of Attribution Broken(£4.Dream 6-30 (not 14,28) 19.40 (20.4The0) £5.00 00) Theatre Company page 75 • Aug Ready24-30or Not Lucid05)Productions 13.00 (14. £5.00 (£4.00)page 93 • Shakespeare 75 breakfast Aug 6-30 10.00for(11.Breakfast 05) £5.00 (£4.C00)pageincluding • Aug Shelf-Life Peppery Edge Productions page 6-30 (not 17) 10.15 (11.15) £5.00 (£4.00) 97 • Thyestes page (£4. 77 00) Aug 6-30 (notConspiracy 17) 14.00Theatre (15.15) £5.00 • Valium Optimism Aug 6-30 (not 17) 11.3page 0 (12.9645) £4.00 (£3.00) • AAugView Res0Theatre 6-30from (not the 17) 15.Bridge 25 (16.4In5)Medias £5.00 (£4. 0) Company page 90 Food and drink: Licensed bar and restaurant serving mealsStrandHR,drinks al(too l daysmall til late Disabled: Front 7ydtoStrAud.HR.Little Big CC Aud: wheelchairs), thenEnt:14yd Aud:8 Str20+5+15+10 20+5HR StrBig HRC Aud: or li9yd ft (tooorto liftliftsmall(28” forx 49”)forlyd to wheelchairs) From Rose Street: Ent: 13yd Aud. Little C Aud:9yd to lift (28” x 49”) 14yd to 10+5 Str HR or lift (too small for wheelchairs). appreciated). WC (W 23”). Guide dogs admitted. Help available (advance warning

L 122

NON SMOKING? Shows may be held in venues where Call thesmoking venue tois allowed. check.

C3 126 St John’s Hall, West End Princes Street Tickets 225 5105 /9 Venue Box Office:and9amserial- late Boy bands killers C’s latest off-shoot kicks i n with a scream.The wildest shows forterrace kids,bar.the Experience grooviest comtemporary wickedest the Fringe at itsclassics, thrillingthespilling best. new writing and the tastiest Children’s Shows • Bringwonder’s Word Magicfrom New Zealand page 7 Bringwonder Aug 6-16 (notthe10)Storyteller 11.30 (12.20) £5.00 (£4.00) (£3.00 C) • Aug Ferdi6-30the(notFerret 17) 12.Optimism 30 (13.20) page £5.008(£4.00) (£3.00 C) • Aug Hans25-30 Up! 11.Nottinghamshire Theatre(£2.50C) Company page 8 15 (12.15) £4.50Education (£3.50 SUOD) Music • Aug Come18-23On 11.Everybody, Sing! (£3.Angelic 15 (12.15) £4.50 50) Voices page 38 • Aug Macbeth 17-23 -15.Shakespeare’s 45 (17.15) £5.00text(£4.&00)Verdi’s music Angelic Voices page 38 Musicals/Opera • The Aug 6-9Rape18.of00 Lucretia (19.50) £5.50Young (£4.5Opera 0) page 63 Theatre • The Bespoke Aug 18-23 17.30Overcoat (18.20) £5.00Oxford (£4.00)Out of the Blue page 97 • Aug La Cantatrice Chauve LesVagues 6-30 (not 17) 13.30 (14.35) £5.00 Francaises (£4.00) page 93 • The Canterbury Aug 6-16 15.45 (16.Tales 50) £5.00Really(£4.Necessary 00) Travelling Actors page 101 • Aug Dripdry 11,13,1Crazy 5,17,2Horse 1,23,25,Theatre 27,29 19.Company 45 (20.45)page £5.0078(£4.00) • Aug Heavy10,Breathing 12,14,16,18,20,Crazy 22,24,Horse 26,28,3Theatre 0 19.45Company (20.45) £5.00page(£4.7800) • Aug Hysteric Studs14,2Waxen 6-30 (not 8) 22.30Patience (23.30) Theatre £5.00 (£4.page 00) 112 • Aug Inside24-30the 14.Island 45 (17.KCSTheatre 00) £5.00 (£4.Company 00) page 90 • Aug Into6-30 the Sky Conscious (not of14,Miles 28) 23.45Bruised (01.00)but£5.00 (£4.00) Productions page 75 • Aug Kiwi 11-16 Odyssey Bringwonder the Storyteller 18.45 (19.40) £5.00 (£4.00) from New Zealand page 74 • The Mechanicals Aug 6-23 (not 17) 14.Z45Theatre (15.35)Company £5.00 (£4.0page 0) 113 • Aug Remember, 11-16 17.Remember 00 (18.30) £5.00Albatross (£4.00) Theatre Company page 69 • Aug Roman 25-30Scandals 17.30 (19.3Nottinghamshire 0) £5.00 (£4.00) Education Theatre Company page 95 • Stages Aug 18-23Think 18.30Twice (19.3Theatre 5) £5.00Company (£4.00) page 108 • The Trial(notK.49,8628) page Aug 6-30 21.0091(22.15) £5.50 (£4.50) • Aug Mr Wilde The05)Broken 6-30 (not& The Suns)Virgin 10.10 (11. £4.00Dream (£3.00)Theatre Company page 75 Food and drink: Licensed terrace bar drinks and snacks all day til late. Day time restaurant. Disabled: by pathHelpfromavailable Princes(Advance Street: Ent: 20ydappreciated). Flat. Aud: 5yd Flat WC (adapted). Guide dogsEnter admitted. warning The Cafe Royal 112 Venue 47 17 West Register Street Tickets 556 2549 Box Office: 9.30am 12.30am One Fringe’sinleading independent venuesBar.bringing again a fantastic of drama, musicofandthecomedy finest Bistro studioselection NOW AIR CONDITIONED! ‘It’sEdinburgh' the most shappening venue onMaithen theatre Fringe’ and Edinburgh Evening News. Comedy <fi Revue • A-Z of Comedy? Aug 8-30 21.15 (22.15)Adam£5.00Crow (£4.0and0) Mitch Benn page 10 • The Big Value ComedyComedy Show...page Early Screaming Blue Murder Aug 8-30 (not 19,28) 20.00 (22.00) £6.0031 • The Big Value Comedy Show... Late31 Screaming Blue19,Murder Aug 8-30 (not 28) 22.Comedy 30 (00.30)page £6.00 • Aug I Beg8-30Your(notPardon? 28) 22.45Charlie (23.45)Cheese £5.00 page 15 • Aug Kit and the17.2Widow’s New 0 (18.20) £8.50 £8.50 Show (£6.00) Kit And The Widow page 25 Aug 8-28 8-28 18.30(19.30) • Stone Me It’s The Lad Himself Aug 9-30 (not 28) 16.10 (17.00) £5.00 Company (£4.00) Theatre page 16 • Three page 32 Aug 8-30 (not 18,28) 19.15 (20.45) £6.00 (£4.50) Music • Aug Eclectic 9-30 Guitar 14.00 (14.with55) Jonathan £5.00 (£4.0Prag 0) Alborada Productions page 38 Theatre • Accidental Aug 8-30 17.1Death 5 (18.5of0) an£5.00Anarchist (£4.00) Stanley Theatre Group page 105 • Aug Hancock’s 9-30 (notLast28)Half 15.10Hour (16.00)Company £5.00 (£4.Theatre 00) page 77


• •

The Man In The EnglishloloLunatic Asylum106 Synaesthesia Aug 11,13,15,and17,1Theatr 9,21,23,25,2Goch 7,29 13.page 30 (14.25) £6.00 (£4.00) The Man InandTheTheatr WelshloloLunatic Asylum Synaesthesia Goch page Aug 12,14,16,18,20,22,24,26,28,30 13.30 (14.10625) £6.00 (£4.00) Food and Ent: drink:2ydLicensed BistroWC Bar (W+M) same level. Disabled: Aud: 2 Flights.

vcnues

The Caledonian Venue 206 Princes Street Talks & Events • Classic Classic FM page 64 Aug 16,2FM 3,24Live 12.00at(13.the00)Caledonian Free • Classic Live at TheFree Caledonian Classic FM page 64 Aug 18-22FM18.30(19.10) Disabled: Details not available

18

Caledonian Venue 183 42 SlatefordBrewery Road Music • Aug Caledonian Beer Festival 11.Caledonian Brewery page 40 8-10,15-17,22-24,29,30 00 (23.00) £3.00 Disabled: Details not available

M2

Cannonball House jio Venue 165 10am-1 Castle lam Hill, Royal Mile (Suns 2pm - 3pm only) Box Office: andthe 2pm-3pm Ideally located at the foot of Castle Esplanade. Si g n posted ‘Urban Studies Centre’ and prominently2 hours. displayed.In Danish, WalkingDutch, tours are FREE OF CHARGE and posters last approximately Frenchconducted and German. Talks & Events • Royal MileFestival Historical WalksGuides Association page 65 Edinburgh Aug 4-30 Tours lastVoluntary approximately 2 hours Free Disabled: Details not available

• Aug Durham Consort 45 Pass) (Free SUDC) 21 12.Early 30 (13.Music 30) £3.00 (£1.00 OARpage& Stage • Aug Edinburgh International Youth Orchestra 46 SUDC) 30 19.30 (21.30) £6.00 (£3.00 OAR & Stage Pass)page(Free • Aug Edinburgh jazz Orchestra page 46Pass) (Free SUDC) 23 12.30Schools (13.30) £3.00 (£1.00 OAR & Stage • Aug Edinburgh Ensemble pagePass) 46 (Free SUDC) 29 12.30Schools (13.30) Wind £3.00 (£1.00 OAR & Stage • Aug Edinburgh University Chamber Orchestra 29 19.30 (21.30) £6.00 (£3.00 OAR & Stage Pass)page(Free46 SUDC) • Aug Fife Youth 26 12.3Jazz 0 (13.Orchestra 30) £3.00 (£1.00pageOAR46& Stage Pass) (Free SUDC) • Aug Fife Youth 28 19.3Orchestra 0 (21.30) £6.00 page (£3.0046OAR & Stage Pass) (Free SUDC) • Aug Fife Youth String Orchestra 46 28 12.30 (13.30) £3.00 (£1.00& Percussion OAR & StageGroup Pass) (Freepage SUDC) • Aug Glasgow page 45Pass) (Free SUDC) 19 19.Schools 30 (21.30)String £6.00 Orchestra (£3.00 OAR & Stage • Goldsmiths’Youth Aug 22 12.30 (13.30) Orchestra £3.00 (£1.00 OARpage& 46Stage Pass) (Free SUDC) • Goldsmiths’Youth Orchestra Aug 22 19.30 (21.30) £6.00 (£3.00 OARpage& 46Stage Pass) (Free SUDC) • Aug Highland Orchestra pagePass) 46 (Free SUDC) 26 19.3Regional 0 (21.30) Youth £6.00 (£3.00 OAR & Stage • Jeugdorkest Aug 9 19.30 (21.Nederland 30) £6.00 (£3.00pageOAR45 & Stage Pass) (Free SUDC) • Aug Kelvin30 Ensemble page (£1.00 46 OAR & Stage Pass) (Free SUDC) 12.30 (13.30) £3.00 • Aug Lothians Schools Orchestra page&46Stage Pass) (Free SUDC) 23 19.30 (21.30) £6.00 (£3.00 OAR • Aug National 15 19.Youth 30 (21.Choir 30) £6.00of Scotland (£3.00 OAR &page Stage45Pass) (Free SUDC) • Aug Perth27Youth Orchestra 12.30 (13. 30) £3.00Chamber (£1.00 OAREnsembles & Stage Pass) page (Free46SUDC) • Aug Perth27Youth Orchestra page 46 19.30 (21.30) £6.00 (£3.00 OAR & Stage Pass) (Free SUDC) • Aug RSAMD Orchestra pagePass) 46 (Free SUDC) 25 19.Junior 30 (21.Academy 30) £6.00 (£3.00 OAR & Stage • Aug Southampton Chamber 45 SUDC) 11 12.30 (13.University 30) £3.00 (£1.00 OAR Choir & Stage Pass)page(Free • Aug Southampton University Chamber Choir page 45 SUDC) 13 19.30 (21.30) £6.00 (£3.00 OAR & Stage Pass) (Free • Aug Southampton pageSUDC) 45 11 19.30 (21.University 30) £6.00 (£3.Chamber 00 OAR Orchestra & Stage Pass) (Free • Warwickshire Chamber Orchestra 45 SUDC) Aug 14 19.30 (21.Youth 30) £6.00 (£3.00 OAR & Stage Pass)page(Free • Warwickshire Chamber Orchestra 45 SUDC) Aug 15 12.30 (13.Youth 30) £3.00 (£1.00 OAR & Stage Pass)page(Free Food and Ent: drink:2ydTea2+7+6 and coffee at evening performances only. Disabled: Newly installed lift. Str HR. Aud: 100yd 8+8 Str HRWC (+5 25”).

Canongate Church jis Venue 60 KirkCanongate, Royal Mile Canongate i n the Royal Mile i s a historic and distinctive venue. Built i n 1690 by order ofsuitable JamesforVII.vocal It is amusic. bright and spacious building with a cathedral acoustic particularly Music • National ChoirOrchestras of Scotland Festival15 of12.Youth British Aug 30 (13.Youth 30) £5.00 (£3.00) page 45 Disabled: Details not available Chaplaincy Centre Li2 Venue 23 I Bristo Square, (near Fringe Club) Tix 650 8201 (pre7Aug65l 1332 I0am-5pm) The Cellar Bar Ki2 Boxa long-established Office: 10.30amvenue - 11 pm Venue 54 Chambers Street Asquality, at the(phones heart oftilltheand8.30pm) Fringe, withwith a well-deserved we bringtheatre, you amusic programme to excite challenge an abundancereputation of for . Music international and art. • Aug New20-23,27-30 York Jazz! 22.30page(01.5330) Free Music • Aug Eyes21-30 in the22.Big15 (23. City45) Eva£7.00Meier Disabled: Details not available (£5.00)page 53 Musicals/Opera Central Hall ls • Coward’s Choice Bunbury & Co page 61 Venue 100 9.30am WestTollcross. Tickets 229 7937 Aug 9-18 22.50 (23.50) £6.00 (£4.50) Box Office: 9.30pm Gilbert Sullivan Wilde(£4.5Bunbury 9-18&21.30 (22.30)Go£6.00 0) & Co page 61 Central Hall, 10533 youth years oldorchestra with elegant I930’sincluding stainedearlyglassmusic, and asymphonic fine acoustic,classics, is home to • Aug ancentury impressive concerts 20th • Schoolhouse Voices40) Of£4.00The(£2.South new commissions, bands and jazz. Aug 12,14,16,18,Rock, 20-22Live! 12.15 (13. 50) & Theatre Whatsit page 63 All shows listed below can be found under FESTIVAL OF BRITISH YOUTH ORCHESTRAS Theatre 0 The Bedseller’sTale C.C.T(£3. . page Music Aug 9-17 14.30 (15.30) £5.00 50) 76 • Anglia Academy 45 & Stage Pass) (Free SUDC) • Voices Beginnings - from Voices of Whatsit the Southpage 111 Aug 14 Brass 12.30 (13. 30) £3.00 (£1.page00 OAR Of The South & Theatre Aug 9-11,13,15,17,19,23-29 12.15 (13.40) £4.00 (£2.50) • Aug Barnet12 12.Schools Orchestra 30 (13.3Symphony 0) £3.00 (£1.00 OAR & StagepagePass)45(Free SUDC) • Aug Blood24-30 Wedding 16.10 (17.De45)Montfort £4.00 (£3.Theatre 00) Company page 80 • Aug Barnet12 19.Schools Symphony Orchestra page 45 30 (21.30) £6.00 (£3.00 OAR & Stage Pass) (Free SUDC) • The Quest(notTues) Hungarian Overtures/ Merlin(£5.International Theatre page 89 Aug 9-20 19. 3 0 (20. 4 0) £7.00 00) • Aug Bedfordshire County Youth Second Orchestra page 45 Aug 21-23 20.30 (21.40) 20 19.30 (21.30) £6.00 (£3.00 OAR & Stage Pass) (Free SUDC) • Scraps Re-Act Theatre page 101 • Aug Dorset16 Youth Orchestra Chamber Ensembles page 45 Aug 21-30 18.15 (19.45) £5.00 (£3.00) 12.30 (13.30) £3.00 (£1.00 OAR & Stage Pass) (Free SUDC) • Shadowboxing Axis page 72 • Aug Dorset16 Youth Aug 18-23 20.30 16.30 (17. 19.30 (21.Orchestra 30) £6.00 (£3.page 00 OAR45 & Stage Pass) (Free SUDC) Aug 24-30 (21.330)0) £5.00 (£3.00) • Aug Dundee Schools Symphony Orchestra page 45 18 19.30 (21.30) £6.00 (£3.00 OAR & Stage Pass) (Free SUDC) • Aug Durham CHAPLAINCY CENTRE continues over the page 21 19.County 30 (21.30)Youth £6.00Chamber (£3.00 OAROrchestra & Stage Pass) page (Free46SUDC) 123


The City Cafe Venue 150 7pm 19 Blair Box Office: - 8pmStreet. Tickets 229 5600 Theatre • Aug Lush11-28White(notRabbit Suns) Cowboys 20.00 (21.15)page£5.00112(£4.00) Food and drink: Licensed Disabled: Details not availablebar and restaurant. Food available until 10pm.

KI2

Columcille Venue NewbattleCentre Terrace (next to Dominion Cinema) Tickets9422920560 Music • Aug Neil 11-30 Stewart Dan21.00 Perry(22.World (not&Suns) 30) £4.00Music(£3.on00)2 Guitars page 58 os Disabled: Details not available

P6

CHAPLAINCY CENTRE continued • AAugTaste Montfort 24-30of14.Honey 15 (15.4De5) £4.00 (£3.Theatre 00) Company page 80 • Word Aug 9-15Play16.30Sol(17.Survivor 30) £5.00page(£3.01040) Visual Arts • Aug Edith10-30 Simon(notWorks Gallery page I IS Suns) 10.Edith 00 (18.Simon 00) Free Disabled:30yd DOWNSTAIRS WC.Aud: ll + ll Str HR.- Ent:40yd Flat.Aud: 20yd FlatWC. UPSTAIRS - Ent:30yd Flat

Church Hill Theatre Venue 137 Morningside Road Box Office: 10 Augwas4-9pm, 11-17builtAugin 1892 10am-9pm Church HiInl 1965, Theatre originally andHifunctioned as Morningside Church. after a 5 year renovation, Church l Theatre was opened as aFree permanent theatre space. Eleven American High Schools will be calling Church Hi l Theatre home during the Fringe. Comedy <& Revue • Aug Don’t Drink 14.the15Water American High School Theatre Festival page 10 Aug 12,17 116.4,1165 (17. 45)(15.45) £3.00 (£2.00) • Aug Marvin’s Room American High(£2.School 12.1455)(13.45) £3.00 00) Theatre Festival page 10 Aug 12,17 118.4,1165 (19. Musicals/Opera • Annie Hard 3Knock Kafe Kids page 62 Aug 0 (22. Aug 2219-2314.319.0 (17. 00)00) £5.00 (£3.00) • American Big RivenThe Adventures of Huckleberry Finn High18.School Aug 0555)(19.Theatre 55) £3.00Festival (£2.00)page 61 Aug 10,16 110.2,1045 (11. • Aug Bugsy28,29Malone 19.30 (21.Edinburgh 30) £5.00Workshop (£3.00) For The Expressive Arts page 61 • Aug 42nd26,27,30 Street 19.Edinburgh Workshop For The Expressive Arts page 61 Aug 30 14.30 (16.3300)(21.30) £5.00 (£3.00) Theatre • American Children High of a LesserTheatre God Aug 3,15 18.School 10 (19.55) £3.00Festival (£2.00)page 69 Aug I141,110.10(11.55) • Aug Feiffer’s People High(£2.School 16.1455)American (17.45) £3.00 00) Theatre Festival page 69 Aug 11,12 110.3,1155 (11. • Aug Lend11,Me13 a10.15(11.15) Tenor American High School £3.00 (£2.00) Theatre Festival page 69 Aug Aug 1617 20.16.1155 (17. (21.115)5) • Aug Look Homeward, Angel American 13,15 (21. 14.1500)(15. 50) £3.00 (£2.00)High School Theatre Festival page 69 Aug 1611,20.10 • Aug Museum American(21.High School Theatre Festival page 69 Aug 10,17 112.2,1240 20.20 (13.40) 40) £3.00 (£2.00) • Aug Native11,1Colors American High School 12.3300)(13.30) £3.00 (£2.00)Theatre Festival page 70 Aug 16 18.3,1350 (19. • The New Mexico Masque and Mummer’s Play American Aug 2,High 14 16.School 30 (17.Theatre 15) £3.00Festival (£2.00)page 70 Aug 10,15 110.30(11.15) • The NightHighThoreau spent inFestival Jail American School(21.Theatre Aug 3,15 20.10 50) £3.00 (£2.00)page 70 Aug 11,17 114.10(15.50) Disabled: Details not available Cirque Baroque Venue 147 12Leith Links- 8pm Tickets 7200 Box Office: midday (notwill477Mondays) Cirque Baroque’s enchanting Bi g Top be neighbouring streets or catch any bus to thesetfootonofLeith LeithLinks. Walk.Free parking on Theatre • Aug Candides 6-31 19.Cirque 30 (21.0Baroque 0) £10.00 page (£8.0760 conc.Tue-Thur only) Disabled: Wheelchair places available.Toilets unadapted.

124

020

The Comedy Cafe Roadshow lii VenueComedy 14 Charles Street, by Fringe Tickets 456669 The Cafe is unique in that Club it isperformance a fully equiped0410 40audience seater, mobile theatre, set iexhilarating n the back ofjourney a truck.venue Moving throughout its the wi l be taken on combining the views of Edinburgh with theatrical comedy at its finest.an Comedy <6 Revue • Tripterranus Comedy14.0Cafe Aug 14-30 (not Suns) 0 (15.Roadshow 15), 16.00 (17.page15),IS18.00 (19.15) £7.00 Disabled: Details not available Continental Shifts at Springwell House Venue 32 Ardmillan Terrace, off Gorgie Rd. Tickets 346 1405 (St Brides) Box Office:movement-based 10am - 10pmprogramme from St Bride’s ‘The the Fringe’ t). Continental Shiftsbest goesfromfromninestrength to worldwide. strength withtoPrepare thebe seen bestforoninandance, physical(The andLiofsvisual theatre countries electrifying blast international proportions. Dance/Physical • Aug Departed 18,19,2Soul 1,22 16.Taihen 00 (17.(Japan) 00) £5.00page(£3.3700) • Aug Maria18-23Cardona Dance (Spain) 19.45 (20.40) £5.00 (£3.00) page 37 Food and drink: andAud: refreshments Disabled: Ent:5ydCoffee 2 Str HR. 10yd 7+9+4 Str HRWC (W 25” M 24”). Continental Shifts at St Bride's ks Venue 62 1010am Orwell Terr Tickets 346 1405 Box Office: - 10pm. ‘The best movement-based programme to be seen on the Fringe’ (The Li s t ) . Continental Shifts nine goes from strength to strength with the best in dance, physical and visual theatre from proportions.countries worldwide. Prepare for an electrifying blast of international Dance/Physical • Being and Bondage Indian25-30 Dance Aug 21.00Society (22.3i0)n Association £6.00 (£4.0with 0) Romanska page 36 • Aug Departed Soul Taihen (Japan) page 11-16 11.00 (12.00) £5.00 (£3.00) 37 • Aug Flor 18-23 de Obesessao a Fraus(£3.Theatre 14.00 (14.50)Pi£5.00 00) Company page 37 • Aug Maria25-30 Cardona Dance (Spain)(£3.00) page 37 19.45 (20. 40) £5.00 • Aug Nukanya 11-23 Dreaming (not 17) 21.30NND (22.4Ngarindjeri 5) £6.00 (£4.- 0Narungga 0) Dreaming page 37 • Septet Gandini Juggling Project page(£4.3500) Aug 18-20,25-27 18. 0 0 (19. 1 0) £6.00 Aug 21-23,28,29 18.00 (19.10) £7.00 (£5.00) Theatre • Aug C’estI 1-16 LaVie!19.45Theatre (21.00) Transformations £5.00 (£3.00) page 107 • Aug The 11-16 Day of13.the00 (14. 43 3Sunsets Small Planet Productions page 104 0) £5.00 Aug 18-23 12.00 (13.30) (£3.00) • Wounded Women Merlin International Theatre page 89 Hungarian Overtures/ Aug (19.110)5) £7.00 (£5.00) Aug 11-16 18-23 19.17.4450 (21. Food and drink: Licensed bistroAudand15yd bar Disabled:helpEnt:available, 2 1/2 yd very ramped. admitted, accessible. flatWC adapted level access. Guide dogs


Craigmillar Castle P/4 Outer Venue 109 Craigmillar Tickets 558 7330 Box Office: I lam -12 midnight The Demarco Foundation the Festival to Craigmillar - the castle community. In keeping with well-knowntakes tradition presentsand antheoutdoor production in a aspectacular setting thatthewillDemarco enhance anyFoundation performance. Theatre • Aug Romeo 14-17and20.00Juliet(22.4Demarco 5) £ 12.00 European (£8.00) Art Foundation page 79 Disabled: Details not available

Diverse Attractions ji i Venue I I Riddles off Lawnmarket Tickets 225 8961 Box Office: 9.30am Court, - midnight Alunless l showsotherwise listed below stated.can be found under DIVERSE ATTRACTIONS Comedy <fi Revue Demarco European Art Foundation • Abigail’s Bablake£3.50 at Diverse Attractions page 11 Aug 18-23Party 13.30(15.00) Venue 22 St11 am Mary’s School,York Lane/Albany St Tickets 558 7330 HI3 • The Canterbury Tales Bablake at Diverse Attractions page 11 Box Office: 12 midnight. Aug 18-23 12.00(13.00) £3.50 The DemarcoandFoundation presents a programme ofamong innovative andmanyexperimental Performing Visual art from different countries, them East European Talks <& Events countries.The Foundation will again be the meeting place for performers, • Aug Meditation journalists and Demarco Festival goers. 11-23 (not 17)page14.6500 (15.30) Free All shows listed below can be found under DEMARCO EUROPEAN ART FOUNDATION. Theatre • All Dance/Physical Augfor18-23Mairi’s 17.45Wedding (19.15) £4.50page(£3.8050) • Aug Bosnia18-23Future page 34 (£3.00) • Aug Bully-Dozer page15)81£3.50 (£2.50) (£0.50 C) 23.00 (23. 5 0) £5.00 11-13 14. 3 0 (15. Aug 18-23 midnight (00.50) • AAugCalendar of Love page (£3. 81 50) • Aug Future11-16Star’s Magic Dancing page 34 18-23 18.30 (19.30) £4.00 13.00 (14.15) £4.00 (£2.00) • Aug Dandelions page 71 £4.00 (£3.00) • Aug Labyrinth page 34 18-23 13. 4 5 (15. 1 5) 18-23 17.30 (18.40) £5.00 (£3.00) • Aug Fisherman’s The (£3. Logos • The Lollipop 18-23 I 1.4Moon 5 (13.1and 5) £4.50 00) Collection page 80 Aug 18-23 13.0Foundation 0 (14.00) £4.00 (£2.page00)34 • Aug HavingI 1-13a Good Time page 81 • Aug Notturno (Crepuscolo & Resurrezione) page 35 13.30 (14.15) £3.50 (£2.00) (£0.50 C) 25-30 21.00 (22.00) £5.00 (£3.00) • Aug Hot 18-23 Flushes21.45 (23. page15)80£5.00 (£3.00) • Aug Phantarch in Alba(01.0page 35 (£3.00) 18-23 midnight 0) £5.00 • The Ladychapel • You Only Miss the Water When the Well Runs Dry page 34 Aug 11-13, 1 8-23 20. 00page (21.0810) £3.50 (£2.00) Aug 11-16 19.00 (19.15) Free (donations accepted) • Aug Lovers11-16 17.page45 90(19.15) £5.00 (£4.00) Talks <£ Events Aug 18-23 21.45 (23.15) • Aug Drama, and15)Science • Aug Men 14-16 - the12.Final 21-23Poetry 14.00 (15. £2.00 (£1.5page 0) 64 00 (13.Frontier 00) £3.50 (£2.page50)81(£0.50 C) • Multiple Division Theatre Aug 14-16 14. 0 0 (15. 00)page£3.5081 (£2.50) (£0.50 C) • Anais Anagram page£3.5079 (£3.00) • The Net Files page 81 (£2.00) (£0.50 C) Aug I 1, 1 8 19. 0 0 (19. 3 0) Aug 11-13 12.00 (13.00) £3.50 Aug 13,16,20,23 23.00(23.30) • No Spring Chickens/A Wee Word00) page 81 • Angels Aug 12.00 (13. Aug 11-16Memories 22.00 (23.-00)DAH£5.00Teatar (£3.00) page 79 Aug 11-16 14-16 20.00 (21.000)0) £4.00 £4.50 (£3. (£3.50) • Aug The 11-30 Dinner(notParty page 79 • Other People’s Footsteps Suns) 17.15 (18.30) £5.00 (£3.00) Aug 25-30 20.00 (21.10) £6.00 (£3.page00) 80 • Aug Disintegration Dze-Ya? Belarus State Theatre page 79 • Postcards page 81 11-16 19.00 (20.30) £5.00 (£3.00) Aug 25-30 17.45 (19.00) £5.00 (£3.00) • The House11.of30Bernarda Alba(£3.00)page 79 • Aug Robert 81 (£2.00) Aug 18-23 (12.45) £5.00 27-30Burns 20.00 (21.page 00) £3.00 • Aug If I Am18-23Medea? 79 (£3.00) • Aug Sganarelle’ page 80 £5.00 15.00 (15.5page 0) £5.00 11-16 20. 0 0 (21. 0 0) • Aug InYerFace • Shirley 18-23 21.00 page (23.00)79 £5.00 (£3.00) Aug 11-16Valentine 21.45 (23.10)page£5.0080 (£3.00) • Aug In Your • ToAugEach His 25-30Dreams 13.30 (14.30)page£2.0079 (£1.00) 11-16 15.4Own 0 (17.-20)Dead£5.00and(£4.gone 00) to Granny’s page 75 • journey • Aug Understanding Magazine Poetry Aug 25-30 19.page 30 (20.7930) £5.00 (£3.00) 15, 1 6 21. 4 5 (23. 1 5) £2.50 (£2. 0 0)and Play Reading page 81 • Aug Kaleidoscope-The • Walking on19.the Roof00) £5.00 page(£3.8050) 11-30 (not Suns) 15.Barely 15 (16.Ensemble 30) £5.00 (£3.page 00) 78 Aug 18-23 4 5 (21. • Aug Lemon18-23Sisters 79 (£3.00) • We’re 13.30 (14.page 30) £5.00 Aug 11-16All Sweet 18.00 (19.Here 00) £4.50page(£3.8000) • Aug Macbeth page 79 • Women Spread the45)Word 18-23 15.00 (17.00) £5.00 (£3.50) Aug 18-23 15. 4 5 (16. £3.00 (£1.page 00) 81 • Aug Marriage State00)Theatre page 78 11-16 -13.Dze-Ya? 00 (14.30)Belarus £5.00 (£3. Visual Arts • Aug The 25-30 Night19.of00the(20.Great Season-Akne • Aug Festival...What 00) £5.00 (£3.00) Theatre page 79 10-30 09.30 (21.Festival? 30) Free page 119 • Aug Nostalgia page 79 25-30 17.30 (18.15) £4.00 (£2.00) Food and drink: Cafe al l • Aug The Overcoat -(23.Credo Theatre page 79 Disabled: Ent: 3yd Flat.Aud:day25yd Flat. Aug 11-16 18-23 22.00 19.45 (20. 405)0) £5.00 (£3.00) • The River-Merchant’s Aug 18-23 22.00 (23.00) Wife £5.00 (£3.page 50) 79 Diverse Attractions Complex ki i • Aug Russian Anguish page 79 I 1-23 (not 17) 19.45 (20.45) £5.00 (£3.00) Venue 51 112 West Bow, Grassmarket Tickets 226 4412 • AAugSublime Discord: Sand & Chopin page 78 Box Office: 9am I 1.30pm 11-16 15.30 (16.40) £5.00 (£3.00) All shows listed below can be found under DIVERSE ATTRACTIONS THEATRE COMPLEX. • Two Rooms17.-00Blue Aug (19.0Ridge 0) £5.00Theatre (£3.00)Festival page 78 Aug 14-16 14-16 23.00(01.00) Theatre Visual Arts • Aug LoversI 1-16 19.page35 81(21.15) £6.00 (£4.50) • Visible Sound Jeff Lorber &Tom Reyer page 119 Aug 11-30 (not Suns) 21.15 (22.30) £10.00 (£8.00) • Aug Measure 18-23 for19.4Measure 5 (21.20) £5.00page(£4.9500) Food and Playground. drink: bar, food and 2cabaret (please enquire) • Aug Measure for Measure Disabled: Ent: lyd Str. A ud: 12yd.WC (unsuitable). Main Ent: lyd I Str. A ud: 11-23 (not 17) 17.45 (19.page 15) 81£4.00 (£2.50) 14ydHR.WC level access. No WC. Aud: 1st Floor Aud:19 Str25ydHR.30NoStrWC.AII HR. NoWC.2nd Floor Aud: 37yd 60 Strwheelchairs, 24”. Basement 18yd levels unsuitable for DIVERSE ATTRACTIONS COMPLEX continues over the page but help available. 125


ECF Kings Hall NI3 V€NU€S Venue 52 South Clerk Street Music • Ceilidhs in theCarpenter’s Carpenter’s Arms Nights13,In15The DIVERSE ATTRACTIONS THEATRE COMPLEX continued Aug 20.00 (23.15) FreeArms page 53 • Live Music at the Carpenter’s Arms • Aug Medea25-30 16.page00 81(17.00) £2.50 (£2.00) Nights9,1In6 The Aug 20.00Carpenter’s (23.00) FreeArms page 53 • Aug Mother 18-22Courage 21.40 (23.20)page£5.0086 (£3.00) Talks <fi Events • Aug Murder 81 (£4.00) • Aug Sunday Night Live! FreeNights In The Carpenter’s Arms page 66 25-30House 18.00 (19.0page 0) £6.00 17 19.00(21.00) • Sleep and Caliban’s Island page 81 Aug I 1-16 15.45 (17.15) £5.00 (£3.50) Food and drink: Softflat drinks available • Snog and Other Stories page 81 Disabled: Ent: +2+3 HR.Aud: 5yd flat.WC unadapted but fully accessible to Aug I 1-16 21.45 (23.15) £3.50 (£2.50) wheelchair users.2ydGuide dogs stradmitted. • Trafford Tanzi page 78 Aug 18-23 16.00 (17.05) £4.50 (£3.50) • Yeats in Performance Aug 25-30 19.45 (21.15) £6.00page(£4.8100) Edinburgh Buddhist Centre pii Venue 18 55aBuddhist GrangeCentre Roadis Tickets 662Friends 4945 of the Western Buddhist Order, a Disabled: Ent:50yd I Str.Aud:40yd The Edinburgh run by the WC (15+4 partial HRW 25” M 25”). 15+4+15+4 Str partial HR. world-wide which aimsto topeople makeintraditional accessible inmovement a form appropriate the modernBuddhist west. teachings and practices Talks <£ Events Drummond Community Theatre • Aug Buddhist Meditation Friends(£2.Of50)The Western Buddhist Order page 65 Venue 25 Drummond Community High School, 41 Bellevue PI 15-30 11.15.00(16.30) 00 (12.30) £4.00 Tickets 558 9695 (after 14 July) Aug 15-30 Aug 19,21,26,28 19.00(20.30) Food and Good drink:disabled Tea and access biscuits usually available Jammed by Joan16.0Tewkesbury Festival Theatre USC-USA page 85 Aug 8,12,19,26 0 (17. 3 0) £5.00 Disabled: Aug 14,21,28 14.00 (15.30) Lillian by William Luce Festival Theatre USC-USA page 85 Aug 7,12,22 19.16.0000(20.(17.45)45)£5.00 Edinburgh Festival Theatre Li2 Aug Venue 199 13-29 Nicolson Street Tickets 529 6000 Aug 2516,214.0,2090 (15. 45) Mud /Tent Meetinj Box Office: Mon-Sat 10am-6pm (8pm on show nights) Aug 11,14,18,21,25,21 ObedientlyYours, Orson Welles Festival Theatre USC-USA page 85 Comedy <fi Revue Aug 9,19,29 19.16.0000(21.(18. 00) £5.00 • Aug Kaleidoscope Radio 4 page 12 Aug 14 15.45 (16.BBC 45) Free Aug 15,18 214.2,2030 (16. 00) 00) Olympus USC-USA Food and drink: Cafe and open cafe sameandhoursbox-office. as box-officeand auditorium accessible by Aug 12,14,1On6,19,My21,Mind 23,26,28,Festival 30 22.00Theatre (midnight) £5.00 page 85 Levelinfra-red entrancesystem tobartheatre, AAugPerfect USC-USA page 85 lDisabled: ift. Sennheiser in auditorium. Guide dogsBarwelcome. 11,14,1Ganesh 8,21,25,28 Festival 19.00 (21.Theatre 30) £5.00 Reservoir page 85 Aug 11,13,1Dogs 5,18,20,2Festival 2,25,27,Theatre 29 22.00USC-USA (22.30) £7.00 Edinburgh Inti Conference Centre ks Star9,16,23,30 Wars Trilogy In(12.Thirty Minutes Festival Theatre USC-USA page 85 Aug 12. 0 0 3 0) £5.00 Venue 196 Morrison Street Tickets 300 3000 Aug 11,13,15,18,20,22,25,27,29 23.30 (midnight) Box Office: I lam -7pm Suburbia by Eric Bogosian Festival Theatre USC-USA page 85 Aug £5.00 Talks & Events Aug 913,22.00 16,20,(midnight) 23,27,30 19.00(21.30) • Meet Your Maker - Artisan Sylvia9,1by3,1A.R. Edinburgh CraftinFairActionpage 65 Aug 6,20,2Gur 3,2; Aug 20-25 Contemporary 11.00 (12.00) Free Vivien:The Other Side of Gone With The Wind Festival11 Theatre USC-USA page 85 Visual Arts Aug 5)(17.£5.00 • Artisan Aug 13,214.7,300019.(15. 16.00040(20. Aug 21-25 Edinburgh 11.00 (19.0Contemporary 0) £4.00 Craft Fair page 115 Aug 8,15,26 45)45) Women and Wallace by Jonathan Marc Sherman Food and drink: Light snacks Festival9,1Theatre Disabled: Fully accessible Aug 2,15,19,2USC-USA 2,26,29 14.0page 0 (15.8530) £5.00 Disabled: Access for wheelchair users (at rear of theatre). HI4 Edinburgh Playhouse 59 18-22 Greenside PI. Tickets 557 2590. Dr Watt's Library kis Venue Box Office: 10am 6pm (8pm on performance days) Venue 92 3 Robertson’s Close, Cowgate Info 557 3768 Office:Tickets available on transforming door into the livliest jazz venue in Comedy <& Revue AtheBoxlaid-back barnight. serving meals andfrom drinks9pm all day, Dee Jack Dee page 16 festival at We’ll be showcasing the very best in local and visiting jazz talent and • An Aug Evening 21,26 20.00with(22.Jack 30) £13.50 (£12.50) you’ll be having a great time. • Jo& Andy Brand,Robinson Mark Lamarr,pageJeff24Green, Richard Morton Music Aug 23 23.30 (02.00) £13.50 (£12.50) • The Jazz Club 51 (£2.50) Food and Ent: drink:3ydRestaurant, time oflevel,performance. Aug 10-16 22.00 (03. (03.page £4.00 Aug 17-30 22.00 000)0) £5.00 (£4.00) Disabled: 3 Str. Main licensed Aud: Circlebaratatstreet stalls down 3 flights. Food and Details drink: not Mealsavailable served all day, bar open until 3am. Disabled: Edinburgh University Management LI2 School Venue 121 7 Bristo Square Tickets 229 1576 Talks <£ Events • Aug Poolside 64 (£6.00) 11-29Learning (not Sats andCafeSuns)Brainpool 10.00 (20.page 00) £8.00 Disabled: Details not available

126


The34Famous House KI2 Venue 5 Chambers StGrouse Tickets 220 5606 Box success Office:story 9.30amof the- midnight The 1996 Fringe returns with a vibrant and varied Scottish and International drama, music, dance,Seriously children’sstramashing entertainment, food and drinkprogramme: with free acoustic live music. from comedy. 9am-3am.Fabulous AlINTERNATIONAL l shows listed belowPRESENTS can be found FAMOUS unlessunder otherwise stated.GROUSE HOUSE - SCOTTISH Children’s Shows • Aug Babushka The15)Bear 8-17 10.and15 (11. £4.00 (£3.page00)7 • The Chipolatas page 7 (£4.00) Aug 27-30 12.15 (13.15) £6.00 • Aug Curiouser 8-16 12....and 00 (13.Curiouser 00) £4.50 (£3.Hong 50) Kong Youth Arts Festival page 7 • Aug Light27-30 and 13.Illusion 45 (14.3Edinburgh 0) £3.00 International Science Festival page 7 • Secrets Explained Edinburgh International Science Festival page 7 Aug 20-24of13.the45Theatre (14.30) £3.00 • Sounds Aug 8-17Sensational 13.45 (14.30) Edinburgh £3.00 International Science Festival page 7 • Aug Ssshhh...! 8-17 15.Hong 30 (16.Kong 20) Youth £4.50 Arts (£3.50)Festival page 7 Comedy <£ Revue • Aug Bruce Morton page 27 Aug 89-3021.30(not(22.18,30)28)£5.00 21.30 (22.30) £8.50 (£7.50) Dance/Physical • Aug Hommage 20-30 15.A15Mary (16.2Wigman 5) £7.00 (£5.Compagnie 00) Yvette Bozsik page 34 • Aug La Vie9-18Simple Diakonos 15.30 (16. 15) £6.00Physical (£4.0Theatre 0) page 35 /Music • Anam Aug 13 21.4page 5 (23.4330) £7.00 (£5.00) • The Barra page 44 Aug 27 19. 3 0McNeils (21.(01. 15)3£8.00 Aug 27 midnight 0) (£6.00) • The Big Spree page 43 Aug 15 21.45 (23.30) £8.00 (£6.00) • Aug Lorna10 Brooks 19.30 (21.15)page£7.0043 (£5.00) • Aug Burach page 44(01.30) £7.00 (£5.00) 20,21 midnight • The Aug IICast19.30 (21.page15)43£7.00 (£5.00) • Ceilidhs 44 (03.00) £6.00 (£4.00) Aug 16,17,24 page midnight • Ceilidhs 44 (03.00) £6.00 (£4.00) Aug 15,22,23,page 29 midnight • Aug Dave11White and30)Donny 21.45 (23. £6.00O’Rourke (£4.00) page 43 • Aug Deaf9,16Shepherd page 43 21.45 (23.30) £7.00 (£5.00) • Aug Donald Black(23.and30)Malcolm 10 21.45 £6.00 (£4.Jones 00) page 43 • Aug Drop28themidnight Box (01.page 44 (£5.00) 30) £7.00 • Aug Duncan Chisholm Ivan(£5.Drever 21 21.45 (23.30) &£7.00 00) page 44 • Aug Ella 9,10,13-17,20-24,27-30 Fitzerald A Tribute 00.page 15 (01.4315) £7.00 (£5.00) • The Finest Acoustic Music21.30 Sessions Aug 8-10,13-17,20-24,27-30 (03.00) Freepage 44 • Aug Flook!26 midnight page 44(01.30) £7.00 (£5.00) • The 43 (£5.00) Aug 14,Folk17 Divas 19.30 (21.1page 5) £7.00 • Aug Ian Carr Karen(£5.Tweed 13 19.(guitar) 30 (21.15)& £7.00 00) (piano-accordian) page 43 • Aug Inner28,29 Sense21.4Percussion Orchestra 5 (23.30) £8.00 (£6.00) page 44 • Aug Bert28Jansch 44 (£5.00) 19.30 (21.page 15) £7.00 • Jock page00)44 Aug 20Tamson’s 21.45 (23.Bairns 30) £7.00 (£5. • Aug Keep9 It19.30(21.15) Up! page£7.00 43 (£5.00) • Jackie 44 (£5.00) Aug 22 Leven 21.45 (23.3page 0) £7.00 • Aug McCalmans 15,16,21,22,23page19.3430 (21.15) £7.00 (£4.00) • Tony Aug 24McManus 19.30 (21.15) page £6.0044(£4.00) • Aug Mad 19Pudding page midnight (01.30) 43£7.00 (£5.00) • Aug Michael 18,19,Marra 20 19.30 (21.page15)43£7.00 (£5.00) • The Sangs-The LivingTradition page 44 Aug 29Muckle 19.30 (21. 15) £7.00 (£5. 00) • Aug Mystery Juice (01.page 43 (£5.00) 14 midnight 30) £7.00 • Aug Northlands page(£4.44 00) 27,28 12.Festival 30 (13.30) £6.00 • John page (£5. 44 00) Aug 27Renbourne 21.45 (23.30) £7.00

• Aug Salsa9,10Viva23.30 page (03.00)43Band £5.00 (£4.page 00) • The Aug 25Sandy 21.45Brechin (23.30) £7.00 (£5.00) 44 • Aug Seelyhoo page 43 18,19 21.45 (23.30) £7.00 (£4.00) • Sgathach Aug 24 21.45 (23.page30)44£7.00 (£5.00) • June Tabor19.30 page Aug 25,26 (21.1445) £8.00 (£6.00) • Tannas Aug 14 21.45page(23.4330) £7.00 (£5.00) • Whose page(£4.4300) Aug 14-17,Solo21-24is it23.Anyway? 15 (00.15) £6.00 • Aug Richard Wood page 44 26 21.45 (23.30) £7.00 (£5.00) • The Aug Wrigley 17 21.45 (23.Sisters 30) £7.00page (£5.0430) Talks <£ Events • Classic FM Live(01.at3The Famous Grouse House Classic FM page 64 Aug 18 midnight 0) £3.00 Theatre • Awarehaus page(£4. 85 00) Aug 21 -26 12.Theatre 15 (13.15) £6.00 • Aug Bowhouse Project page 85 21-30 12.00 (13.00) £5.00 (£3.00) • Aug Burns9-30For(notBreakfast 18,26) 10.30 page (11.3830) £5.00 • Aug Californian 9-30 (notPoppy 18,26) 19.page 00 (20.8300) £8.00 (£6.00) • Columcille Aug 8-17 17.3Stray 0 (18.Theatre 50) £7.00Company (£5.00) page 105 • Cruising Gallus25)Theatre Aug 21-30-(not 17.00 (18.Company 15) £7.00 (£5.0page 0) 83 • Aug Fishtales 10-19 13.Rowan 00 (14.Tree00)Company £6.00 (£4.00)page 103 • Aug Life 20-30 and Death in Milton 10.15 (11. 20) £5.00Keynes page 83 • Aug Mad9-30Grassmarket (not 18,26)Project 14.00 (15.page30) 88£7.00 (£5.00) • The Merchant page00)83 Aug 21-30 14.15 ofVenice (16.15) £6.00 (£4. • Aug Parallel 25-30Lines 20.45 (21.page 45) 85£8.00 (£6.00) • Smart Aug 10-30Women, (not 18,Stupid 26) 22.30Choices (23.45) £6.00page(£4.8500) • The Story(notof 18,the26)Fallen Aug 8-30 19.45 Hero (20.45)Guandaline £8.00 (£6.0Sagliocco 0) page 88 • Tales Aug 9-18From17.1a5Traveller (18.20) £7.00Les(£5.Enfants 00) Terribles page 93 • The Tragedy of Man20.30Hungarian Aug 9-23 (not Suns) (22.00) Overtures/ £8.00 (£6.00)Merlin Int.Theatre page 89 • Vagabond 85 (£5.00) Aug 20-30 17.John30 (18.3page 0) £7.00 Food and Ent: drink:3 ydBar,3 Str.Access cafe and Scottish/International Disabled: to cafe/bar only. restaurant 9.30am-2.30am Footlights and Firkin Venue 85 7 Spittal Street Tickets 229 8368 Box Office: I pm - 2pm and 6pm - 8pm Comedy & Revue • Peter BuckleyHilHillpage And13Some Comedians - Free Again Peter10-30 Buckley Aug 21.25 (22.25) Free • Aug Slap8-14,17-21,24-28 Slap Slap Firkin20.00 Fringe 0page 19 Aug 15,16,22,23,29,30 20.00 (21. (21.00)0) £3.00 £3.50 Food and Fuldrink: Publicfacilities. house with bar snacks Disabled: l disabled

k?

BUS INFORMATION LRT 0131 555 6363 (24 hours) SMT 663 225 92333858 Traveline01310131

127


Music • Aug Shambhala 25-30 16.00 page (17.25)56 £5.00 (£4.00) • Aug Shiho11-23Sound (notJapanesque 17) 18.00 (19.00)page£5.5056(£4.50) Theatre Fringe Club lii • Aug Chaucer the (22. Sky30)with£5.50Diamonds 25-30 in21.00 (£4.00) Modernising Theatre Company page 94 Venue 2 Teviot Row, Bristo Square. Tickets 226 5138 in Love -05Howard Brenton Asylum Theatre Company page 72 Box Office:to the7pmepicentre - late. of the Fringe and Festival City.The largest arts festival on Earth • Christie Preview Aug 10 00. (01. 0 0) £3.50 Welcome Aug 12,14,16,19,21,23,26,28,30 00.05(£2.(01.50)00) £4.50 (£3.50) squeezes into one three-storey building: with music, club nights, international comedians, • Goodnight Desdemona (Good Morning great British theatre and the pick of the Fringe. The page Juliet) 108(£4.50 C) Aug Totally 10-23 15.Portable 15 (17.Theatre 15) £6.50Company (£5.00 SUOD) Comedy <£ Revue • Aug Have11-30 You (not SeenSuns) My Pussy? Mirador Productions • Aug Fringe11-30Club21.30Cabaret Fringe Club page 19 22.45 (23.55) £6.00 (£4.00) page 94 (23.30) Free with Fringe Club Membership • Oleanna Atlantic CTC page(£3.7200) • Omid Djalili is Ethnic page 29 Aug 25-30 10. 1 5 (12. 1 5) £4.00 Preview Aug(not8 21.20 (22. 20)(22.£5.0020) £7.00 (£6.00) • Aug Othello - William Shakespeare Asylum Theatre Company page 72 Aug 9-29 13, 2 8) 21.20 10 12. 3 0 (14. 5 5) £3.50 Aug 30 22.30 (23.30) Aug 11-30 (not Suns) 12.30 (£2. (14.550)5) £6.50 (£4.50) • Aug Suffer11-15the 10.Children Music 30 (11.50)Gresham’s £5.00 (£2.Youth 50) Theatre page 88 • Acoustic FringewithClubFringepageClub49 Membership • Tapestry Fresh Blood Theatre page Aug 10,17,2Underground 4 23.00 (02.00) Free Aug 18-23 10. 3 0 (12. 1 0) £4.00 (£3. 5 0) 86 • Aug The 21Beatles ClubFringe pageClub 49 Membership Aug 25-30 17.40 (19.20) midnightBeat(late)Fringe Free with • Threads of Life The Works Theatre page 112 • Aug BigVern‘n’the Club Club pageMembership 49 Aug 8,9,25-30 15.00 (16.00) £4.00 (£3.5Company 0) 23,24 midnightShootahs (late) Free Fringe with Fringe • Two Jim Cartwright Asylum Theatre Company page 72 • Aug Big Wednesday Fringe Club page 49 Aug 5 (20.Suns) 55) £3.50 8,15,22,29 11.00 (late) Free with Fringe Club Membership Aug 1011-3019.3(not 19.35 (£2. (20.550)5) £5.50 (£4.50) • Aug Boogalusa Fringe Club page 49 14,29 midnight (late) Free with Fringe Club Membership Disabled: Good disabled access. • Cat Fever(late)FringeFreeClub page 49Club Membership Aug Scratch 16,17 midnight with Fringe • Aug Dawntreaders Fringe Club page 49 George Square Theatre Mi2 16 20.00 (21.30) £6.00 Venue 37 George Square. 650 2001 (pre 6 Aug 651 1332 10am -5pm) • Aug Fiesta8,9,Latina page Fringe 49 Club Membership Box Office: 10.30am - I I pmgreatTickets (phones till 8.30pm) 10 2 i .30 Fringe (02.30)Club Free with Great theatre, great comedy, atmosphere.The new look George Square Theatre • Aug Fringe8-30Club FringewithClubFringepageClub49 Membership brings you the best of the Fringe. Relax and enjoy. 22.00Disco (late) Free • Gods Comedy <fi Revue Aug 23Boyfriend 20.00 (21.30)Fringe £6.00Club page 49 • Alibis for 20.Life15by(21.Sean Hughes • Aug The 15Humpff Family Fringe Club page 49 Aug 15-29 30) £9.00 (£8.00)Sean Hughes page 24 midnight (late) Free with Fringe Club Membership • Bill Bailey page 11 • Kenny Young & the Eggplants Aug 18-29 21.45 (22.45) £9.00 (£8.00) Kenny Young18,and20-22,The24-27, Eggplants:The Aug 29,30 21.00Eggplant (22.15)Evolution £6.00 Tour page 5 / • The Umbilical Brothers are back with ‘Don't Explain’ Aug 16,15,2137,22.30 (23.45) £6.00 Gilded8-17 Balloon Aug 21.45 (23.page00)23£8.50 (£7.50) • Lajko Felix and Lorinszky Attila Hungarian Overtures/ Merlin International Theatre page 51 Dance/Physical Aug 12-14 20.30 (21.45) £6.50 (£5.50) • The Brothers 49 • Aug Bodies15,1Electric 34 (£3.00) Aug 20McCluskey midnight (late) Free withFringe FringeClubClubpage Membership 6 12.30 (13.3page 0) £5.00 • Aug Pearlfishers pageFringe 49 Club Membership • Aug Kosh20-29 Kabaret present Three(£6.Point 28 midnightFringe (late) Club Free with 18. 3 0 (19. 4 0) £8.00 00) Turn Gilded Balloon page 35 • The Men(late)FringeFreeClub page 49Club Membership • Scottish-American Ballet page 37 Aug 27,Porridge 30 midnight with Fringe Aug 9-14 20. 1 5 (21. 2 0) £6.50 (£5. 0 0) • Aug Sola22 Fringe midnightClub(late)pageFree49with Fringe Club Membership Theatre • Tympanal! Fringe(02.Club00) page 49 Fringe Club Membership • Antigone Aug 11,18,25 23.00 Free with Aug 8-18 18.Teatr 15 (19.Ludowy 30) £8.50- Krakow, (£7.50) Poland page 106 • Aug The 20-29 Fall of14.the30 (16. House of Usherettes Talks <& Events 0 0) £7.50 (5.50) Forkbeard Fantasy page 86 • Aug Fringe23 Annual • They Shoot Horses, Don’t They? 11.00 (14.General 00) Free Meeting Fringe ACM page 66 National Youth Theatre of Great Britain page 95 Aug 00)0£5.00 • Aug Studio18-29at 9.the30 Fringe Aug 89-1715.015.0 (17. 00 (17. 0) £8.00 (£6.00) (19.00) FreeRoyal National Theatre Studio page 66 Food and Not drink:accessible Tea, coffee,for icewheelchairs creams andor snacks frommobility 12 noon,difbarficulfrom 5pm dogs til late Theatre Disabled: those with ty. Guide • Aug Forbidden Fruit Nottingham Playhouse Roundabout TIE page 95 admitted to auditorium. 00)0£5.00 Aug 23,26-29 23,24,26-2914.018.0 0(15.0 (19. 0) (£2.50) • Aug Les Miserables 10-30 (not 18,Red 25) 16.Shift00Theatre (18.30) Company £8.50 (£6.50)page 103 The38Gilded Balloon Theatre Ki2 • Trust page(£5.7750) Venue 23310amCowgate. Aug 9-26Byron (not 18)George 18.00Costigan (20.30) £6.50 Box Office: - I am. Tickets 226 2151 Food and Nearest drink: Cafe, Licensed BarsKitchen and Restaurant fromto 10am Children’s Shows Disabled: access from rear. lift+18available getM to+25tiltoplate. floor (Cabaret • Aug Magic8-17Bob’s for Kids Hal l ) . Ent: 50yd 7+1+2 Str partial HR WC (W Sp HR 25” Sp HR 25”).Aud: 11.00Cabaret (12.00) £5.00 (£3.00)Gilded Balloon page 7 numerous stairs and several floors. Help available. Guide dogs admitted. Comedy & Revue The 8-30 Act (notEd Byrne page(£5.17 50) The81 Garage K9 • Aug 11,18,2&8)Brendan 16.00 (17.Burns 00) £6.50 Venue Grindlay CourtTheatre Centre, Grindlay St Tickets 228 2215 • The Angie(notLe11,Mar18,2Show Angie Le £7.50 Mar (£6. page50)26 Box Office: 10am midnight Aug 8-30 8) 21. 3 0 (22. 3 0) Presenting exciting performances and15attractions thatfrom include:thedrama, dance, music and • Aug Best8,9,13-16,21-24,26-30 of So You Think You’re Funny? So You(£6.Think The Purple Turtle’ cafe/bar. Located minutes walk Fringe Office i n a courtyard 22. 1 5 (23. 4 5) £7.00 00) You’re Funny? page 32 opposite the Lyceum; neighbouring the Usher Hall, the Traverse and the Filmhouse. • Aug Bunty8-30the(notBouncer Neptune Theatre Liverpool 12,26) 23.45 (00.45) £6.00 (£5.00) page 27 Comedy <£ Revue • Aug Ed Byrne: page(£6.13 50) 8-30 (notPsychobabble 11,18,28) 21.00Ed(22.Byrne 00) £7.50 • Aug Bea 8,9,11,13,15,17,18,20,22,24,25,27,29 Love at Midnight page 12 midnight (01.00) £4.50 (£3.50) • The Comedy Storm Gilded(£5.Balloon page 20 Aug 8-30 20.00 (21. 0 0) £6.50 5 0) Dance/Physical • Dave Johns - 22.On1The Edge page 16 Preview Aug 8 5 (23. 1 5) £3.50 • Ceremonial Lusty25)Juventus Aug 9-30 (not 13,28) 22.15 (23.15) £6.50 (£5.50) Aug 15,16,18-23Kisses 21.10 (22. £5.50 (£3.page 50) 36 • Aug Frans27-30 Ruhl23.30 Presents (00.30)Amsterdam £7.00 (£6.00)Comedy Explosion Gilded Balloon page 20 128


• • • • • • • • • • • • • • • • • • • • •

Glub15-23 Glub!14.1Yllana Aug (15.310)5)page£7.0033 (£6.00) Aug 24-30 16.350 (17. Hey Gringo Stephen Frost (£5.page00)19 Aug 8-30 13.15 (14.15) £6.00 Ian Stone Bit of Didley Squat page 24 Preview Aug 9-30Aug(not8 21.13,128)5 (22. 21.1155)(22.£3.5015) £7.00 (£6.00) InAugLove 2 with Janie Anderson 8-30 17.00 (18.15) £7.00 (£6.0and 0) Gregg Fleet Gilded Balloon page 20 JillAugPeacock&Viv in Burns 8-30 16.15 (17.1Gee 5) £6.00 (£5.00)Baby Burns Gilded Balloon page 20 The Johnny Aug 8-30 (notVegas 11,18,Show 28) 22.4Johnny 5 (23.45)Vegas£7.50page (£6.5330) The Late,15.Late, Breakfast Aug 8-30 30 (16.Late 45) £7.00 (£6.00)Show Gilded Balloon page 20 Late8-30 ‘N’ Live page 20(£8.00) Aug (not 22)Gilded 01.00Balloon (04.00) £10.00 Donna McPhail page 26 Aug 17-23 20.45 (21.45) £8.50 (£7.00) Marion off (£5. Gilded Aug 8-30Pashly 17.15 (18.Pulls15)it£6.00 00) Balloon page 20 Matt8-30King18.in30La(19.La30)Land Aug £7.00 Gilded (£6.00) Balloon page 20 Miss8-30 Itchy’s18.3Bastard Aug 0 (19.30) Breakfast £6.50 (£5.5Show 0) Gilded Balloon page 20 Nicole8-30Bunting Aug 18.45 (19.- In45)the£6.00Thighs (£5.00)of the Beholder Gilded Balloon page 20 Rich8-30 Hall’s(notLouisiana Aug 12,24) 22.00Hayride (23.15) Gilded £7.50 (£6.Balloon 50) page 20 Shelagh Martin Expands Shelagh Martin Aug 8-30 (not 11,26) 16.00 (16.30) £3.50 page 27 Simon Balloon(£5.page Aug 8-30Lipson (not 18,in26)Pieces 19.45 (20.Gilded 45) £6.50 50) 20 SoHeats:YouAugthink10-12, You’re Funny? page 32 (£5.50) 1 7-20 22. 1 5 (23. 4 5) £6.50 Final: Aug 24 20.45 (22.45) £8.50 (£7.50) ATaste Aug 8-16of20.D’Unbelievables 45 (21.45) £7.00 (£6.Gilded 00) Balloon page 20 Terry Neptune Theatre(£5.Liverpool Aug 8-30Titter’s (not 12,Full26)Length midnight (01. 00) £6.00 00) page 29 Tommy page50)33 Aug 8-30Tiernan (not 28) 21.& Jason 15 (22.Byrne 30) £7.50 (£6. Vladimir McTavish in20 101 Great Moments in Scottish Sport Gilded8-30Balloon Aug (not 12,page 28) 22.30 (23.30) £6.50 (£5.50) Music • The Gadflys Gilded Aug 8-30 midnight (04.0Balloon 0) £6.50 page (£5.5490) • Aug Labi25-30 Siffre-A Day In The Knife 20.45 (21.45) £7.50 (£6.50)Gilded Balloon page 49 • Aug Paul8-1Capsis Balloon 1,13-17,returns 19-21,2in3-26Cabaret 23.30 (00.Gilded 30) £7.00 (£6.00)page 49 Theatre • After Aug 8-30Penny 17.30 Gilded (18.30) Balloon £6.50 (£5.page 50) 87 • Barry Sorts It19.Out page 73 Preview Aug 8 4 5 (20. 5 5) £4.00 Aug 9-30 (not 13,28) 19.45 (20.55) £7.50 (£6.50) • Aug Behind the Aquarium at 12.the30Last 8,10,12,14,16,18,20,22 (13.55)Pizza £6.00Show (£5.00)Gilded Balloon page 87 • Aug Beowulf Gilded Balloon page 87 9,11,13,15,17,19,21,23 12.30 (13.55) £6.00 (£5.00) • Cat A Theatre Daylight Aug 8-30 18.30 (19.Company 30) £6.00- (£5. 00) Robbery Gilded Balloon page 87 • AAugClockwork 8-23 15.45 Orange (17.15) £6.50Gilded(£5.5Balloon 0) page 87 • C’mon Balloon(£5.0page Aug 8-30Black 12.45 (14.Gilded 15) £6.00 0) 87 • Jump! Crying i n Public Places page Aug 8-30 (not 11,18) 19.15 (20.20) £8.0078 (£6.00) • Aug Leonardo Stephen 8-24 17.Was 15 (18.Right 30) £6.50 (£5.5Frost 0) page 86 • Aug Love8-30 Theatre (not 18)Company 14.30 (16.presents 00) £6.50Monsters (£5.50) Gilded Balloon page 87 • Aug Road8-30Rage17.45Gilded Balloon page 87 (19.00) £7.00 (£6.00) • Soldier Aug 9-30On(notA 18,Monday 25) 14.30Gilded (15.45)Balloon £6.00 (£4.page00)87 • Unidentified Human Remains and The True Nature of Love Gilded Balloon page 87 Aug 8-23 13.30 (15.15) £6.50 (£5.50) • WordPlay Aug 15-24 12.0Sol0 (13.Survivor 00) £5.00page(£3.10400) Food and drink: Licensed bar, snacks and refreshments all day. Disabled: Aud: 12 yd Studio: Flat WCEnt:2yd (W + M)Flat.Aud: 10yd WC (W + M).Theatre: Ent: lyd Flat. NON SMOKING? Shows may be held in venues where smoking is allowed. Call the venue to check.

Gilded Balloon Venue 36 People’s Palace, OldIIFishmarket Close Tickets 226 2151 kii Children’s Shows • Aug Moondance 16-23 11.00Gilded (11.45)Balloon £4.00 (£3.page00)1 Comedy <£ Revue • Aug Best8-30 of Scottish 20.45 (21.4Gilded 5) £7.00Balloon (£6.00) page 21 • Aug Frankie & Ruby Slippers 8-30 Boyle 20.45 (22. 00) £6.50 (£5.50)in Scots Pished Gilded Balloon page 21 • The Gents(not Gilded Aug 8-24 19) 15.Balloon 45 (17.00)page£6.0021 (£5.00) • Aug Hello,8-30We’re Balloon(£5.5page (not the 12,26)Nualas 20.15 (21.Gilded 15) £6.50 0) 21 • Aug Kamikaze Freak Show Gilded Balloon page 8-30 (not 12,19,26) 23.30 (01.15) £7.00 (£6.0210) • Aug Kookie16-30presents 11.45 (12.Anthem 45) £6.00For(£5.Doomed 00) Youth Gilded Balloon page 20 • Aug Leandre, Gilded(£5.Balloon 25-30 Mes 17.15Lunatic (18.30) £6.00 00) page 21 • Aug Logan8-30Murray in Uncle Ron Explains It All00) Gilded Balloon page 21 (not 19,28) 19.30 (20.30) £6.00 (£5. • Aug Mothers Unleashed present Perineum 8-24,28-30 17.00 (18. 00) £6.00 (£5.00) Intact-A Gilded Balloon page 21 • The Nimmo Posh (£5. Spice00) Nude! Gilded Balloon page 21 Aug 8-30 13.30Twins (14.30)in £6.00 • Aug The 8-30 Oxford Revue Gilded Balloon 17.45 (19.00) £6.50 (£5. 50) page 20 • Aug Phil 8-30 Nichol18.1is5 a(19.Spy15) £6.00 Gilded(£5.Balloon 00) page 21 • Taika Aug 8-30& Jemaine: 23.30 (00.4Humourbeasts 5) £6.00 (£5.00) Gilded Balloon page 21 • The Three19.Canadians in Ben(£6.Hur-The Aug 8-30 15 (20.30) £7.00 00) Epic Gilded Balloon page 21 • Tina C inmidnight Rhinestone Aug 8-30 (01.30)Cowgirl £6.50 (£5.Gilded 50) Balloon page 21 • Young, Green(23.15)Young, Aug 8-30Gifted (not 28)and22.00 £7.50Gifted (£6.50)& Green page 33 Dance/Physical • Aug De Morochas, Pelandrunas Gilded Balloon page 35 8-30 13.00 (14. 00) £6.00 (£5.y Abacanadas 00) Theatre • Aug Brighton Theatre 8-30 (not 20,27)Events 14.15 (15.present 30) £7.00Kiss(£5.and00)Tell Gilded Balloon page 88 • Aug It’s Uncanny! The Weird Sisters page (£5. 11200) 8-30 (not 12,26) 12.00 (13.15) £6.00 • Aug KC Productions Gilded00) Balloon page 87 8-30 (not 19,2presents 4) 15.00 (16.Silly15)Cow £6.00 (£5. • Aug Lippy10-30 presents Nine45)lives,Ten 14.45 (15. £6.00 (£5.Tales 00) Gilded Balloon page 88 • Aug The 8-30 MC 22.of 4a5Striptease Act Doesn’t (23.45) £6.50 (£5.50) Give Up Gilded Balloon page 88 • Aug PMTTheatre I’m00)OKYou’re OK Gilded Balloon page 87 8-30 13.00 Co (14.3Presents 0) £6.00 (£5. • Still Game18.45Gilded Aug 8-30 (20.00)Balloon £6.50 (£5.page50)88 • Weetzie Bat 12,Gilded Aug 8-30 (not 26) 16.Balloon 30 (17.30)page£6.5087 (£5.50) • WordPlay Aug 25-30 15.4Sol5 (17.Survivor 00) £5.00page(£3.10400) Disabled: Details not available Graffiti gis Venue 90 Corner Broughton and East London Streets Tickets 557 8330 Box Office: I I am 2am Firmly established as the celebratory heart ofthethe300Festival, Graffiti comprisesdream upstairs a 600 capacity celestial ex-church and downtstairs rendezvous an enormous sunny sunken gardencapacity repleteCafewithGraffiti market, marquee, restaurant andabutting free entertainment. Comedy & Revue • Marvin Hanglider - The Power of Negative Advertising Highly23,Recommended Aug 24 14.30 (15.30)page £6.0023(£5.00) DancelPhysical • Aug Devadasi 18-21 14.Devayani 30 (15.30)page£4.0035(£3.00) • Like a Goddess Aug 25-30 18.00 (19.- Bharata 15) £6.00Natyam (£5.00) Dance Devayani page 35 • Shakti in22.Tibetan Book of the Aug 8-14 0 0 (23. 0 0) £6.00 (£5. 0Dead 0)00) Shakti page 37 Aug 15-30 22.0- 0Jazz(23.0Hoofer 0) £7.00 (£6.page • Will Gaines Aug 7-30 (not Mons) 17.45 (19.00) £5.5037 (£4.00) GRAFFITI continues over the page 129


GRAFFITI continued Music • Acoustic Mania(21.Antonio Fordone & Neil Stacey page 38 Aug 0) £7.00(£5. (£6. Aug 13-17 16 14.320.30 0 (IS.30)3£6.00 00)00) • Antonio Fordone Trio Antonio Forcione Aug (21.330)0) £6.00 £7.00 (£5. (£6.000)0) & Neil Stacey page 38 Aug 23,19-2224 20.30 14.30 (15. • Apu - Dancing Aug 14-17, 21-24 with 18.00the (19.4Inca 5) £6.00page (£5.0380) • jane Bom-Bane Aug 6-30 16.00 (17.00)page£5.0040 (£2.50) • Aug Club Graffiti Cafe Graffiti pagemidnight 40 (03.00) £5.00 (£4.00) Aug 3,5-7,10,12-14,17,19-21,24-28 1,2,8,9,15,16,22,29,30 midnight (03.00) £6.00 (£5.00) • Aug Flamenco Puro11,18)Azabache: Cuadro Flamenco de Diego Mora page 40 8-30 (not 19. 1 5 (20. 3 0) £6.00 (£5. 0 0) Aug 16,17,23,24 16.00 (17.15) • Aug Grand Graffiti Cafe23.1Graffiti 40 00)page£8.00 Aug 8,21,92,12,5,2146,23.29,1350 (03. 050)(03.£10.00 (£8.00)(£7.00) • Herbie Flowers with Marvyn Hanglider Highly8-22Recommended page 50(£5.00) - My Mum’s aYoghurt Aug 14.30 (15.30) £6.00 • Aug Hot 19-24 Club Jazz Kimbara page 52 18.040 00.(20.The1500)(01. Free Brothers Aug Aug 2219,00.20,1251,2(01. 15) £6.0015)(£5.£5.00 00) (£4.00) • John’s Dances Aug 16-22Book12.of30 Alleged (13.45) £5.00 (£4.00)Mr McFall’s Chamber page 53 • Leicestershire Arts Symphonic Wind Band & Youth Dance Festival of British Youth Orchestras Aug 25 12.00 (13.45) £3.00 (£1.00 OAPpage& 46Stage Pass) (Free SUDC) • Aug Mike Hatchard’s 8 23.00)Piano 15 (00.Recital 15) £5.00 Highly (£4.00)Recommended page 50 Aug 11,15 116.2,107,0 1(17. • Aug Oxford18-23Concert Party Europe’s 12.30 (13.45) £6.00 (£5.00)only Baroque & Tango Orchestra page 54 • Aug The 20,26-29 Russian 23.30 Gypsy(00.Band 40) £8.00Loyko(£7.0page 0) 52 • Tango Palace Sexteto Canyengue page 56 Aug Aug 21,22,24 25-30 20.0023.00(21.(03.30)00)£8.00£10.00 (£7.0(£8.0) 00) • ATribute to Maxine Daniels Highly Recommended page 50 Aug 8,13,9,1141,23.12 120.00 (21. Aug 5 (00. 30)415)5) £6.00 (£5.00) Aug 15-17, 2 4 12. 3 0 (13. Aug 18-20 16.00(17.15) 18.00 (19.15) Aug 21,22 • Wake Up Dead HankWangford page 58 Aug Aug 23,24 25 23.3020.1(01.5 (21. 00)45) £8.00 (£7.00) Musicals/Opera • Oz King(notof Clubs Aug -8-30 11,18,23)Ozmosis 21.15 (22.Productions 25) £6.00 (£5.page00) 62 Theatre • Aug The 1-7Kerouac Triangle Light page 77 19.30 (20. 50) £6.00City(£5.22.40 00) Productions Aug 9,10,12-17,19-22,24,26-30 (midnight) Food and GraffithAccess drink: Licensedthrough bars, cafefrontanddoors. gardenCaferestaurant GraffitkAccess through car park. Apply forDisabled: assistance at main entrance. Greyfriars Kirk kii Venue 131 1/2Greyfriars Place,performance. Candlemaker Row. Tickets 225 1900 Box Office: hour before Edinburgh’s first ofReformed (1620).funerary National monuments. convenant signed in 1638.BobbyScotland’s finest collection 17th andChurch 18th century Greyfriars - world famous dog - original tours throughout the portrait.Varied festival. programme of concerts, organ recitals and guided Music • Choral Masterpieces of Five Ex Collegio page5Centuries Aug 16 20.30Cantabrigiensi (22.00) £5.00 (£2. 0)42 • Aug Haydn/Mozart Philomusica of Edinburgh 21 20.00 (21.30) £6.00 (£3.00 C) page 54 • The Lied Trio Plays Beethoven Aug 9 19.30 (21.00) £4.00 (£2.50) to the Beatles The Lied Trio page 52 • Aug LucaVillani 17,18 21.00Philomusica (22.00) £7.00of Edinburgh (£5.00) page 54 • Aug Mahler: Symphony No 7 (£6.00 ScottishOAP)Sinfonia 24 17. 0 0 (18. 3 0) £6.50 (£4.00 page C) 56 Aug 25 20.00 (21.30) • Vivaldi - The(21.Four30) Seasons Aug 14 20.00 £6.00 (£3.00Philomusica C) of Edinburgh page 54 Disabled: Flat access to Church and toilets. 130

Greyfriars Kirk House ki i Venue 28 Candlemaker Row Tickets 225 3626 Box Office: 10.30am I I pm ThetheFringe thefromheartBritainof theandFestival’ presents another stunning programme ofdelicious bestvegetarian iVenue n theatreatmeals available on thearound Fringe!the world.Visit our cafe for the most Theatre • Aug Bite Me (not AngelSuns) Fish Theatre page 70 (£4.00) 20.45 (21. 35)Theatre £5.00 • Aug Blude11-30 Red AFG (Cutting Edge 11-16 18.15 (19.50) £5.00 (£3.00) Company) page 68 • The Travelling Theatre page 75 Aug IEpic 1-23 of(notGilgamesh 17) 16.40 (18.Bristol 00) £4.00 • The Aug IFire 1-23 Poet (not IT)Philip 20.10Wells(21.10)page£4.00112(£3.00) • Aug The 18-30 Imaginary of Eternal (not 24)Invalid 18.15 (20.Theatre 15) £6.00 (£5.00)Values page 107 • The Island12.Theatre Simplicite Aug 25-30 45 (14.15)De£5.00 (£4.00)page 107 • Aug The 25-30 Last Suit The40)Blasted 16.50 (17. £4.50Heath (£3.00)Players page 74 • Aug Machinal Penn Theatre Ensemble 25-30 10.45 (12.25) £3.00 page 97 • Aug Mad 11-23 Forest(notNottingham 17) 23.10 (00.University 40) £4.50New (£3.Theatre 50) Company page 96 • Aug Oblivious 18-30 (notWith24)Wings 14.50&(16.Nemesis 00) £5.00Theatre (£3.00)Companies page 112 • Aug One 11-23 Of The(notBoys 17) 15.Straight 20 (16.2Up0) Theatre £4.50 (£3.Company 50) page 105 • The Paradox of Insanity!pageI Mean Humanity!! Seventh Son Productions 103 Aug 11-30 (not 17,24,28) 21.30 (22.45) £5.00 (£4.00) • Aug Pinter11-23Revue! Company (not 17)Smashing 11.35 (13.Theatre 15) £5.00 (£3.50) page 104 • Aug Playing the Game Jacknife page 90 11-30 (not Suns) 13.35 (14.45) £4.50 (£3.50) • Aug Pots 11-16 of Red15.Jam 00 (16.Red 00) Jam £5.00 page (£4.00)103 • Aug Report18-30for(notan Academy 24,28) 22.10 Mathis (22.50) Schrader £5.00 (£3.0page 0) 94 • ToAugBe11-16Remembered The Underground 19.00 (19.40) £4.00 (£3.00) Theatre Company Ltd. page 110 • Two Bold(not As Brass Aug 18-30 24) 18.Entertainment 10 (19.50) £5.00page(£4.7400) • Wardrobe Company Aug 11-23 (notMan17) Loaded 17.00 (17.Theatre 40) £4.00 (£3.00) page 93 Food and drink: Unlicensed vegetarian cafe Disabled: Ent: 2yd 22 Str partial HR.Aud: 7yd FlatWC (W/M both 22 Str 6yd) Guildford Arms Venue 107 I West Register St.(off East End Princes St) Tickets 556 4312 Music • Aug Stephen Caledonian 18,20 Carroll 20.00 (midnight) Free Folk At The Guildford page 41 • Holyrood Slim andTheGuitar Junior Caledonian Folk At Guildford Aug 19 20.00 (midnight) Free page 41 • Aug Scalded Cats Caledonian Folk 14,22 20.00 (midnight) Free At The Guildford page 40 • Tandem Aug 15 20.00Caledonian (midnight)FolkFreeAt The Guildford page 40 • Waykis Folk AtFreeThe Guildford page 40 Aug 16,21 Caledonian 20.00 (midnight) • Aug MikeWhellans CaledonianFreeFolk At The Guildford page 41 17,23 20.00 (midnight) Food and Details drink: not Licensed Disabled: availablebar, food.

112

Harry Younger Hall jis Venue 13 Lochend Close, Canongate Box Office: 9am - 9.30pm Children’s Shows • Aug Theatre Venue30) 13£1.00page 9 25-30Train 10.30 (11. • Aug Tom8-23 and 10.the00Magical Flower(£2.5Venue (11.20) £5.00 0) 13 page 9 Theatre • Aug Eleemosynary 13 page 8-30 14.15 (15.Venue 30) £5.00 (£4.00)111 • Aug Faust8-30Flambe! 13 page 16.20 (17.Venue 30) £5.00 (£4.00)111 • Aug 50 Ways 7-23 21.to 4Kill5 (22.Your15) Lover £4.00 (£3.Venue 00) 13 page 111 • Aug Hopscotch Venue 13 page 111 (19.Yankee 00) £4.00Doodle (£3.00)Dandies (on the same night) £5.00 (£4.00) Double10-16Bil 18.with05 The • Aug Lives17-23 Worth18.0Living Venue 13(£3.page 5 (19. 0 0) £4.00 00) 111(on the same night) £6.00 (£5.00) Double Bil with Wrestling With Demons • Aug Marriage of Convenience Venue 8-23 12.15 (13.30) £5.00 (£4.00) 13 page 111


• • • •

Small18-23Change Venue £5.00 13 page Aug 20.20 21.30 (£4.01110) The Strange Case of Dr jeckyll and Mr Hyde as told to Carl Jung Venue 13 page 111 Aug 8-16 20.15 (21.30) £5.00 (£4.00) Wrestling With Demons Aug 0) £4.00LiVenue (£3. 0)13 thepagesame111night) £6.00 (£5.00) Double17-23Bil 19.with05 Li(20.ves0Worth ving0(on The Yankee Doodle Dandies Venue Aug (20.00) £4.00(on(£3.the00)same13night)page£5.00111 (£4.00) Double10-16Bil 19.with05 Hopscotch Disabled: via Lochend Close: Ent: 2yd I.Aud: 3yd 4 StrWC (W + 2 20”)

Holyrood Park Ki6 Venue 10 foot of Royal Mile. Info 226 5257 or 5259. Music • The Trust-Action Aug 17Prince’s 11.00 (17. 00) Free The Prince’s Trust page 54 <& Events The Haunted Vaults ji2 Talks Fringe Sunday Venue 61 meet outside The Chambers, Street peopled by many • Aug 11.00 (17.00)page Free66 historic RoyalAnCity Mileunderground lies a mazevenue ofHigh vaulted ofaBeneath the cioftyEdinburgh’s ’scaution: deceaseddon’t inhabitants. not forchambers, the faint-hearted, we offer Food and17drink: Snacks, refreshments word get left behind. Disabled: Open air venue. Parking / dropall offdayavailable. Theatre • Aug The Bloody45Chamber Grid Iron Theatre Company page 88 (midnight) The Honeycomb k/2 Aug 7-9I 1-3022.(not Suns) 22.4£5.00 5 (midnight) £9.00 (£6.00) Venue 139 10am-1 36 BlairamStreet Tickets 226 2151 Box Office: Disabled: Due to the uneven nature of the vaults there i s no access for people with disabilities. Comedy & Revue • Adam8-30Hills(not- 12,Stand 19,26)Up17.and15 (18.Deliver 15) £6.00Gilded (£5.0Balloon 0) page 23 Henry*s Cellar Bar ks • Aug Marcus i Venue 162 8-16 Morrison Street Info: 221 1288 Aug 8-30Brigstocke (not 12,28) 19.0page 0 (20.1300) £6.50 (£5.50) • Aug Gregg8-30Fleet’s World Music 20.45 Underwater (21.45) £7.00 (£6. 00) Gilded Balloon page 23 • Aug Hung8-30Le22.30 - Now(23.and30)Zen • Aug Henry’s Bar00) page 50 £6.50 Gilded (£5.50) Balloon page 23 10-30Cellar 12.00 (03. • AAugRight Gala(£5.Evening 8-30 Royal 14.45 Variety (15.45) £6.00 00) Gilded Balloon page 23 Disabled: Details not available Music from 1Kulu Session(£4.0page Hill Street Theatre hio • Jazz Aug 11-14, 7-21,2Presents 4-28 23.30 Jazz (05.0Jam 0) £5.00 0) 51 Venue 41 1910am Hill -Street. Tickets 226 6522 Box Office: 12 midnight. Theatre Home toTomek an incredibleis again 3 Fringe First winning companies in ‘96,theatre HeraldfromAngelaround Award • Gilded Bristol Old Vic page Theatre School presents The Converse is also True winner world. Minutes Bork from Princes host Street,to thean exceptional licensed bararray servesof refreshments until thethe Aug 8-30Balloon 13.30 (14.30)88£5.00 (£3.00) small hours. • The Converse Is Also True Graduating Students page 75 Bristol8-30Old13.Vi3c0Theatre Comedy <£ Revue Aug (14.30) School £5.00 (£3.00) • Aug Caughtt Shortt Sl a p Me Productions presents Kate Shortt page 32 • Mannix Flynn in Talking the0Wall 20-30 18.45 (19.45) £5.00 (£4.00) Aug 8-30 16.00 (17.00) £6.00to (£5. 0) Gilded Balloon page 88 • Aug Chloe10-30Poems in Universal Rentboy Pantomime Prods page 30 (not 17,24,25) 21.50 (22.50) £6.00 (£3.00) Food and drink: Licensed bar Disabled: Details not available Dance/Physical • Aug Cornography Alger50)(USA) page00)36 10-30 (not 17)Kronis 18.00& (18. £6.00 (£4. Inverleith Church Hall A9 Venue 120 45Ferry Roadprior (opp toGranton Road) Tickets 538 6077 Theatre Box Office: minutes performance • Andy and Edie Fireraisers Theatre Company page 85 Aug 10-30 (not 17,28) 22.40 (23.55) £5.00 (£4.00) Musicals!Opera • Cracked Y Touring • Aug Oliver! Forth (21. Childrens Theatre page 61 Aug 19-30 (not 24) 10.Theatre 00 (11.1Company 5) £3.00 (£1.page00) 113 • Aug Dear10-23 Miester Mandela Capab (South Africa) page 76 Aug 9,8-1616 14.19.3300 (16. 440)0) £5.50 (£4.50) (not 17) 14.30 (15.45) £5.00 (£4.00) • Aug Desperate17.Lines page 90 Food and drink: Refreshments at time of performance. (18.115.Imago 0) 4£6.00 Disabled: Aug 9-16 18-30 (not10 26) 0 (16.4(£4.0) 00) Help available.Ent: 70yd 2 Str. Aud: 6yd level. WC 24” (very narrow). Guide dogs admitted. • Aug Elephant Wake Catalyst Theatre (Canada) page 76 10-30 (not 17,26) 19.30 (20.40) £6.00 (£5.00) • Garland Judy with love (21.page25)90£6.00 (£4.00) Jaffa Cake kio Aug 10-30 (not 17) 20.10 Venue 7 28 King Stables Rd Tickets 557 6969 • Aug Holding Hands with 10-16 00.30 (01.20)Angels £5.00 (£4.Theatre 00) West page 107 Music • The The Ghost Aug 11,Last14,Vegas 16,19,2Lounge 1,23,25,2Act 8,30 23.10 (00.10)Road £5.50Company (£4.50) (USA) page 87 • Acid Flux:The Edinburgh New Music Festival page 47 • Aug LrgLotGrtVu (USA)(£4.page Aug 23Brass 20.00 (23. 00) £9.00 10,12,15,18,20,The 22,2Ghost 4,26,29Road 23.10Company (00.10) £5.50 50) 87 • Andy Sheppard & Jazz Jamaica • Aug Maridos y Hujeres (Husbands & Wives) La Folia Teatro (Spain) page 92 Flux:The Edinburgh New Music Festival page 47 18-27 14.00 (15.25) £6.00 (£4.50) Aug IS 20.00 (23. 0 0) £11.00 • Ten Days’ A-Maze, or page the Prodigious Mysteries of the Saragossa Manuscript • Aug Babybird Flux:The Edinburgh New Music Festival page 47 The Cherub Company 76 16 20.00 (23. 0 0) £10.50 Aug 10-30 (not 17) 21.00 (22.00) £7.00 (£5.00) • Composers Ensemble (plus Special Guest Vocalist) • Aug 2lyrs@6.am Theatre(£3.Company Flux:The Edinburgh 24-30 14.30 (15.Ablaze 30) £4.00 00) page 68 Aug 22 20.00 (23.00)New £10.00Music Festival page 47 • Whale Music Stray Dogs Theatre Company page 105 • The Divine Comedy & MichaelFestival Nymanpage 47 Aug (19.255)5) £6.00 (£4.00) Flux:The Music Aug 10-16 18-30 17.18.0355 (18. Aug 12,13Edinburgh 20.00 (23.New 00) £12.00 • Aug East27Coast Flux:The Edinburgh New Music Festival page 47 Food and drink:2ydLicensed bar, snacks and refreshments all day. 20.00Project (23.00) £7.50 Disabled: Flat. Faust21 20.00 Flux:The 25” M secondEnt:floor 25”).Aud: second floor Str HR. Aud: third floor HRWC (W first floor • Aug (23.0Edinburgh 0) £10.00 New Music Festival page 47 • Aug Flux 14-17, Clubs21-24,Flux:The Edinburgh(05.New00) Music Festival page 47 29-31 midnight from £5.00 • Aug Heaven 17 Flux:The Edinburgh New Music Festival page 47 24,25 20.00 (23.00) £12.00 BUS INFORMATION • Steve Martland Band Flux:The Edinburgh New Music Festival page 47 LRT 0131 555 6363 (24 hours) Aug 17 20.00 (23. 0 0) £9.00 SMT 01310131 663 225 92333858 • Teenage Fandub Aug 30 20.00 (23.00) Flux:The £9.00 Edinburgh New Music Festival page 47 Traveline JAFFA CAKE continues over the page 131


Leith Community Education Centre dis VCNUCS Venue 197 Newkirkgate Theatre • The Right 13.Wrong Lawnmowers page 92 Aug 19-22 JAFFA CAKE continued Aug 21-23 19.0000 (14. (20.000)0) £4.00 (£2.00) • Tindersticks Flux:The Edinburgh New Music Festival page 47 Disabled: Details not available Aug 20 20.00 (23.00) £10.50 • Aug Midge29 Ure Flux:The Edinburgh New Music Festival page 47 20.00 (23. 00) £10.00 • Flux:The Urusei Yatsura & MogwaiMusic& Delgados The179Leith Gallery b/9 Edinburgh Venue The Shore Aug 19 20.00 (23.00)New £7.50 Festival page 47 Box Leith Office:Gallery I65lam-6pm • The Wannadies plus support The i s a gallery specialising i n Scottish contemporary art. It i s located beside Flux:The Edinburgh the Water of Leith and The Shore, Leith. Aug 14 20.00 (23.00)New £7.50Music Festival page 47 Theatre Disabled: Details not available • Aug Glasgow 11-23 Girl (not 17)Leith19.Gallery 00 (20.1Productions 5) £5.00 (£3.5page 0) 93 Disabled: Access availibility James Gillespie's High School ns Venue 93 Lauderdale Box Office: 9am - 8pm Street. The Magdalen Chapel kii Musicals/Opera Venue 185 41 Cowgate Info 220 1450 • Annie Stage 84 page 63 Aug 15 (21. Music Aug 11-16 16 14.119.5 (16. 45)45) £6.50 (£4.50) • Isobel13,Mieras The45)Clarsach (Scottish • Aug A Funny Happened 15 20.00 (21. £6.00 (£5. 00) Harp) Society page 41 19-23Thing 19.15 (21. 45) £5.00on(£4.the00)Way to the Forum Union Theatre page 63 • AAugMusical Tour Around Europe The Harp)(£5.Society Food and Ent:ramped drink: Tea andlOOyds+I.Aud:4yd,5Str+5Str coffee at time of performance.FIR. Aug 25Clarsach 20.00 (Scottish (21.45) £6.00 00) page 41 Disabled: • Aug A Scots Clarsach Adapted WC separate building. 14,16Measure 20.00 (21.4The 5) £6.00 (£5.0(Scottish 0) Harp) Society page 41 Disabled: Ent: 4yds Flat 2 Str but ramp available. Aud:accessible 6yds Flat.WC: Fully adapted. Guide Khublai Khan's Mongolian Restaurant dogs welcome, help available on premises, completely for wheelchairs. C20 Venue 186 1243noon Assembly Street, Leith Tickets 555 0005 BoxFringe Office: 12 midnight The75Mambo Club ls Aseaport. debutnotforsample KK’s- situated lOmins drive from Princes St in the heart of Edinburgh’s Venue WestTollcross. Why the Box Office: 10.00pm - 3am Info 229 0469 Mongolian BBQ restaurant. unique dining experience offered by Scotland’s only Music Comedy «fi Revue • The Mambo Club page 5222.00 (04.00) £5.00 (£4.00) • Khublai Khan’sMongolian presents:BBQJames James - The25 Magic of... Aug 7-10, 14-17,21-24,28-30 Khublai Khan’s and Bar page Aug 10-30 (notTues) 23.00 (00.15) £5.00 (£4.00) Food and drink: Licensed andAud: snacks22ydat time performance only. enough for Disabled: Network I Ent: 2ydbar flat. 2 SrtofHR.WC unadapted(wide Food and drink: available show.andLicensed wheelchair Disabled: I step toFoodground floorbefore restaurant theatre.bar during show. help available,users) phone.at Aud. level. Network 2 & 3: totally inaccessible. Guide dogs admitted, La Belle Angele Ki2 Mandela Village ji2 Venue i101 II the Hasties Close, offLBA’s Guthrie Street Venue 103 11Scotsman Market Street Gallery Tucked n behind Gilded Balloon, eclectic mix of l i v e music and late-night dance Box Office: am-1 am clubs continue to grow i n popularity. Recent improvements to the venue and the inclusion of comedy shows make it THE Fringe venue for 1997. The Scotsman Market Street Gallery isfacilities; transformed to represent the New South Africa in one huge exhibits forvenue; youngcatering and old;andopenlicensed throughout theindividual day (andperformances, night!). workshops and Comedy & Revue • The Condos Hey Get a Life! Gilded Balloon page 21 Talks <£ Events Aug 8-30 18.15 (19.15) £6.50 (£5.50) • Aug Mandela Village Arts Out 5Of0) Africa page 64 • Aug Massive (17.03The0)0) £2.50 8-30 Deja-Vu (not 26) 17.Gilded 00 (18.Balloon 00) £6.50page (£5.5210) Aug 8-24 8-24 11.18.0300 (01. £5.00 (£1. (£2.50) • Smiley Aug 8-30in(notConfessions Suns) 21.00of(22.a Catholic 15) £7.00 Buddhist (£6.00) Gilded Balloon page 23 Food and Details drink: not Full available licensed and catering facilities • Sports Revue presents - Don’t Cry for me Gareth Southgate Disabled: Gilded Balloon page 21 Aug 8-30 (not 26) 15.45 (16.45) £6.50 (£5.50) • Stephen Pub(£4.Quiz00) Stephen Frost page 19 Aug 10,17,Frost’s 24 19.30Celebrity (22.00) £5.00 Marcos K7 • Stephen Frost’sSuns)Impro Venue 98 5510.30am Grove -Street. Tickets 228 9116 Aug 8-23 (not 19.30All(20.Stars 45) £7.50Stephen (£6.50)Frost page 19 Box Office: midnight Marco’s offers a sparkling mix of theatre, comedy and music in a friendly exciting and Music affordable venue.The • John Otway19.30Gilded shows on offer cannotcafe-bar/meeting be bettered. place is the best on the Fringe and the array of Aug 25-30 (20.45)Balloon £6.50 (£5.page50)49 Comedy <fi Revue • Aug Peatbog Faeries(03.A00)Folking 20 midnight £7.00 Palaver (£5.00) at La Belle Angele page 49 • Aug Barbys, • Aug Shooglenifty at La50)Belle Angele page 49 8-26Bulls 21.15and (22.3Haggis:The 0) £5.00 (£4.Comedy 00) Feast page 11 24,25 midnightA Folking (03.00)Palaver £9.50 (£7. • AAugCanal Runs Through It The Canals00) page 19 8-30 (not 17) 16.45 (17.45) £5.00Far (£4. Food and Details drink: not Drinksavailable licence til 4am • The as Chic(£4.Murray Disabled: Aug 8,Chic 9,15,1Murray 6,22,23,2Story 9,30 20.30Doug(21.Healy 30) £5.00 00) page 17 • Aug Newsrevue 29 (22.35) £6.00 (£5.00) 8-30 (notTues)page21.30 3 Men8-30and(notTues) 2 Dogs 19.30page(20.3330) £5.00 (£4.00) Lauriston Hall Tickets 0802 774800 K9 • Aug Venue 27 Lauriston Box Office: 10.30am -Place 5pm • Whoops VicarTues)is that your(01.Dick00) £5.00 Newsrevue Aug 8-30 (not midnight (£4.00) page 29 Musicals/Opera • Women of13.a40Certain Age £4.Theatre Works page 32 Aug 8-23 (15. 0 0) £5.00 0 0) • Aug Genesis?..! It My00)Way Aug 24-29 19.Did45 (22. £3.00 Smarx (£2.00)Arts Crew page 63 Aug 8-16 16-2221.00 18.15(22.(19.10)30) Disabled: Level access to the hall.Access to toilets includes slopes. 132


Music • Aug Every8-23Dog23.Has 00 (00.Its10)Day£5.00The(£4.Tarantinos 00) page 58 • Zoot Money,18.1Woodstock Aug 23-28 5 (19.15) £6.00Taylor (£5.0and 0) a Strawb page 58 Musicals!Opera • Aug BugsyI 1-16Malone 13.00 (14.North 15) West £4.50 Leicestershire (£3.50) Youth Theatre page 62 • Aug Don 17-23 Giovanni Opera Invention(£4.00)page 62 16.30 (18. 15) £5.50 • Aug Into 17-23 the Woods 18.45 (21.Plunge! 05) £5.50Productions (£4.50) page 63 Theatre • Aug BeckettLand Action Theater(£4.0page 8-30 23.00 (00. 15) £5.00 0) 68 • Aug Blood24-29 Wedding 16.30 (18.Sternberg 15) £5.00Theatre (£3.50)Actors Repertory Society page 105 • Aug Dancing The New 11-16at15.Lughnasa 30 (17.30) £5.00 (£3.50)Buckenham Players page 95 • Aug Find24-30 Me 15.Manchester 15 (16.15)Metropolitan £4.00 (£2.50)Drama Society page 93 • Aug Get a17-30 Life20.50Hourglass (22.05)Productions £5.00 (£4.00)page 89 • Glimpse (Sundays, Wednesdays, Fridays) Afterthought page 69 Previews Aug 10,13,Aug15,18,7,920,19.202,02(20. 4,27,020)9 £2.00 20.00 (21.00) £5.00 (£4.00) • Glimpse (Tuesdays,Thursdays, Saturdays) Afterthought page 69 Previews Aug 12,14,Aug16,18,9,9220.00 1,23,26,(21.28,030)0 £2.00 20.00 (21.00) £5.00 (£4.00) • Absolute The Importance of Being Earnest Company Aug 8-23 Banana (not 17)Theatre 13.30 (15. 00) £5.00page(£4.6800) • Jaques and his Master Eclipse Aug 17-30 12.00 (13.30) £5.00 (£3.5page 0) 82 • Aug Killing9-23Larry Negative (not Suns) 15.15Equity (16.15)Theatre £5.00 Company (£3.50) page 95 • Aug Memories 9-16 17.from 15 (19.the00) Invisible £5.00 (£4.0The 0) Dylan Dog Theatre Company page 82 • Aug Our 11-16 Country’s North(£3.West50) Leicestershire Youth Theatre page 95 15.00 Good (16.30) £4.50 • Aug The 17-23 Pit and22.30the(23.Pendulum 20) £5.00 (£4.Shattered 00) Windscreen Theatre Company page 103 • The Rape18.of20Lucrece Looking Glass Productions page 93 Aug 8-23 (19.10) £5.50 • Aug The 8-16,24-30 Seagull Eclipse 19.30 (21.page 00) 82£5.00 (£3.50) • Aug Sunday 17-30Lunch (not 26)Sleeve 16.30Productions (17.30) £5.00page (£4.0104 0) • Aug Terry17-23 Pratchett’s 14.00 (16.Witches 00) £6.00Abroad (£5.00) The Wotjacallem Players page 112 • Aug Unreliable Romances (Mondays: Free Show) Afterthought page 69 11,18,25 20.00 (21.00) Free Food and Ent: drink:2ydCafe, snacksby Fire and meals Disabled: Flat.Alicensed ud: 50ydbar,(20yd Door)al2l Strday. HR WC (W M 20”). Meadowbank Centre and Stadium ji? Venue 151 10am London- 10pm Road Info 668 4100 Box Office: Talks & Events • Atta Aug 17Ullah 20.00Khan (22.30)Essa£7.00Khailvi Edinburgh Mela page 65 • Aug Bhangra 16 23.30atThe (02.0Mela 0) £7.00Edinburgh Mela page 65 • Main LadkiMelaSolahpageBaras Edinburgh 65 Ki (I’m The Girl of Sixteen) Aug 16 20.00 (23.00) £7.00 • Aug Nagwanti 17 15.0-0Param (16.30) Para £4.00Theatre Edinburgh Mela page 65 • Aug North-South-East-West 17 18.00 (18.30) Free Musical Spectacular Edinburgh Mela page 65 • Aug War17with17.0Wind 0 (17.4-5)Waves £3.00 Dance Company Edinburgh Mela page 65 Food and drink: Cafeteria Disabled: Details not available

VCNUCS Theatre • Aug Bolshoi Circus page 19.7400 (21.00) Aug 8-15,19,20-22,26-30 9,12,13,16,17,23,24,30,31 14.30 (16.30) Aug 16,17,23,24,31 17.00 (19.00) • Aug Lawrence21.30 Leyton’s Mindf*** page 92 Aug 8-30 16,17,23,24(22.19.310)5 (20.£9.0015) (£7.00) Food and Good drink:access, Licenseddisabled bar, snack Disabled: WC.bar All on one flat level. Moray House Student's Union km Venue 168 2pm 37 Holyrood Road Tickets 557 6608 Box Office: - 6pm located Moray House i s a centrally well-known venue. Easi l y accessible from both Holyrood Road and the Royal Mile.The venue has a built in stage and seating capacity of 100-150. Music • Aug Grease the Night Club(05.00)page 49 Aug 2,1,98,,116,5,223,2,3209 22.00 22.00 (05.00) £4.00 £5.00 Food and Details drink: not Licensed Disabled: availablebar, snacks and refreshments all day Moray House Theatre Venue 167 10am Canongate/St Box Office: - midnightJohn’s Street Tickets 667 2212 Musicals/Opera • Aug The Bear Cambridge Opera 7 18.0(£5. 0Group (19.00)00)page £5.0061(£4.50) Aug 8,16,10,2312,18.14,0018,(19.21,020)5,2£6.00 • AAugDinner Engagement Cambridge Opera Group page 61 00) £5.00 Aug 9,11,13,20,26,28 15,17,22,24 18.0018.(19.000(19. 0) £6.00 (£5.0(£4. 0) 50) • ‘Let it Be’-The Musical The Arthur Terry Aug 24-27 21.15 (23.30) £6.00 (£5.00) School page 61 Theatre • Anything for Laughs The Fun£5.00Factory page 86 Aug 18-21,26-30 Aug 22-25 12.45 (13.12.4455)(13.£5.5045) (£4. 50)(£4.00) • AsAugYou9,11,Like It Megalomania page 94 13,15,17,19,21,23 20.50 (23.20) £8.00 (£6.00) • Aug The 18-30 Beaux’Stratagem Fret Theatre Company page 105 (not 24)with 14.20Cinderella (16.Strut 00) &£6.00 Special Double-Bill £10.00(£4.(£7.00)00) • Aug Cinderella Strut & Fret Theatre Company 105 (not 24)with 16.1The 0 (17.Beaux’ 50) £6.00 (£4.00)page Special18-30Double-Bill Stratagem £10.00 (£7.00) • Aug Incarnate Cambridge University ADC page 76 7-24 (not Mens) 22.30 (midnight) £5.00 (£3.00) • Aug Michael 9,11,1Chekhov 3,15,16 13.Acting 45 (15.Workshop 00) £4.00 (£3.Cygnet 50) Theatre page 78 • Aug Romeo 7-16and15.0Juliet 0 (17.30)Cygnet £6.00 Theatre (£5.00) page 78 • Aug The 8,Taming 10,12,14,of16,the18,2Shrew 0,22 20.50Megalomania (23.20) £8.00page(£6.9400) • Aug Time-Share 8-30 19.15 The (20.3Studio 0) £5.00Theatre (£4.00)Company page 105 Food and Details drink: not Licensed Disabled: availablebar, snacks, refreshments all day.

km

Murrayfield Parish Church Hall hi Outer Venue 104 Ormidale Terrace. Theatre • Aug She Stoops 11-23 19.to30 Conquer (21.45) £5.00The Makars and DMDC page 93 Food and drink: Tea at time of performance only. The Meadows Big Top Ni2 Disabled: Ent: 3yd HR.andAud:coffee 3yd WC. Venue 189 9.30am The Meadows, Melville Drive Tickets 667 7367 Box Office: to 8.30 Spectacular Big Top.Cabaret Mix of chair individual a modern Big Top by day1000andseata stunning styleandvenuetieredby night. Free seats. parkingProvides on Melville Drive. Venue The30Netherbow Theatre jis 4310am High- 9pm Street. Tickets 556 9579 Box Office: Comedy <6 Revue Look down historic the Royalgateway Mile to where John Knox that’s Netherbow. It’s • Aug Big Top Edinburgh’s the cultural ofjutstheoutOld- museum Town.theCelebrating 15-17,Extravaganza! 22-24 21.15 (22.45)page£9.5013 (£8.50) anniversary, enjoy our studiototheatre, cafe withhubcourtyard, and gallery.our 25th Music Children’s Shows • The Mean14-17, Fiddler Edinburgh • A.A. Milne’s Pooh35) £3.00 Richard(£2.Medrington’s Puppets page 9 Aug 7-10, 21 -24,at28-31 17.00 (23.Festivals 00) The Mean Fiddler page 52 Aug 7-30 (notWinnie Suns) 12.the45 (13. 50) • The Adventures of Peter Rabbit Ian Turbitt’s Puppet Theatre page 7 Aug 7-30 (not Suns) 11.15 (12.05) £3.00 (£2.50) • Aug Rainbow MagicSuns)Syl10.via00Troon’s 7-30 (not (10.50)Kenspeckle £3.00 (£2.5Puppets 0) page 9 THE NETHERBOW THEATRE continues over the page 133


Outside the Beehive Inn 178 10am Grassmarket vemcs Venue Box Office: - 9pm Tickets 554 0777 Theatre • The Original Edinburgh Literary Pub Tour page 96 Aug Aug 4-30 4-30 20.18.3000 (20. (22.030)0) £6.00 (£5.00) Food and Level drink:access Snacks,throughout soft drinks,- tohotarena-side drinks. seating and front Disabled:

THE NETHERBOWTHEATRE continued Theatre • Oxygen Danny and theandDeep Blue Sea Company page 97 Aug 8-30House (not Suns)Merlin 16.00 Theatre (17.00) £6.00 (£4.00) • Aug Macbeth Speaks The 7-30 (not Suns) 14.00Touring (15.10)Company £6.00 (£4.0page 0) 108 • Now We Are Very Old: An Audience With A.A. Milne Richard Medrington’s Puppets page 103 Aug 25-30 18.00 (19.10) £6.00 (£4.00) • Aug Opium Theatre page 72 9-30Eater (not Suns)Australian 20.30 (22.National 30) £7.00 (£4.5Company 0) • The Aug ISeal 1-23 Wife (not 17)Attic18.0Theatre 0 (19.25)Company £7.00 (£4.page 50) 72 Food and drink: Cafe8+1open 10am to 10pmI StrWC for coffee,(+3snacks, Disabled: HR.Aud:5yd 25”). meals etc. Enclosed liftEnt:and10yd stair lift forStr wheelchair access to theatre.

KIO

Overtures at the Edinburgh Playhouse hi4 Venue 97 Greenside Place Theatre • Aug Blood18,and Honour Double Edge Drama page 82 17.0 0(20.0 (18. Aug 19,223,2,3213.05,2019.90 0(14. 30)30) £6.00 (£4.00) Aug 20,27 3 0) Aug 21,28 15.00 (16.30) • The Drama page 82 Aug 18,19,Critic 222,3,225,6,23Double 90 13.15.0000Edge (14. Aug (16.330)0) £6.00 (£4.00) Aug 20,27 17. 0 0 (18. 3 0) Aug 28 19.00 (20.30) in transition Edge Drama page 81 Old St. Paul's Church £ Hall jis • Aug 18,19,2223,219.6,3000Double (20. Venue 45 Jeffrey Street. Tickets 556 0476 Aug 13.03300)0)(14.£6.00 30) (£4.00) Box Office: 10am -1 I pm Aug 20,27 15. 0 0 (16. Venue 45 is oneshows.of theIt’s most social venues at the Fringe. It can boast numerous awards Aug 21,28 17.00 (18.30) and cafe,five-star best parties in town!!cafe ‘Club Polski’ is also a must for all socialites.Top theatre, top • Who’s Aug 18,19,22Laughing 2,3,225,6,2390 17.15.Now? 000 (18. (16.33Double 0) £6.00Edge (£4.0Drama 0) page 82 Aug 0 0) Children’s Shows Aug Aug 20,27 21,28 19.13.0000 (20. (14.330)0) • Aug The 11-30 Emperor’s New10.Clothes (not Suns) 35 (11.35)Blunderbus £4.50 (£3.0Theatre 0) Company page 7 Disabled: Details not available Music • Aug Festival Old St PaulFree’s Music ‘97 page S3 10,17,Masses 24 10.30(11.45) The Palladium cm • Wallingford Church Venue 26 Broughton 557 -2100 6969 pre August) Aug 8 20.00 (22.Parish 00) £5.00 (£3.0Choir 0) page 58 Boxwonderful Office: 10am - classical 6pmPlace MonGreek-Tickets Sat,Palladium 12pm 4pm(557 Sun • Zadok the Priest Old St Paul ’ s Music ‘97 page S3 A A-listed building on the edge of the New Town (at Aug 20 20.00 (21.30) £6.00 (£4.00) Broughton havingfacilities undergone a major renovation with ithree shows dailyStreet), and newreturns bar/toilet - the Palladium is probablyprogramme the best venue n town. Musicals/Opera • Aug DIY8-23 - the20.musical C Productions Comedy <£ Revue 15 (21.45)K£6.00 (£5.00) Ltd page 62 • Aug David15-23Baddiel 11 (£8.00) 21.00 (22.page 15) £10.00 Theatre • Aug BBC11,Television page 12 30) Free • Accidental Death of an Anarchist In Your Space Productions page 90 13,21,26-28 22.00 (00. Aug 11-30 (not Suns) 14.05 (15.45) £6.00 (£4.00) • Aug Best14-23 OfThe(notFest page 13 £9.50 (£8.50) • Aug Dracula Be Ba Theatre page 13 21) 22. 4 5 (midnight) 11-16 12.15 (13.45) £4.50 (£3.50) • Jenny Eclair page 11 (£8.00) • Aug The 11Evening Before the Millenium After Oxygen Productions page 91 Aug 24 21. 0 0 (22. 0 0) £10.00 -23 23.15 (00.05) £4.50 (£3.50) Aug 24 23.00 (midnight) £10.00 (£8.00) • Jealousy • The New(notJimMons) Rose 19.Circus Aug 12-17,2Red0-24,Fish27-29Theatre 22.00Company (23.00) £5.00page(£4.10100) Aug 9-30 00 (20.15)page£8.5029 (£6.50) • Aug Marvin’s Room Absolute Banana Theatre Company page 68 12,14,16,19,21,23 18.30 (20.00) £5.00 (£4.00) Music • Aug Matilda People • Cuba LibreScottish at the Palladium 25-30Liar!12.30 Those (13.40)Theatre £5.00 (£3. 00) page 108 Cuba31Libre • Aug Road25-30QMW Theatre Company page 101 Aug 22.00 (00.30)Cuba £10.00Defence (£8.00)Campaign Benefit page 41 18.30 (20.00) £5.00 (£4.00) • Horse plus Guest Players • Aug Romeo Theatre Aug 11,18,25 19.00 (20.15) £10.00page(£8.SI00) 18-23& 12.Juliet 15 (13.Schhh! 45) £4.00 (£2.0Company 0) page 103 • Aug Margarita page 54(£8.00) • Aug Rope11,1Absolute Banana Theatre Company page 68 9,10,12 Pracatan 23.00 (00.30) £9.00 3,15,18,20,22 18.15 (19.45) £5.00 (£4.00) Disabled: Details not available • Two Pairs of Shorts QMW Theatre Company page 101 Aug 25-30 20.30 (21.45) £5.00 (£4.00) • Vinegar Aug 25-30Tom16.15 QMW (18.00)Theatre £5.00 (£4.Company 00) page 101 Physician and pm 86 5812 Dalkeith RoadandFirkin Tickets 662 4746. Food and HalhA drink: fewLicensed cafe 9am street - 11 pmlevel. Church: Ent: 3yd Flat.Aud: 50yd 7+7+19 Venue Box Office: noon10am- 2pm 6pmbrewed - 8.15pm Disabled: steps up from Food available from I am. Ales on site enjoy a free brewery tour and Str HR WC (+ 7 M). sample of our fiExperience ve ales. Enjoythea ales 4-pintandpitcher and BBQFirkin-style! in our huge beer garden (group bookingsoneavailable). atmosphere, Comedy <& Revue out of the blue ji4 Venue 143558 The Bongo Club, 1412 New (off Royal Mile) • Aug Hypnotist Lennon£5.00 & His(£4.Hypno-Dog Firkin Fringe page 19 Tickets 7604round BoxNew Office: noonStreet - alam 7-24 21.Hugh 45 (midnight) 00) Non-stop alitsl year Street Studios, multi-media artscabaret, centre,clown, hostsperformance, the Bongo Club with imprudent mix of incessant fringe of the Fringe Food and Fuldrink: Publicdisabled house with snackscar park vaudeville and live music from dusk to dawn. Disabled: l fecilities, toilets,barlarge Comedy <£ Revue • AreYou To 4Me? Aug 17-30Talking 17.45 (18. 5) £5.00Good(£3.Idea 00) Company page 23 • Aug UnVento La Canapia 10-30 16.Impetuoso 00 (17.00) £5.00 (£3.00) page 25 Dance/Physical NON SMOKING? • Aug Malopo & Poetry Shows may be held in v 10-23African 19.30 (20.Dance 30) £5.00 (£4.00) Mamelodi Theatre Organisation page 31 where Call thesmoking venue tois allow check Food and Details drink: Available Disabled: not available12 noon until 3am 134


Pleasance LI4 Venue 33 60I lam The- Pleasance. Tickets 556 6550 BoxtheOffice: 12 Festival midnight. Join Pleasance’s own of Theatre 10 performing spaces round a courtyard -hasFooddiedandon drink all day - 40 theatre pieces - 31 up for Fringe Firsts. Who said theatre the Fringe? Children’s Shows • Aug Fun Song (not Factory10.‘On15 Stage’ Pleasance (11.135)0) £6.50 (£5.50)Festival of Theatre ‘97 page 8 Aug 18-30 18-30 (not 26) 26) 12.00 (13. • The Happy Gang Sing-a-long Pleasance Aug 11-16 10.30 (I 1.25) £4.00 (£2.75) Festival of Theatre ‘97 page 8 • Aug I DareYou Pleasance of Theatre‘97 18-30 (not- Railtrack 26) 13.45 (14. 45) £4.00Festival (Children Free) paged Comedy <£ Revue • Alistair McGowan Goalposts Alistair McGowan page 26 Previews Aug 6,7 20.05Moving (21.05)the£5.00 Aug 8-10, 05) £7.00 Aug 15,16,12-14, 22-2417-21 20.1520.(21.0515)(21.£8.00 (£7.00)(£6.00) • Arj Barker’s Letter to3America Arj Barker page 11 Preview Aug 8 20.30 (21. 0) £5. 0 0) Aug Aug 9-11,13,14,17-21,27-30 15,16,22-24 20.30 (21.30)20.30£7.50(21.(£6.30)50)£6.50 (£5.50) • Aug BBC26New Awards BBC Radio 4 page 12 19.30Comedy (21.00) Free • Lenny Beige One Man HisTalent Lenny Beige page 13 Previews Aug 6,7 16.00 (17.0and 0) 0£4.00 Aug 0 (17.(£6.00)00)£6.00 (£5.00) Aug 8-11,13,14,17-20,25-30 15,16,22-24 16.00 (17.00)16.£7.00 • The Big Squeeze &0Sue, Geraldine McNulty and Emma Kennedy page 27 Aug 19-21, 216.5-3000 (17. 16.000Mel0)(17.£8.00 0) (£7. £7.00 Aug 22-24 00)(£6.00) • Adam Bloom page 13 Preview Aug 6 18.45 (19.418.5) 4£5.00 Aug (19.45)(£7.£7.00 Aug 7-14,17-21,25,27-30 15,16,22-24 18.45 (19.45)5 £8.00 00) (£6.00) • Scott Capurro page 15 Preview Aug 7 22.30 (23.30) £5.00 22.30 (23.30) £8.00 (£7.00) Aug Aug 8-10,12-14,17,19-21,25-27,29,30 15,16,22-24 22.30 (23.30) £8.50 (£7.50) • The Cheese Shop page 15 Aug 8,10,Cheese 9 17.13,01Shop (18. 10)Presents...BOOF! £5.00 17.10 (18.1The Aug 4,117.7-21, Aug 15,116,1,212-24 10 2(18.5,217-30 0) £8.00 (£7.00)0) £7.50 (£6.50) • Charlie Chuck page 15 50) £7.00 (£6.00) Aug Aug 8-14,17-21,25-30 15,16,22-24 18.50 18.(19.5050)(19.£8.00 (£7.00) • Club SealsAug 6,7page Previews 23.3015(00.40) £3.5023.30 (00.40) £5.00 (£4.00) Aug 8-10,12-14,17-21,25-27,29,30 Aug 15,16,22-24 23.30 (00.40) £6.00 (£5.00) • Cluub page 15 PreviewsZarathustra Aug16,4,717-19, 22.05- Attention (23.05) 22.£4.000Scum Aug (23.500)5) £8.00 (£7.00) Aug 8-115,11,6,13,22-24 22.0521,(23.25-30 05) £8.505 (£7. • Aug Comedy BBC Radio 4 page 11 16,17 Masterclass 10.00 (12.00) Free • The Comedy Zone(00.30)page 16 Previews 6, 7 22.50 £4.0022.50 Aug 8-11,13,14,17-21,25,27-30 (00.530)0) £8.00 (£7.00) Aug 15,16,22-24 22.50 (00.30) £8.50 (£7. • C.R. FunAugThe7,8Edinburgh Comedy Revue page 17 Previews 15. 0 0 (15. 4 0) £4.00 Aug Aug 9-11,13,14,17-20,25,27,28,30 15,16,22-24 15.00 (15.40) £7.0015.0(£5.0 (15.00)40) £6.00 (£4.00) • Aug The 25Daily18.0Telegraph Open Mic Award - Grand Final page 16 0 (19.40) £5.00 • Dallas andAugPacker Go0 (16.Large! Dallas And Packer page 16 Previews 8, 9 15. 5 Aug 3,14,115.7,158,0 2(16. 0,21,550)20)5,£6.00 2£4.00 7-30(£5.15.0500)(16.50) £5.00 (£4.00) Aug 10,15,116,1,212-24 • Dylan - Gurgling Dylan Moran page 27 PreviewMoran Aug 7 21.30 (22.25)for£4.50Money Aug Aug 8-14,17-20 15,16,22-2421.30 21.30(22.(22.225)5)£8.00 £8.50(£7.(£7.050)0) • Emotional page 13 Preview Aug Baggage 6 18.00 (19.Cambridge 00) £5.0000 (19.Footlights Aug Aug 7-11,13,14,17-21,26-30 15,16,22-24 18.00 (19.00)18.£8.00 (£6.00)00)£7.00 (£5.00) • Aug First22Impressions BBC Radio 4 page 12 11.00 (12.00) Free • Jason Freeman page(22.1900) £4.00 Previews Aug 6, 7 21.00 Aug 21.00 (£7. (22.500)0) £8.00 (£7.00) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 21.00 (22.00) £8.50 • Kevin Gildea page 19 Preview Aug 7 22.30 (23.22.3030) (23. £5.0030) £8.00 (£7.00) Aug Aug 8-14,17-21,25-30 15,16,22-24 22.30 (23.30) £8.50 (£7.50) • Dave Gorman In the Pleasance with the Microphone page 23 Previews Aug 6,7 21.15 (22.15) 21.£4.0015 (22. Aug 8-11,13,14,17-21,25,27-30 Aug 15,16,22-24 21.15 (22.15) £8.50 (£7.510)5) £8.00 (£7.00) • Boothby Previews AugGraffoe 6,7 20.10 page (21.1230) 20.10 £4.00 (21.10) £8.00 (£7.00) Aug 8-11,13,14,17-21,25,27-30 Aug 15,16,22-24 20.10 (21.10) £8.50 (£7. 50) • Richard Herring’s Rita page 23 Previews Aug 6,7 15.3Excavating 0 (16.50) 15.£4.00 Aug 8-11,13,14,17-21,25,27-30 3 0 (16. Aug 15,16,22-24 15.30 (16.50) £8.50 (£7.550)0) £8.00 (£7.00)

V€NU£S • Innocent Millions Dying David Mitchell & RobertWebb page 16 Preview Aug13-21 6 11.00Dead (12.000)0)or£4.00 Aug £5.50 Aug 7-11, 24-30 17.20II(18..0020)(12.£5.50 (£4.50)(£4.50) • Aug Instant10-14,Sunshine-Anniversary Instant £6.50(£5. (£5.550)0)Sunshine page 24 Aug 15,16,217-21 2,23 17.17.2200(18.(18.330)0)£7.00 • The Itsy Bitsy Liz Webb Show Li Preview 00) £2.00 z Webb page 33 Aug 8-30Aug18.73018.(19.3000)(19.£3.00 • JoAugEnright: Not Tonight Josephine Jo Enright page 17 (20.15)(£6.Enright £6.50 Aug 6-14,17-21,25,27-30 15,16,22-24 19.15 (20.19.15)15 £7.50 50) (£5.50) • John Aug 26Shuttleworth’s 18.00 (19.00) FreeOpen House BBC Radio 4 page 12 • Just Radio 4 page 12 Aug a19Minute 12.00 (13.BBC 00) Free • Aug Kaleidoscope Radio 4 page 12 21 15.45 (16.BBC 45) Free • Kissing the Goldfish 25 Preview Aug 1425-27, 23.45 (00.4page 5) £4.00 Aug (00.4(£6. 5) £6.50 Aug 15,17,116,9-21, 22-24 23.4259,3(00.0 23.45)45£7.50 00) (£5.00) • The League of17.Gentlemen page 25 Preview Aug 7 3 0 (18. 3 0) £4.50 Aug 17.30 (£7. (18.530)0) £7.50 (£6.50) Aug 8-10,12-14,17-21,25,27-30 15,16,22-24 17.30 (18.30) £8.50 • Lee and Aug Herring - 3This Morning With Richard, Not Judy II page 25 Previews 6, 7 12. 0 (13. 3 0) £4.00 Aug 14,17-21, 25,27-30 12.£8.50 30 (13.(£7.350)0)£8.00 (£7.00) Aug 8-115-16,1,123,2-24 12.30(13.30) • Stewart Lee King Dong vs Moby page 26 Previews Aug 6,7 20.00 (21.00) 20.00 £4.00 (21.Dick Aug Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 20.00 (21.00) £8.50 (£7. 500)0) £8.00 (£7.00) • APreview LittleAugFight7 17.Music Pellew International page 30 Aug 8-14, 17-21 17.17.050055(18.(18.(18.005)05)5)£5.00 £6.00 Aug 15, 1 6, 2 2, 2 3 £7.00(£5. (£6.000)0) Aug Aug 2425 17.17.2200 (18. (18.220)0) £7.00 £6.00 (£6. (£5.000)0) • Sean PreviewsLockAug16,4,71page 21.2265 (22.25) 21.£4.0025 (22.25) £8.00 (£7.00) Aug Aug 8-115,11,6,123,2-24 21.7-21,2525,(22.27-30 25) £8.50 (£7.50) • Aug Loose16 Ends Radio 4 page 11 09.45 I(11.BBC 00) Free • Aug Loose23 Ends Radio 4 page 12 09.45 II(11.BBC 00) Free • Aug L’Ultima Recital page 26 6-1 1, 13, 1 4, 1 7, 1 8, 2 0, Aug 15,16,22-24 16.20 (17.21,220)6-30£8.0016.2(£7.0 (17.00)20) £7.00 (£6.00) • Aug The 25LWT10.3Comedy Writing Award Forum page 26 0 (11.45) Free • Mark Maier page 2615) £5.00 Preview Aug 6 22. 1 5 (23. Aug 15 (23. Aug 7-10,12-14,17-21,25-27,29,30 15,16,22-24 22.15 (23.15) £8.0022.(£7. 00) 15) £7.00 (£6.00) • Aug Mervyn Stutter’s Pick of30)the£7.00Fringe page 27 9-14, 1 9-21 13. 0 0 (14. (£6. 0 Aug 15-17,22-25 13.00 (14.30) £7.50 (£6.0)50) • Milton Joyrider Jones page 24 PreviewJones: Aug 6 20.00 (21.00)Milton £5.0020.00 Aug (21.000)0) £7.00 (£6.00) Aug 7-10,12-14,17-21,25,27-30 15,16,22-24 20.00 (21.00) £8.00 (£7. • AlPreviews MurrayAugthe6,7Pub Landlord - King of Beers page 27 21.30 (22. 3 0) £4.00 Aug 21.30 (£7. (22.530)0) £8.00 (£7.00) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 21.30 (22.30) £8.50 • The Aug 21News 21.30Quiz (22.30)BBCFreeRadio 4 page 12 • Parsons Parsons&andNaylorNaylorpage- The Merry Onions of Dorking Preview Aug 6,7 21.20 (22.3020) £4.5021.20 (22.20) £7.50 (£6.50) Aug 8-10,12-14,17-21,25-27,29,30 Aug 15,16,22-24 21.20 (22.20) £8.50 (£7.50) • Peepolykus Coffee Peepolykus page 30 Preview Aug 7,- 8I am 17.15a (18. 25) £5.00 Aug 17.15 (£7. (18.520)5) £7.50 (£6.50) Aug 9,10,12-14,17-21,25,27-30 15,16,22-24 17.15 (18.25) £8.50 • Greg Proops page 3030) £5.00 Preview Aug 7 19. 3 0 (20. Aug 19.3500)(20.30) £8.00 (£7.00) Aug 8-10,12-14,17,19-21,26,27,29,30 16,22-24(22.19.00)30£8.00 (20.3(£7. 0) £8.50 (£7. 2515,21.00 00)Productions • Aug Re-Tune To Murder Punchline page 30 Preview Aug 917-21 13.20 (14.2020)(14.£5.00 Aug 0) £5.50(£5.(4.50)50) Aug 10,15,112-14, 6,22,23 13.213.0 (14. 20) 2£6.50 • The RichAugFulcher Fulcher page 19 Previews 6-8 16.Show 10 (17.1Rich 0) 16.£5.00 Aug 10 (17. Aug 9,10,11,13,14,17-21,25-30 15,16,22-24 16.10 (17.10) £8.00 (£7.100)0) £7.00 (£6.00) • Aug Short18-22 Story11.00BBC(11.3Radio 4 page 11 0) Free • Junior Simpson Previews Aug 6,7 21.45page(22.3145) £4.5021.45 (22.45) £7.50 (£6.50) Aug 8-10,12-14,17-21,25-27,29,30 Aug 15,16 22-24 21.45 (22.45) £8.50 (£7.50) THE PLEASANCE continues over the page 135


VCNUCS THE PLEASANCE continued • Aug Sir Bernard17,1Chumley’s Grand Tour (£7.Sir0Bernard Chumley page 31 0) £8.00 Aug 10-14, 15,16,22-249-2120.0020.00(21.(21. 00)0£8.50 (£7.50) 0) • Aug Frank8-11,Skinner page 32 14,17-21 00) £8.00 Aug 15,16,13,22-24 21.0021.00 (22.00)(22.£8.50 (£7.50)(£7.00) • Aug Stanza BBC Radio 4 page 12 26 21.00 (22.00) Free • APreview Supercollider Ben Moor page 27 Aug 6 16.0for0 (17.the000)0Family £5.0000) £6.00 Aug (17. Aug 7-10,12-14,17,18 15,16 16.00 (17.00)16.£7.00 (£6.00) (£5.00) • With Pleasure Aug 26Great 13.00 (14. 00) FreeBBC Radio 4 page 12 Music • Aug Flute18-21, Dreams Frei Zinger 58 211.5 311.0 3(12. 0 (12. 5) £3.50page Aug 22-24 15)1£4.00 (£3.(£3. 50)00) • Geno WashingtonofTheatre - What’s in the pot? Pleasance Aug 18-28Festival 00.50 (02.35) £4.00‘97 page 54 • The Tarantinos Aug 9-15 00.50 (01.50)page£2.0058 Talks <S Events • Pleasance 10 Steps to starting a theatre company - ITC Aug 22,23 Festival 11.00 (13.ofTheatre 00) Free‘97 page 66 Theatre • Along Max Fisher page 86 Aug 10 Came 18.007-21, (19.a Spider 5) £5.00 Aug 218.25-30 18.0205)(19.£8.0025) (£7. £7.0000)(£6.00) Aug 11-14, 15,16,212-24 00 (19. • Beyond Ecstasy Venus Productions Pleasance ofTheatre‘97 Preview AugFestival 8,9 22.40 £5.00page(00.9905) £6.00 (£5.00) Aug 18-21,(00. 2(00.5-30005)5)22.40 Aug 10,15,116,2-14, 22-2417,22.40 £7.00 (£6.00) • Blue at the ThroatofTheatre‘97 - Aidan Dun 100 Pleasance Aug 24-30Festival 12.50 (13.50) £5.00 (£3.page 00) • Blue Remembered Hills - Only Human Theatre Co. Pleasance Aug 7,14,2Festival 1,28 14.ofTheatre 00 (15.00) ‘97£6.00page(£5.9800) • Aug Dancing in3,Shadows Sandy Walsh 112 14,112.7,139-21, 12.30(£5.(13.page Aug 15,10,116,1,212-25 0 (13.247-30 5) £6.00 040)5) £5.50 (£4.50) • Dead on the Ground Hoipolloi Pleasance page 98 Previews AugFestival 8,9 15.ofTheatre 45 (16.50)‘97£4.00 Aug 45 (16.(£6.50)00)£6.00 (£5.00) Aug 10,15,116,2-14, 22-2417-21,15.4255,2(16.7-3050)15.£7.00 • Doctor Steiner’s Stranger‘97thanpageFicton Pleasance Festival ofTheatre 97 Show - Marcel Steiner Preview Aug 7 15. 0 0 (15. 5 5) £5.00 Aug 00 (15.(£6.55)50)£7.00 (£6.00) Aug 8-11,13,14,17-21,26-30 15,16,22-24 15.00 (15.55)15.£7.50 • Dr. Johnson’s Dictionary -‘97Cambridge Pleasance Festival ofTheatre page 99 ADC Previews Aug 11,13,7,195,14.17,4109,(15. 21,253,0)25,£5.00 27,29 14.40 (15.50) £7.00 (£5.00) • Dusty FruitFestival - Rejects Revenge page 98 Pleasance Preview Aug 8 12.3ofTheatre‘97 0 (13.40) £4.00 Aug 9-11,13,14,17,18,20,21,26-30 Aug 15,16,22-24 12.30 (13.40) £7.0012.3(£6.0 (13.00)40) £6.00 (£5.00) • Fool 110 PreviewsHouse Aug 7,Trestle 8 15.15Theatre (16.55) Company £4.50 15.15 page Aug Aug 9-11,13,14,17,18,20,21,25,27-30 15,16,22-24 15.15 (16.55) £8.00 (£6. 00)(16.55) £7.00 (£5.00) • Forces of Peace ofTheatre‘97 - ARTTS International Pleasance Aug 6-10,1Festival 2,13 12.40 (13.50) £4.00page(£3.100 50) • “Gasp!” Economical page 100 Preview11-14,Aug18-21, 10 16.25,0207-30 (17.Truth 016.0) 0&0 (17. 18.Pleasance 4050)(19.& 418.5)Festival £3.00(19.ofTheatre‘97 Aug 4(£5. 5) £5.50 Aug 15,16,22-24 16.00 (17.00) & 18.45 (19.45)45£6.50 50) (£4.50) • Grace - Jade Theatre Company Pleasance Festival ‘97 page 98 Preview Aug 614,14.17,0ofTheatre 0 (15.20) £5.00 Aug 7-1 1, 1 3, 7-30 (£6. 14.0500)(15.20) £6.50 (£5.50) Aug 15,16,22-24 14.18,0020,(15.21,220)5,2£7.50 • Guardian International Student Drama Award Pleasance Festival ofTheatre ‘97 page 25You11.3Seen 0 (13.This 30) £6.00 (£4.- National 00) 97Youth Theatre • Aug Have Girl? Pleasance Festival ofTheatre ‘97 page 97 Preview19,2Aug Aug 1,24,1725,17.27-3045 (19.17.145)5 (19.£6.0015) £8.00 (£6.00) • Hummingbirds Cambridge Pleasance Festival -ofTheatre ‘97 ADC page 99 Previews Aug 10,14,Aug16,6,18,820,14.242,02(15. 4,26,520)8,3£5.00 0 14.40 (15.50) £7.00 (£5.00) • Ian Shuttleworth: Critical Mass Pleasance Festival ofTheatre ‘97 page(‘Comic 99 Genius’ - The Independent) Aug Aug 10,15,116,1,2143,112.4,117-21, 5 (13.2155)12.15(13.15) £5.00 (£4.00)£4.00 (£3.00) 136

• • • • • • • • • • • • • • • • • • • • • • • •

Kanzerstik Pleasance Aug 8-10,12-17- Double 12.00 (13.Ego00) £5.00 (£4.0Festival 0) ofTheatre ‘97 page 99 Latin! by Stephen Fry Counterweight Pleasance Festival page 99 Productions Previews Aug 7,4,817-21, 13.ofTheatre‘97 3025,(14.27-3025) £4.00 Aug 9-1 1, 1 3, 1 13. (14.020)5) £6.00 (£5.00) Aug 15,16,22-24 13.30 (14.25) £7.0030 (£6. The Lightning Man - Young‘97Pleasance Pleasance Festival ofTheatre page 97 Preview Aug 8 17.17.3300(19.(19.225)5)£4.00 Aug Aug 9-14,18,20 15,16,22,23 17.30 (19.25)£6.50 £7.50(£5.(£6.000)0) The LongFestival Good Friday - The Corporation Pleasance Previews Aug 7-917,1ofTheatre 11.002(12. 2‘970) £4.11.page 00 98 Aug 10, 1 2-14, 9-21, 5, 2 7-30 Aug 15,16,22-24 11.00 (12.20) £6.5000(£5.(12.00)20) £5.50 (£4.00) Mae West:Festival All Of Me - Home ispagewhere the art is Pleasance Previews Aug 6,7 14.of Theatre‘97 05 (15.20) £4.0014.05100(15.20) £5.50 (£4.50) Aug 8-10,12-14,17,19-21,25,27-30 Aug 15,16,22-24 14.05 (15.20) £6.00 (£5.00) MemoryAugMan7 12.- Paul Festival ofTheatre ‘97 page 98 Preview 40 (13.Clark 40) £5.00Pleasance Aug 40 (13. Aug 8-10,12-14,17,19-21,25,27-30 15,16,22-24 12.40 (13.40) £7.5012.(£6. 50) 40) £6.50 (£5.50) Miss Broadmoor - Landlady‘97 topage Thespians Pleasance Festival ofTheatre 99 - Laffa Jaffa Productions Previews Aug 7, 8 18. 4 5 (19. 4 5) £4.50 Aug 18.45 (£6. (19.040)5) £6.50 (£5.00) Aug 9,10,12-14,17-21,25,27-30 15,16,22-24 18.45 (19.45) £7.50 MISTER V.Festival - Campaign to ‘97FreeVanunu Pleasance ofTheatre page 99 Preview Aug17-21 9 17.20 (18.(18.20)20)£5.00 Aug £6.00 (£6. (£5.000)0) Aug 10-14, 15,16,22,23 17.17.2200 (18. 20) £7.00 Molloy - Gare Lazare Playerspage 100 Pleasance FestivalStofTheatre‘97 Previews (13.50)(£4.£4.00 Aug 16-23Aug12.514,0 1(13.5 12.50)50£5.00 00) The Naked Guest Animus Pleasance Festival ofTheatre‘97 page 100 Previews Aug 6, 7 19. 4 5 (20. 4 5) £5.00 Aug 19.45 (£6. (20.540)5) £6.50 (£5.50) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 19.45 (20.45) £7.50 Nightshift - SheepofTheatre‘97 Thrills Theatre Company Pleasance Festival page Aug 24-30 17.05 (18.10) £6.50 (£5.50) 100 The Post Off Poems Nick E Zinc Pleasance page Productions 100 Previews AugFestival 7-917-21,ofTheatre‘97 11.235,02(12. Aug 10,12-14, 7-3025:)11.£3.00 30 (12.25) £5.00 (£3.00) Prufrock: Live! - ofTheatre Empty Space Theatre Pleasance ‘97£5.00page 98 Co Preview AugFestival 2018.18.303(19. 0 (19.40)40)£7.00 Aug 21,25-30 (£6. 0 0) Aug 22-24 18.30 (19.40) £8.00 (£7.00) Red Festival ofTheatre‘97 page 98 PreviewZoneAug- 71Derevo (00.Pleasance 30) £4.00 Aug 4,23.30 123.30 7,19-21, 23.30 (£6. (00.030)0) £6.50 (£5.00) Aug 8-115,11,6,13,22-24 (00.25-27 30) £7.50 Richard III Oddbodies Pleasance Festival ofTheatre‘97 page 99 Preview Aug 7 14.00 (15.25) 3£4.00 Aug 0 14.(£6.00 0(15.0) 25) £6.00 (£5.00) Aug 10,15,212,1,2134,114.5,108,0 1(15.9,227,5)29,£7.00 The RippleFestival Effect - Revelationspage 100 Pleasance Previews Aug 6,7 16.ofTheatre‘97 35 (17.45) 3£4.50 Aug 8-14,17,19-21,25,27-30 5 (17.(£5.45)50)£5.50 (£4.50) Aug 15,16,22-24 16.35 (17.45)16.£6.50 70Pleasance Hill Lane Improbable Theatre Festival ofTheatre‘97 Aug 25,27-30 20.15 (21.50) £8.00 page (£6.00)97 Shooting an Elephant H H Productions PleasanceAugFestival page 100 Previews 9 15.ofTheatre‘97 35 (16.20) £4.50 Aug 7,8,19-21, 35 (16.(£5.20)50)£5.00 (£4.50) Aug 10-14, 15,16,212-24 15.3255,2(16.7-3020)15.£6.00 Swan SongFestival by Jonathan Harveypage 98 Pleasance Previews Aug 6,4,717,20.ofTheatre 25 (21.25-27, 40)‘972£5.00 Aug 8-1 1, 13, 1 1 9-21, 9,30 20.(£7.2050)(21.40) £7.00 (£6.00) Aug 15,16,22-24 20.25 (21.40) £8.00 Sykes &,13,Nancy -1,Oddbodies Aug 8, 9 1 7, 2 0, 2 2 5, 2 8 14. 0 0 (15.Pleasance 15) £6.00Festival (£5.00)ofTheatre ‘97 page 100 Aug 16, 2 4 14. 0 0 (15. 1 5) £7.00 (£6. 0 0) The TearsFestival of Friday Evening‘97 - Seduction Pleasance page 98 Opera Preview10,1Aug 9 18.18.3ofTheatre 03(19. Aug 1,13-17 0 (19.40)40)£5.00 £6.00 (£5.00) Tomorrow is a lovely day - Only Human Pleasance 98 Theatre Co Previews AugFestival 6,7 14.ofTheatre 00 (15.10)‘97£5.00page Aug 8-10,12,13,17-20,25,27,29,30 14. 0 0 Aug 15,16,22-24 14.00 (15.10) £7.00 (£6.(15.00)10) £6.00 (£5.00) TheTownThat Went(00.Mad Theatre page 112 Preview10,1Aug 9123.00 125)7-30£5.00Volcano Aug 1, 1 3, 4, 1 7-20, 2 5, 23.00 (00. Aug 15,16,22-24 23.00 (00.15) £8.50 (£6.010)5) £7.50 (£5.00) Urban Minefields - Oscar ‘97McLennan Pleasance Preview Aug1Festival 7 14.17-21 4ofTheatre 0 (15.14.440)0 (15. £3.5040)page£6.0099 (£4.00) Aug 8-10, 2-14, Aug 15,16,22,23 14.40 (15.40) £7.00 (£4.00)


• You Are MyFestival Mother - Backchat Theatre Co Pleasance Aug 19-2123 12.12.0000 (13. (13.of Theatre 00)0) £7.50 £6.50‘97(£6. (£5.page 50)0) 99 Aug 22, 0 5 Aug 24 14.314.0 (15. 30)3£7.50 50)50) Aug 25-30 30 (15. 0) £6.50(£6.(£5. • Young Pleasance goes STORE CRAZY Pleasance page 99(£0.99) Aug 25-30Festival (not 28)of20.Theatre 15 (20.‘9735) £1.99 • Zero Frantic Assembly Pleasance Festival of Theatre‘97 page 98 Preview Aug 7 18. 5 0 (20. 0 0) £5.00 Aug 18.50 (£7. (20.000)0) £7.00 (£6.00) Aug 8-11,13,14,17-21,25,27-30 15,16,22-24 18.50 (20.00) £8.00 Food and Ent: drink: Restaurant, cafe, licensed bar, pasta and wine bar, snacks all day. Disabled: Parking available.15yd 2 StrWC (+4 50yd adapted). Aud: 80yd 12+9+5 Str HR.

Music • Aug Battlefield Band(22.in00)Concert 17,18 20.00 £8.50 (£6.Battlefield 50) Band page 40 • The LennyQueen’s HenryHal- lPoor White Trash and the Little Big Horns page 54 Aug 13,14 20.00 (22.00) £12.50 (£8.50) • Aug Dougie 26,27MacLean 19.30 (21.30)page £9.5052(£8.50) • Aug Mi Salsa 12,19,-2Edinburgh 6 22.30 (02.0Latin 0) £5.00American (£3.00) Society The Queen’s Hall page 54 Food and drink: Licensed bar. The Quaker Meeting House jii Disabled: Ramped access. Ent: lyd +1 .Wheelchair spaces in hall. Infra-red audio Venue 40 710am Victoria Terrace. Tickets 220 6109 system and induction loop. Accessible bar.WC (adapted). Parking on Clerk Street. Box Office: - heart 9pm. Friendly Venue i n the of the Old Town, above Victoria Street and close to the Castle, Grassmarket and Fringe Office. Cafe with home-made vegetarian food, excellent small theatre and elegant workshop / display space. Raj Restaurant on the Shore bi? Venue 184 10.00am Henderson- 12Street, Leith Tickets 553 3980 Talks <& Events Box RajOffice: midnight The Restaurant on The Shore i n Leith, formerly the Empire House Cinema, i s the • Aug Shakespeare’s Best Bits! The Shakespeare Workshop page 67 largest‘Indian’ in Edinburgh.The specialises in Bangladeshi 18-23 14.30 (16.00) £3.50 (£2.50) and enjoys the Restaurant best waterfront view in the ciRajty. (Unrestricted Parking). and Goan dishes Theatre Talks <fi Events • The Cheviot, the Stag andpagethe82 Black, Black Oil Eclipse25-30 Theatre • The Traditional MusicBangladesh of BengalFestival Of Food And Culture page 64 Aug 18.00Company (20.00) £5.00 (£2.50) Choudhury & Co-The Aug • Cyrano Foolery Aug 8,10-14, 9,15,117-21, 6,22,223,4-2829,319.0 19.30 3(22.0 (22.00)00)£13.£ 917.5 95 Aug I 1-23 (not 17) 18.page30 86(19.45) £4.50 (£3.00) • Aug Fire 25-30 Rope20.30 and Liberty Bob(£4.Hellon Food and drink:2ydRestaurant & Licensed Bar available all day (22.15) £6.00 00) & Catherine Side page 14 Disabled: • Aug Heroin11-16Lies12.15Newbury Youth (£3. Theatre users. Help Ent: available.level access. Aud: 7yd level access. WC adapted. Suitable wheelchair (13.30) £4.50 50) page 95 • Aug Magdalena 18-23 12.0Tagus 0 (13.Theatre 00) £5.00Lisbon (3.50) page 106 • Aug Never18-23Mind20.30the(22.Rain30) Forests Randolph Studio H8 £4.00 (£2.0Partially 0) Total Theatre page 97 Venue 55 Inst. Francais d’Ecosse, 13 Randolph Cres. • Aug Only11-30 Just (notLeaveners Theatre Company page 92 Tickets 225 5366 Box Office: Opens I lam. Suns) 15.00 (17.00) £5.00 (£4.00) Award theatre, music, film society and danceandfrom Japan.today. Each • Aug PuccinkThe Puccini(£4.00)Performance Exchange page 97 unique winning and representing the ideas, cultureNorth of theAmerica west andand east 11 -16 21.00Dream (22.10)of£5.00 • AFreeStory with an Ending Tomee Theatre page 108 Comedy <fi Revue Preview12.Aug 0 (12.0(£3.0) 00) • Aug Koyo17-30 Yamamoto Aug 25-30 00 (13.20 310.0) 3£5.00 21.00 (22.in0“Made 0) £5.00in(£4.Japan” 00) Japan Experience page 24 • The Tie Tagus Theatre Lisbon page 106 Aug 18-23 13.30 (14.30) £5.00 (£3.50) Dance/Physical • Aug Aki 24,26,28,30 Sato Solo Dance Visual Arts 11.30 (12.performance 30) £5.00 (£4.0Japan 0) Experience page 36 • Art of11-16, Silence Quaker Festival Committee page 118 • Japan ButohExperience Dance by page ImreThorman withYasumune Morishige (cello) Aug 2 5-30 10. 0 0 (17. 0 0) Free 36 Aug 18-23 10.00 (14.00) Aug 24-30 19.30 (20.30) £5.00 (£4.00) • Japan EgikuExperience Hanayagi -page Contemporary Japanese Dances Food and Access drink: Vegetarian 10am - 6.30pm Disabled: from VictoriaCafeTee.openLift available to all floors. Ground floorWC (adapted) Aug (15.020)0)36£5.00 (£4.00) Aug 10-16 17-23 15.14.3100 (16. Queen Margaret College hi Outer Venue 24 Drama Dept.,I lam-3 Clerwood Terrace.Fringe TicketsI lam317- 7.45pm 3546 (from 21 July) Box Office: Pre-festival pm. During Music • Aug Chikuzan 18.Japan page 51 Theatre (18.Experience • Betty and Bobby’s Macbeth Aug 10-16 17-23 19.4050 (20. 355)0) £5.00 (£4.00) Queen Margaret College Drama Department page 101 • The Lied Trio Aug 7-16 (not 10) 19.35 (21.00) £5.00 (£4.00) Aug 10-16 20.30Plays (21.30)Beethoven £4.00 (£2.5to0) the Beatles The Lied Trio page 52 Food and drink: Bar available Talks <fi Events Disabled: I Wheelchair space in main auditorium. Chairlift.WC (adapted). • Asian Blue13.0Japan Aug 17-30 0 (15.Experience 00) £3.50 (£2.page50) 66 l I J3 * Symposium on Love:The Devastating little breath of Eros N Queen's Hall '' Keti 24-30 Productions Inc. 30)page£3.5066 (£2.50) Venue 72 Clerk Street. Tickets 668 2019 Aug 15.15 (16. Box Office: 10amconcert - 10.30pm. Theatre Scotland’s livliest hal l i s busier than ever during the Fringe with over 80 including International • Theatrical asperformances well as comedy, folk andthe lots more. Festival morning concerts and Jazz Festival Aug 24-30 17.Company, 00 (17.50) Gumbo £5.00 (£4.0Japan 0) Experience page 90 • Aug Uncle10-16Bob16.The Marsh page(£4.93 00) Comedy & Revue 0 0 (17. 3 5) £5.00 Aug 17-23 (not 18) 16.10(17.45) • Aug Bob 19-21 Downe19.-30Jazzy! 17 (21.30) Bob £10.00,Downe £8.00 page and £6.00 Visual Arts • Jimeoin page(23.24 50) £9.00 (£7.00) Aug 21-25 22.00 • Aug Dancing 17-30Goddess 11.00 (23.-00)Paintings Free Mieko Nishimura page 117 • Aug Fred22MacAulay one (£7. night50)only Gilded Balloon page 23 20.00 (21.1- 5)for£8.50 • Aug Exhibitions Japan Experience 10-30 11. 0 0 (22. 0 0) Free page 119 • SolOYears of' S oYouThinkYou’re Funny’ page00)32 AugYou25Think 19.30You’re (21.30)Funny? £9.00 (£8. Food and drink: Cafe available all day.50yd 27 Str HRWC (F +3 25” M +7 25”). Disabled: Ent: 3yd 4+1 Str HR. Aud: • Aug Mark24Thomas 32 19.30 (21.30)page£10.00

137


The Ross Theatre V£NU£S Venue 112 Princes Street Gardens Tickets 467 2551 Music • The A Benefit Forof Waverley Care - An Aids Trust Aug Summer 24 13.00 (20.Love 00) Dance £7.00 (£6.Party00) page 57 lii Disabled: Details not available

ff Reid Concert Venue 8 Bristo Square Hall Music • AAugFestival David(£6.A 0Hal0)l Whitburn Band page 42 IS 19.3of0 (21.Brass 45) £8.00 Disabled: 100yd flat Sstr. A ud: 8yd flat. Fixed tier seating. WC ISstr (22in). Not advisable for wheelchairs. Guide dogs admitted.

jio

Roxburghe Hotel 19 Venue 89 3810am Charlotte Square. Box Office: I 1.30pm Amajor longshops established hotel iOpen n the West withinuntilwalking distance ofthisall thespace and venues. all dayEndeveryof Edinburgh, day from 7am midnight.Watch for entertainment. Roman Eagle Lodge kio Music Venue 21 211.30am Johnston- Terrace. Tickets 225 7226 • The Folk00)Show page 54 Box Office: I 1.30pm Aug 29Paddie 19.30 Bell (22.30)Festival £8.00 (£7. Right25in shows. the heartA powerhouse of Edinburghofanddrama rightandat theexcitement. heart of thePlusFringe. Tcupwo oftheatres packed Talks <6 Events with a free coffee with every ticket. • Aug International(19.CD00)&£1.00 Record Fair page 66 Children’s Shows Aug 232224 10.12.10.000000 (19. 000)0) Aug (17. • Aug It Came Rimelle... 8-16 12.From 55 (14.Planet 00) £5.00 (£3.50) Fox Youth Theatre page 7 Visual Arts • AAurora/Western Trip To The Farm Connecticut University • Edinburgh Festival Book Fair page 118 Aug 12-23 (not 18) 11.30 (12.2State 0) £4.00 (£3.00) page 7 Provincial Booksellers Fairs Association Aug 5-30 (not Suns) Aug 4,10,17,24 12.00 10.(18.0000)(18.00) Free Comedy <& Revue • Aug Beyond Food and Ent: drink:6ydRestaurant, licensed bar, snacks, refreshments alMl day.Aud. level). 11-23The19.3Brink 0 (20.25)Grin£4.50Reaper (£4.00)page 23 Disabled: 2toStr.access Aud:WC 6yd 2 Str.WC (F +20users. to basement • Aug I 2 Look 30 (£3.50) Service lift available for wheelchair Guide dogs admitted. 18-30 Out 13.104(14.0page 0) £4.00 Help available. • Aha! ThoseSister Jammy Cows From Dunedin, New Zealand page 10 City 28)Sisters Aug 24-30 (not 22.40 (23.25) £5.00 (£4.00) Royal Botanic Garden on Music Venue 193 Inverleith Row • America’s Golden Age of Rock’n’Roll - A Cappella Style The Fabulous Fourmel’dyhides page 42 Theatre Aug 8-22 22.30 (23.30) £6.00 (£5.00) • Theatrum LivingstoneBotanicum - Quest- Theater for the Source Nile • Art, Sex andTheatre Politics - German Plantes(£5.of0the page The Studio Company page50)Cabaret 57 Songs Aug 8-24 (not 17) 20.30 (22.00)of£9.00 0) 108 Aug 8-17 22. 1 5 (23. 0 0) £4.50 (£3. Aug 18-24 23.30 (00.15) Visual Arts • The Big Picture Theatre Aug 8-Sep 5 10.00 /(17.An00)Dealbh Free Mor page 119 • Absent Friends Pounds, Dollars and Cents page 100 Aug 8,10,12,14,16,18,20,22 16.55 (18.10) £3.50 (£3.00) Disabled: Details not available • Auden and Isherwood’sThe Ascent of F6 Daedalus Aug 8-16 Theatre 12.15 (14.Company 05) £5.00 page (£4.00)78 • Aug Born9,1to1,1be3,1Wilde Cents(£2.page Royal College of Physicians hii 5,17,19,2Pounds, 1,23 17.Dollars 00 (18.0and 5) £3.00 50) 100 Venue 9 Queen Streetmembership now includes some of the world’s most • The DumbWaiter Founded195in 1681, the College’s Aug 17-30 13.00 (14.15)Red£5.00Eye(£3.Productions 00) page 101 distinguished doctors.The Physicians’ Hall, designed i n 1843 by Thomas Hamilton, i s one • Aug Elsie9-17 And20.30 Norm’s Macbeth Company Theatre page 77 the New Town’s landmark buildings. What a historic setting for Fringe irreverence. of (21. 5 5) £6.00 (£5. 0 0) Aug 18-23 22.21.2005 (23. Music Aug 24-30 (22.340)5) • Aug Gerard • An Lineker 16-20Kenny 19.30 and (21.0Abracadabarets 0) £10.00 at the College Abracadabarets page 38 Aug Evening 18-23 20.With 15 (21.Gary 50) £5.50 (£4.00)West End Theatre Company page 112 • Aug Falstaff Breakwith Productions page 74 Disabled: Details not available 8,15-17, 11 -14,2,18-21 45(18.(18.00)00)£8.00 £6.00 (£5.00) Aug 2(23.3 16.45)16.45£8.00 Aug 2325-2822.30221.10 (£6.(£5. 00)00)(£6.00) Aug (22. 2 5) £6.00 Royal Fine Art Commission for Scotland Aug 24,29,30 21.10 (22.25) £8.00 (£6.00) KIS • Aug Low24-30 Level16.Panic Kismet Theatre Company page 91 55 (18.10) £5.00 (£4.00) Venue 132 Bakehouse Close, 146 Canongate • Aug Medea8-16 Soup Kitchen Theatre page 104 14.30 (15.30) £4.50 (£2.50) Talks <£ Events • Aug Out24-30 ofTime20.15First • Aug Minds13,Meetings - Bridge Design (21.0Among 5) £4.50Sequels (£3.50) page 85 15,20,22 17.30(19.00) Free Architecture on the Fringe I page 64 • Aug Puckerlips Limb page 93 9, 1 1, 1 3, 1 5, 1 7, 1 9, 2 1, 2 3, 2 5, 2 7, 2 9 18. 3 0 (19. 5 0) £5.00 (£4. 0 0) Visual Arts • The Servant Shoestring Players page 104 • Architecture Poole HarbourtheBridge Design Competition Aug 8-10 18.18-20, 10of(19.2Two 25)Masters £5.00 (£4.20The 0) £6.00 Aug 11-13, 5-27 18. 1 0 (19. 5) (£4. 0 0) Aug 4-29 10.0on0 (16. 0Fringe 0) FreeI page 114 Aug 15-17,22-24,29-30 18.10 (19.25) £7.00 (£5.00) • Aug Skrimshanker Theatre(£4.Company Disabled: Details not available 24-30 14.20 (15.Keyhole 50) £5.50 00) page 90 • Stacked Backstage Aug 11-22 (not 17) 14.Theatre 10 (15.1Company 0) £4.50 (£3.page00)72 Royal Mile Primary School jis • Teechers Venue 58 Canongate Tickets 0831 153545 / 0860 456195 Aug 24-30 16.H.3D0.G(17.. Productions 45) £5.00 (£4.page 00) 89 • Three-Piece Suite Soup Kitchen Theatre poge / 04 Theatre Aug 8-16 15.40 (16.40) £4.50 (£2.50) • Aha! Up TheSisterDuffCity Sisters From Dunedin, New Zealand page 69 • Aug Ballad11,of12,a14,Tin15 Man ey Theatre 16.30 (17.The30)Wey£2.50Vall(£2. 00) Company page 112 Aug 8-23 20. 5 5 (22. 1 5) £5.00 (£4. 0 0) • Aug Place11,- 1Home! Time Unknown The Aug 24-30 (not 28) 19.40 (21.00) 2,14,15 17.50 (18.45) £2.50 (£2.00)Wey Valley Theatre Company page 112 • Weepie Limb page 93 • Aug Raised11,1on2,1Songs The Wey Aug 8,10,12,14,16,18,20,22,24,26,28,30 18.20 (19.55) £5.00 (£4.00) 4,15 15.&15Stories (16.10) £2.00 (£1.0Valley 0) Theatre Company page 112 • Aug The 8-23 Weight Productions (notof17)Smoke 15.20 (16.Firefly 30) £5.00 (£3.00) page 85 Disabled: Ent: 30yd 1+3 Str.Aud: 10yd Flat. Food and Ent: drink:level.FreeAud:coffee Disabled: +20 Str HR.WC unadapted. Inaccessible for wheelchairs. 138


Royal Museum of Scotland Ki2 Venue 43 Chambers Street. Box Office: I0am-5pm (8pm onTues) Mon-Sat and noon-Spm Suns. Scotland’s the heartis ‘Precious of the Capital offers unique and displays.premier Highlightmuseum of thisinsummer Cargo-Scots & the exhibitions, China Trade’.galleries Admission Free. Music • Amadinda at the Museum Hungarian Merlintickets International 51 Overture Aug 19 18.Overtures/ 30 (19.30) Free given withTheatre any otherpageHungarian • Leicestershire Arts Symphonic Wind Band & Youth Dance Festival of British Youth Orchestras page 46 Aug 24 14.30 (15.30) Free Musicals/Opera • Aug Brodie! 11-16 Brunstane 18.30 (20.4North 5) £6.00page(£4.5610) Food and drink: Cafe open l day. Aud: 20yd ramped.WC adapted.Totally accessible. Disabled: Ent: Lothian St. 2ydalramped.

vcnucs • Aug Untune Me That Tune£6.00 (£5.page00)55 IS 14.30(16.15) • AAugView12 12.from page00)55 30 (13.the30)Kirk£5.00 (£4. • Wendy Boys(£5.00)page 41 Aug 21 19.and30 the (21.3Lost 0) £6.00 • Whistlebinkies Aug 30 19.30 (21.30) page £6.0058(£5.00) Food and Entdrink: to 2pm Disabled: : 3ydTea3 STr.andAcoffee ud: 5ydatFlattimeor ofsideperformance. entrance at Snacks street leMon vel by- Fripriornoonarrangement.

St Ann’s Community Centre kis Venue 65 South Close, Cowgate. Tickets 557 0469 from 6 August Box Office: 9.00amGray’s - 9.40pm. St Andrew’s & St George’s Church hii Children’s Shows Venue III 10am 13 George Street. Tickets 225103847 • Grimms Box Office: 3pm (Mon Fri) From Aug I 1-16Fairy 10.00Tales (11.00) Leicestershire £4.50 (£3.50) Youth Arts page 7 This elegantonceandagainhistoric Georgian churchprogramme in the heartofofdiverse Edinburgh’s Newevents. TownFinecaters for • Aug Hiawatha Leicestershire Youth(£3.Arts50) page 7 alperformances l tastes with a wide ranging musical Aug 18-23 12. 0 0 (13. 0 0) £4.50 by acclaimed local, national and international artists - and some are FREE! • Machine Gunners Leicestershire Aug 18-23 14.00 (15.00) £4.50 (£3.50)Youth Arts paged AlTIME l shows below canstated.be found under ST ANDREW’S & ST GEORGE’S AT FESTIVAL • WhyThe unlesslistedotherwise Aug 18-23 Whales 10.00 (11.Came 00) £4.50Leicestershire (£3.50) Youth Arts page 7 • Wind In The12.0Willows Leicestershire Dance/Physical Aug 11-16 0 (13. 0 0) £4.50 (£3.50) Youth Arts page 7 • Strictly Aug 10-16Scottish 19.30 (21.30)page£6.0037 (£5.00) Musicals/Opera • Aug HairI 1-23Leicestershire page 62(£3.50) Music (not 17) 20.Youth 00 (21.Arts00) £4.50 • Calluna Aug 19 19.The 30 (21.Clarsach 30) £6.00(Scottish (£5.00)Harp) Society page 41 Theatre • Aug Cantabile Brahms • The Killing(notof Sister Leicestershire 26 14.3Celebrate 0 (16.30) £6.00 (£5.00) page 56 Aug 11-23 17) 18.0George 0 (19.00) £4.50 (£3.50) Youth Arts page 92 • Aug Cantus • Aug Romeo And14.Juliet Leicestershire Youth Arts page 92 27 19.Angelicus! 30 (21.30) £6.00page(£5.5600) 11-16 0 0 (15. 0 0) £4.50 (£3. 5 0) • Catriona • TeeCHeRS Arts (£3.page50)92 Aug 20 19.McKay 30 (21.30)(Clarsach) £6.00 (£5.and 00) Chris Stout (Fiddle) page 41 Aug 11-23 (notLeicestershire 17) 16.00 (17.Youth 00) £4.50 • Cello Alchemy page 51 (£5.00) Aug 18, 2 2 14. 3 0 (16. 1 5) £6.00 Food and drink: Cafe 9. 0 0am 9. 0 0pm Aug 26 19.30(21.15) Disabled: Ent: 30yd Flat. Aud: 4yd Flat.WC. • Aug Cello21&12.Piano 30 (13.30)page£5.0056 (£4.00) • Aug Chanson d’Amour page 55 St Cecilia’s Hall kis 16 14.30 (16.15) £6.00 (£5.00) Venue 3 I cnr10.30am Niddry- 5pm Street & Cowgate. Tickets 650 2805 • Chopin Poland Box Office: Aug 28 12.and30 the (13.3Spirit 0) £5.00of (£4. 00) page 56 Designed by Robert Mylne i n 1760, St Cecilia’s Hal l i s the oldest purpose-built concert • Coalition page 55 halEdinburgh l in Scotland is the second Aug 12 14.30 (16.30) £6.00 (£5.00) MusicalandSociety foundedoldest in 1728.still in use in Britain.The hall was built for the • Aug The 20Coates Duo15) £6.00 page (£5. 56 00) 14.30 (16. Music • Czech Out! page£6.0056 (£5.00) • Amphion Anglicus - SongsHallof Mirth and Madness Aug 21 It14.30(16.15) Harpsichords • Aug Edinburgh Aug 28 15.00 at(16.St30)Cecilia’s £6.00 (£4.00)page 50 14 12.30Barock (13.30) £5.50page(£4.5500) • Paolo Aragona page 38 • Aug Ensemble Aug 25,27 15.00 (16.00) £4.00 (£3.00) 29 19.30 (21.page30)56£6.00 (£5.00) • Arborea • Aug Festival page 41(£6.00) Aug 9 15.0Musica 0 (16.30) Harpsichords £6.00 (£4.00) at St Cecilia’s Hall page 50 18 19.Ceilidh 00 (22.00) £7.00 • Castle To Cowgate Edinburgh Renaissance Band page 42 • Aug Fiddle,22 19.Harp and Voice page 41 Aug 15,16 110.6 20.00 (22. 30 (21.30) £6.00 (£5.00) Aug 3000 (12. 300)0)00) £6.00 (£4.50) • Aug Four26Poets, Eleven Composers page 56 Aug 23 19. (21. 12.30 (13.30) £5.00 (£4.00) • David Pollock - GoldbergHallVariations • Aug GlitterII 14.30page(16.5515) £6.00 (£5.00) Harpsichords Aug 26 15.00 at(16.St30)Cecilia’s £6.00 (£4.00)page 50 • An Impromptu Afternoon with Schubert page 56 • French Baroque Music Harpsichords Aug 30 14.30 (16.15) £6.00 (£5.00) Aug 14 15. 0 0 (16. 3 0) £6.00 (£4.00) at St Cecilia’s Hall page 50 • Vivien • John Kitchen-TheThree Couperins Aug 14 Liu 14.30 (16.page30)55£6.00 (5.00) Harpsichords • Aug Mark13Wilde and Alan£6.00Jacques Aug 23 15.00 at(16.St30)Cecilia’s £6.00 Hall (£4.00)page 50 14.30(16.15) (£5.00) page 55 • Loki Ensemble Singet Den Herren • Aug Masters Harpsichords 25 19.of30the(21.Keyboard 30) £6.00 (£5.0page 0) 56 Aug 21 15.00 at(16.St30)Cecilia’s £6.00 Hall (£4.00)page 50 • Aug Menage A Deux page 55 • Love’s Torments Music by Handel and his Contemporaries 15 12.30 (13.30) Free Harpsichords Aug 19 15.00 at(16.St30)Cecilia’s £6.00 Hal (£4.l00)page 50 • Aug MerlynII 12.Trio30 (13.page 55 30) Free • Lucy Cardan - J S Bach Partitas Harpsichords • Organ Aug 22 20.00 at(21.St30)Cecilia’s £6.00 Hall (£4.00)page 50 Aug 13,2Recitals 0,27 12.30 (13.page30)55Free • Lucy Cardanat-StJ SCecilia’s Bach Partitas • Aug Organ30 Spectacular page 56 Harpsichords Hall 12.30 (13.30) £5.00 (£4.00) Aug 24 20.00 (21.30) £6.00 (£4.00)page 50 • Aug Piano22 Recital • Aug Mozart Harpsichords 12.30 (13.30)page£5.0056 (£4.00) 12 15.and00 Beethoven (16.30) £6.00 (£4. 00) at St Cecilia’s Hall page 50 • Aug St Andrew’s and St Free George’s Choir and Orchestra page 55 • Aug O Tuneful Voice... Harpsichords 16 12.30(13.30) 16 15.00 (16.30) £6.00 (£4.00) at St Cecilia’s Hall page 50 • Scuola Aug 31 19.Geovia 30 (21.30)page £6.0056(£5.00) Food and Refreshments at time ofunadapted. certain performances only. • Song 55 (£4.00) Disabled: drink: Ent: Niddry Aud: level.WC Aug 18Recital 12.30 (13.3page 0) £5.00 wheelchair bookings toSt.unlock door. Induction Loop.Advise curator in advance re • Sostenuto page 55 Aug 19 14.30(16.15) £6.00 (£5.00) • Temenos Aug 17 19.Vocal 30 (21.Quartet 30) £6.00 (£5.page 00) 55 139


• • • J9 • •

V£NU£S St Cuthbert’s Parish Church Venue 122 on5 Lothian No smoking premises. Road Mus/c • Aug Choral10 18.Concert RoyalSUOD) Choral(£2.50 UnionC) page 42 00 (19.00)Edinburgh £5.00 (£4.00 Musicals/Opera • The Aug 18,Opera 19 17.Diva 00 (19.0Petticoat 0) £4.00Opera (£2.50) page 62 • StAugMatthew 16 16.00 (17.Petticoat 30) £4.00Opera (£2.50)page 62 Disabled:grounds Disabled can be brought to the door although there is no parking in Church

Musiche Virtual! Aug (21.330)0)Philomusica £6.00 (£3. (£3.00of00 C)C)Edinburgh page 54 Aug 2226 20.00 15.00 (16. £5.00 Phillida Bannister contralto, Alpin Smart guitar Philomusica Aug 18 20.00of(21.Edinburgh 30) £6.00page (£3.0054 C) Piano Favourites Philomusica Aug 23 15.00 (17.00) £6.00 (£3.00ofC)Edinburgh page 54 Take Philomusica Aug 16Me16.toYour 30 (17.30)Lieder £5.00 (£3.00 C) of Edinburgh page 54 William Revels (baritone) David Arditti (piano) Philomusica Aug 10,12,14of18.Edinburgh 00 (19.00) page £5.0054(£3.00 C) Disabled: Ent: 3yd 2.Aud: 5yd Flat.

St Mary's Cathedral ]7 Venue 91 Palmerston Place Box Office: 9.30am - 12.30pm Come and visit St Mary’s Cathedral, five minutes walk from Princes Street, West End. The largest ecclesiastical building built in Scotland since the reformation.Victorian Gothic daily 7.3splendour 0am - 9pm.by George Gilbert Scott. Concerts and services. Cathedral open Music St Giles Cathedral J12 • Aug Baroque Philomusica Venue 187 High Street, Royal Mile 24 20.00Concert (21.30) £6.00 (£3.00ofC)Edinburgh page 54 St Giles’ cathedral, the historic High Kirk of Edinburgh, where John Knox was minister. • Aug B Minor Mass St Mary’s Cathedral 9 19.30 (21.30) £7.50 (£5.00) page 56 Music • Aug Chrysalis-The 23 20.00 (22.Cathedral 00) £4.00 (£2.Concert 00) Chrysalis page 41 • Scottish Borders Wind & Chamber Orchestras Festival31 of18.00(19.00) British YouthFreeOrchestras page 46 • Aug Daily18-29 Choral Evensong St30Mary’s Aug (not 23, 2 4, 2 8) 17. (18.10)Cathedral Free page 56 Aug 27 16. 0 0 (17. 0 0) Free Musicals/Opera • Aug Mozart Requiem 10 20.00 (21.30) Philomusica £6.00 (£3.00ofC)Edinburgh page 54 • Jeanne Proscenium Aug 18,1D’Arc 9 19.45 (21. 45) £9.50Theatre (£6.00)Company page 63 • Aug Organ5,12,Recitals St (21. Mary’s15) Cathedral 1 9, 2 6 20.00 £5.00 (£3.00pageSUD)56 (£1.00 C) Food and Ent: drink:6ydLower • Aug Scottish Chamber Disabled: + 7 Str.aisleAud:cafe5ydopen Flat. all day. 17 20.00 (21.45) Choir £7.00 (£5.St00)Mary’s Cathedral page 56 • Sunday Aug 17,24Services 10.30 (11.St30)Mary’s Free Cathedral page 56 St John's Church 19 Aug 17,24 15.30 (16.30) Venue 127 West End, Princes Street Disabled: Ent:3yd I.Aud:4yd FlatWC. Music • Aug His Majesty Commands Arborea Musica And Friends page 39 St Michael and All Saints Church L9 25-29 17.30 (18.30) £6.00 (£4.00) Venue 95 Brougham Street • Arborea Loki Ensemble - Crudel Tiranno Amor Musica And Friends page 39 Music Aug 18-20,22 17.30 (18.30) £6.00 (£4.00) • StMusic at St Michael Church and All Saints • Aug Masters 11-15of17.the30 Concerto (18.30) £6.00Arborea (£4.00) Musica And Friends page 39 AugMichael 10,17,2&4Al11.l Saints 00 (12.30) Free page 56 Theatre Food and Level drink:access Coffeethroughout / Tea available after service • Aug Becket Disabled: - suitable for wheelchairs. 9-16 Exacting 19.30 (21.Theatre 30) £5.50Company (£5.00) page 83 Visual Arts St Ninians £6 • Aug West4-30End(notCraft Venue 71 Comely Bank Road Tickets 553 1549 Suns)and11.Design 00 (18.00)FairFree page 119 Theatre Food and Ent: drink:20ydLicensed 9.30pmaccessible by arrangement. Disabled: Flat.Aud:cafeI yduntilFlat.WC • Aug Of Mice And Men Edinburgh Theatre Arts page 83 Aug 8-21 9,16 (not 14.40 10,(17.17)30)19.40 (22.30) £6.00 (£5.00) St Mark's Unitarian Church J9 Food and drink: Wine and soft drinks available at time of performance Venue 125 1/2Castle Ent: 30Guide yds flatdogs4Strpermitted. HR.Aud:Help 2 ydsavailable flat.WCon(+3premises. 25”) inaccessible and unadapted Box Philomusica Office: hourTerrace before performance forDisabled: wheelchairs. The concerts offer varied programmes for young audiences, featuring a wide range of instruments and musical works performed in an intimate setting. St Peter's Church Hall pis A/1 us/c Venue 17is situated Lutton iPlace Box Office: performance • Aug Banquet of Musick StoffPeter’s n ora quiet partentrance of the cityI/2hr andbefore is easily reached eitherpeaceful by bus (itgardens, is just 10,113.5-19, 2(14.1,202,0)24,£6.00 2Philomusica 5 15.00 (16.of00)Edinburgh £6.00 page 54 a major bus route) car.The to the hall, through attractive Aug 23 0 0 is especially pleasant. Aug 12,14,20,26,27 20.15 (21.45) £6.00 • Cameo Edinburgh Theatre Aug 19,21 Philomusica 20.00 (21.30)of£6.00 (£3.00 page C) 54 • Cello • Aug Ne’er9-30the(notTwain Aug 11,&15Piano 17.00 (18.Philomusica 30) £6.00of(£3.Edinburgh 00 C) page 54 Suns) Edinburgh 19.45 (22.0People’s 0) £5.00Theatre page 82 • David Humeof Edinburgh violin, NeldapageHardie piano Food and drink: Coffee and biscuits performance. Philomusica 54 Aug 15,25 19.30 (21.15) £6.00 (£3.00 C) Disabled: Ent:40yd +I.Aud:WC (W at+ Mtime22”).of Disabled access to auditorium,coffee bar and ladies WC. (Gent’s WC up stairs) • Aug Francis Martineau Philomusica of Edinburgh page 54 24-29 22.00 (23.00) £5.00 (£3.00 C) • Aug I Violan of Edinburgh 27 13.Philomusica 00 (14. £5.00 (£3.00 C)C) page 54 St Serf's Church Hall ah Aug (21.0030)0)0) £5.00 £6.00 (£3.00 Venue 83 Clark Road, Goldenacre Box Office: 7pm - 7.30pm Aug 2829 20.00 15.00 (16. (£3.00 C) • Jocelyn Steele Philomusica of Edinburgh page 54 Theatre Aug 10 20.00 (21.30) £6.00 (£3.00 C) • Aug Kantaro Edinburgh • Cluicheadairean DhunGroup Eideann and82Friends 16,17,2Philomusica 4,29,30 20.00of(21. 30) £6.00page (£3.0540 C) Edinburgh Drama Aug 27-29 Gaelic 19.30 (21. 45) £4.00 (£3.page 00) • Leona Munro soprano, Lucia Micallef piano Philomusica • Aug Keep9-23in a(notCoolSuns)Place19.30Leitheatre Aug 23 20.00of(21.Edinburgh 30) £6.00page (£3.0540 C) (22.00) £5.00page(£4.9200) • Philomusica Michael Ladomery tenor, David Lyle piano Food and Ent: drink: Unlicensed, refreshments at time of performance. I.Aud: now 4ydlightFlatWC Aug 26,28,29of13.Edinburgh 00 (14.00) page £5.0054(£3.00 C) toDisabled: entrance from60ydpavement installed.(W 24”). Permanent sloping ramp, with handrail, 140


St Stephen's Centre FIO Venue 88 Foot of- 6pm Howe Street Tickets 556 2661 Box Office: I Oam The St Stephen’s Centre, designed by William Playfair ideal in 1826, occupiesinthethepride of place in NewaTown.The venue an auditorium for theatre upEdinburgh’s to 500)rooms with fine Father Willishasorgan. is theatre 250)round plus (seating stage. Various suitable for rehearsal, dance,Below exhibition. Cafespace open (seating during performances. Seventh Day Adventist Church Comedy <fi Revue Venue BristoandPlace Tickets 2819 hall. The venue188is a3bright attractive upstairs225church Musicals/Opera Musicals/Opera • Aug Redemption • The Wizard of Oz (21.The05)Scottish Theatre and Music School page 63 10-16 (notSong 13) 20.00Agape(22.Theatre 20) £5.00Co.(£4.page 00) 61 Aug 5-9,12-1619.05 £6.00 (£4. 5 0) Matinees Aug 9,16 14.05 (16.05) £6.00 (£4.50) Aug 11-15 (not 13) 17.00 (19.00) £5.00 (i Haggis, Theatre Aug 11-22Neeps (not 16,and17)Burns 12.10 (13.The35)Scottish £6.00 (£5. 00) and Music School page 103 Disabled: Access to Front Annex but no access into the Hall. AAugMidsummer Night’s Dream ArkleTheatre Company page 71 18-23 19.45 (22.00) £5.00 (£4.00) Once18-30 a Catholic The Sheraton Grand Hotel js Aug (not 24) 19.The50Scottish (22.20) Theatre £6.00 (£5.and00)Music School page 103 Venue 124 9am Festival Square, Lothian Road Tickets 229 9131 Box Office: -9pm Locatedsnack in themenu heartinofthethelobby city. We are an ideal pre/post theatre dining venue. Enjoy our festival £ 15.00 - and parking is free! bar from £7.00 or a two course buffet in the terrace from Theatre The Salisbury Centre PI4 Venue 46 25.30pm Salisbury- 7.30pm Road Mon-Fri Tickets 667 5438 Box Salisbury Office: The Centre i s an alternative education centre set i n a large Georgian house with atherapy beautifulandorganic garden.rooms. Near Arthur’s Seat. For hire: Large spacious studio, library, meditation Talks <£ Events • Aug Sanctuary - Festival of Healing page 67 10-30 10.13.Gardens 30 (13. £2.00 (£1. Aug (16.3000)0)0) £2.00 £2.00 (£1. (£1.0000)0)0) Aug 10-30 10-30 16.3300 (19.

serving snacks and meals from 7am-1 I pm. South Bridge Resource Centre Ki3 Venue 123 Infirmary Street Tickets 558 9991 Box Office: 10.30am IS mins after the last show starts Venue 123 iopposite s one of Edinburgh’s most central Streetworks, is justclassics off Southand Bridge and Chambers Street) hostingvenues a wide(Infirmary range of new comedy food andanddrink.the Three Weeks Fringe Showcase. Stop in our cafe and bar for great tasting Children’s Shows

Theatre • All California Aug In9-23The(notTiming Suns) 22.50 (00.05)Faultzone £3.00 (£2.page 50) 76 • The Art of(notCruelty Aug 25-30 28) 20.1Bare 5 (21.And35) Ragged £5.00 (£3.Theatre 00) page 73 • The Aug 11Broken -23 (notHeart 17) 23.1The 5 (00.Unseam’d 55) £5.50Shakeseare (£3.50) Company page 110 • Aug Death11-23and(nottheIT)Maiden 123 (£4. page00)111 13.40 (15.Venue 20) £5.00 • Aug Doctor Faustus Bare And Ragged Theatre page 73 18-23 20.14.1155 (21. Aug 25-30 (15.445)5) £5.00 (£3.50) • Aug Don 11-23 Juan (not HitsSuns) Middle15.Age! Venue 123 page 30 (16.45) £5.00 (£4.00) 111 • Aug Dracula Bare 28)And21.50 Ragged(23.Theatre 25-30 (not 10) £5.00page(£3.7350) page 0 (£3.01110) The 18-30 Handwriting, the Soup and the Hats Annex Theatre - USA page 71 Aug (not 24) 21. 1 5 (22. Scottish International at the Quad Ki2 Aug 26,28,30 12.00 (13.30) 45) £6.50 (£5.50) Venue 192 University Old College, South Bridge Tix 220 5606 • The Importance of Being Earnest Short00)Back & Sides page 104 Box beautiful Office: See Famoussurroundings Grouse House Aug I 1-23 (not 17) 11.45 (13.30) £4.50 (£3. The atmospheric oftheatre the- Scottish oldfeaturing collegeInterational quad provideEuropean a magnificent • Aug Khamasseen American University In Cairo page 70 setting for a programme of epic outdoor two major companies. 11-16 19.15 (20.45) £5.00 (£4.00) Fabulous food and drink available across the road at the Famous Grouse House. • Aug Life with Idiots Venue18.00123(19.page 111 (£5.00) 11-30 (not Suns) 0 0) £6.00 Theatre Aug 11-30 (not Suns) 19.10 (20.00) £6.00 (£5.00) Alternate show • Aug Macbeth Pulped(£4.0Fl0)ying Pig Theatre Company page 86 18-30 Pruned (not 24) and 13.55Henry (15.00)V£5.00 • Aug Open11-22 House California Faultzone Aug 9-25 (not 15,16,23) 2 (not Suns) 22.10 (22.40) £2.00page(£1.7650) • The Picture12.2of0 (14. Dorian Gray(£4.Bare Disabled: Ent: 20yd on access road Aug 25-30 00) £6.00 00) And Ragged Theatre page 73 • The Revenger’s Tragedy Aug 25-30 16.00 (17. 45) £6.00Bare(£4.And 00) Ragged Theatre page 73 Tempest (a Storm in a Teacup) Scottish Poetry Library k • The MasterI 1-30Rosencrantz’s page 94(£3.00) Venue 56 Tweeddale Court,the14year HightheStreet. Info 557 2876. Aug (not Suns) Little 10.50 Eyases (12.00) £4.00 Open public poetry, throughout SPL provides information • ThreeWeeks Fringe Showcase Venue 123 (£4. page00)111 indexestototheofScottish past andalwayspresent, for researcher or browser,andandautomated our wide Aug 12, 1 4, 1 9, 2 1, 2 3, 2 6, 2 8, 3 0 17. 0 0 (18. 50) £6.00 selection international poetry surprises overseas visitors. Aug 27,29 19.00 (20.50) Open Mon-Sat, noon-6pm;Thurs 2-8pm. • Trilogy of Sorrow Tamar Theatre Company, West Leigh page 106 Aug 18-23 19.15 (20.45) £5.00 (£3.00) Theatre • Aug Courtyard Readings Scottish Poetry Library page 103 Food and drink: Cafe available al l day. Licensed bar after 5pm and alandl daytoilets. on Sats.Studio and 11-30 (not Suns) 14.00 (15.30) Free Disabled:on Ent: 5yd. Aud:floor. Flat.Wheelchair access to Mainassistance auditorium cafe/bar the second (Call ahead for wheelchair to the second floor.) Disabled: Details not available Guide dogs admitted.

Scotch Malt Whisky Society bi Venue 102 9am The Vaults, Giles St. Leith. Info 554 3451 BoxareOffice: - 6pm.an87evening You invited to spend of entertainment while enjoying the ‘real tradition’ of Scotland, samplecrack’. its finest whiskies and listen to highland and lowland music, pipes, fiddles and ‘good Music • Aug The 17,24 Drouth20.00Festival (22.00)Spirit £5.00 page 47 • Aug Festival Spirit page 47 (22.00) £12.50 (£10.00) I 1-13, 18-20,25-27 20.00 Food and drink: Licensed bar all day. Aud: 14yd Flat.WC (28”). Guide dogs admitted, Disabled: (external). phone, helpEnt:8yd available.22Str Not HRadvisable for wheelchairs.


South Leith Parish Venue 180 Henderson Street Church Halls Children’s Shows • Aug Pips 12-30 and Panda’s (not Suns)Magic 10.30Egg(12.00)Purves £4.00International (£3.00) Puppets page 8 • The Aug Tinderbox 12-30 (not Suns)Purves 13.30International (15.00) £4.00Puppets (£3.00) page 8 Disabled: Ent:4yd flat.Aud:5yd flat.WC adapted and on ground level.

• Aug Undine A Bit (23. Of 3Rough 6-30 22.30 0) £6.00Theatre (£5.00)Company page 68 • Whale Music Exacting Theatre page 83 Aug 9-16 20.40 (22.10) £5.00 (£4.5Company 0) • Who Oxford Aug 6-16is Reginald 20.40 (22.Lummy 10) £5.00 (£3. 50) Brookes Student Union Drama page 96 and drink:1+7+1CafeStr.andAlsolicensed untilvia3am.Quarry Lane.WC (fully adapted). Aud: 32yd as Food ramp barat rear toDisabled: lift (30”) Ent: or 7+9+3.

Southside Courtyard Li3 Venue 16 Davie St. Tickets 667 2212 Children’s Shows • Aug Dotty24-30Quaver’s Last40)Symphony 18.40 (19. £4.00 (£3.00)On the Road page 8 • John ThreePeelBilligoats Gruff and Three Little Pigs Puppets page 7 Southside Community Centre, 117 Nicolson St. mi 2 Aug 11-23 (not 17) 11.00 (11.50) £3.50 Venue Tickets82667Southside 2212 Box Office: 10am - I am. Comedy <& Revue • Aug Mitch8-30Benn Children’s Shows 22.30The (23.3Laboratory 0) £5.00 (£4.page 00) 25 • Aug Circus9-30Workshop Magic Carpet Theatre pageS • Bottom OfTheHil BillpageIn A13 One-Man Show (Free) 10.10(11.45) £3.50 Peter Buckley Double Bil Price (with The Wizard of Castle Magic) £7.00 Aug 17-30 19.15 (20.10) Free • Aug The 9-30 Wizard10of(13.Castle Magic(£4.0Magi Theatre pageS • Aug Die on Stage, Loud American Steven Alan Green page 23 £5.00 0) c Carpet 40)Bastard £5.00 Double Bil12.Price (with25) Circus Workshop) £7.00 Aug 4-14,18-21,25-30 15-17,22-24 22.5022.50 (23.4(23. 0) £5.50 (£5.0(£4. 0) 50) • The Expert Comedy <£ Revue Aug 8-25 21.0at0 (22.the00)Card £5.00Table (£4.00)The Laboratory page 25 • Count ArthurPresents Strong’spage Drama Masterclass • Aug Science Made 19.Easy45 (20.The45)Laboratory Larry Trafalgar 25 8-25,29,30 £5.00 (£4.00)page 25 Aug 6-14,17-21,25-30 0 (19.00)00)£5.50£5.00(£5.(£4.00)50) • The Spite Boys The30 22.Laboratory page Aug 15,16,22,23,24 18.18.00 0(19. 8-1 1, 1 3-18, 2 0-25, 2 9, 1 5 (23. 3 0) £4.5025(£4.00) • The Magic Show • Aug Star8-14,17-21,26-30 of German Comedy!!! Earl Okin page 29 Aug 8-25,29,30 21.30Ian(22.Kendall 30) £5.00page(£4.2400) 30) £7.00 • Aug Porteous and Archer Experience Porteous & Archer page 30 Aug 15,16,22-25 20.1020.10 (21.30)(21.£7.50 (£5.50)(£5.00) 8-30 20.20 (21.20) £5.00 • Aug Stand6-23Up19.Straight page (£4. 32 00) Dance/Physical 05 (20.05) £5.00 • Aug A Midsummer page 36 • Still Horny After All30These Years Earl Okin page 29 24-26,29,30 Nights 11.00 (13.Dream 40) £5.00The(£4.Laboratory 50) Aug 9, 1 5, 1 6, 2 2, 2 5, 2 9, 16. 1 0 (17. 1 5) £6.50 (£5. 0 0) • Aug Portrait Game The Laboratory page 36 Aug 23,24 16.10 (17.15) £7.00 (£5.50) 10-23 11.30 (12.30) £4.50 (£4.00) • Terrorist A.S - A(£4.New Aug 17-30Tarts (not 28)Undercover 19.15 (20.15)S.£5.00 50) Force in Comedy page 31 Musicals/Opera • Aug Hit The On 0the0) £4.00 Road (£3.page00)62 Dance/Physical 25-30Road 14.05 (15. • Aug Dorothy 9-16 of18.4Oz5 (19.Burklyn 45) £5.00Youth(£4.Ballet 00) page 34 Theatre • Wired 36 • Adolf Aug 10-14,The119.8-211Laboratory 16.1050)(17.£5.00 1page 0) £5.00 Aug 8-30The(notLaboratory 28) 18.30 (19.page20)91£5.00 (£4.00) Aug 24-30 0 (20. (£4.50)(£4.50) • Antigone Aug 15-24 13.Exacting 30 (15.0Theatre 0) £4.00Company (£3.50) page 83 Music • Away Wi’The Faeries The • Aug Gareth Hedges The Laboratory page 52 Aug 8-16 17.00 (18.00) £3.50 (£2.Laboratory 50) page 91 24-30 14.15 (15.45) £5.00 (£4.00) • Aug Christmas & No20)Theatre 8-16 (notin 10)July19.Yes 15 (20. £6.00 (£5.Co00)page 112 Musicals/Opera • Aug ClaraI 1-24The(notLaboratory • Aug Barrie8-30 The Company 63 parties) 17,23) 15.2page 5 (16.9140) £5.00 (£4.00) (notRealistic 10,17,25)Theatre 16.10 (17. 50) £6.00of Edinburgh (£4.50) (£3 page for school • Aug Eclipse18-25The17.0Laboratory • Aug Birth8-14,19-21,24-27 of a Man The22.Edinburgh University Footlights page 61 0 (18.15) £5.00page(£4.9150) • Aug Enemy: Project Ibsen4Aurora/Western Connecticut State University page 72 Aug 15-17,22,23,29,30 22.1155 (23. (23.550)0) £6.50 £7.00 (£5. (£5.050)0) 0 (19. 0) £6.50(£5.(£5. • Aug Cabaret 26 Theatre Aug I15,I -14,16,127,2,2139-2118.418.0 (19. 50) 5£7.00 50) 00) 9-24 00.Trip15 (02. 15) £5.00Company (£4.50) page 63 • Female Parts The Laboratory page 92 • Aug Company Cambridge University ADC 61 Aug 18-20 14.45 (15.20) £4.50 (£4.00) (21.45)page Aug 6-11,13,14,17-19,21,25-27 15,16,22-24,29,30 20.10 (21.20.10 45) £7.50 (£6.£7.00 50) (£6.00) • Aug Gagging 8-17 Britannia 16.00 (17.45)The£5.00Laboratory (£4.50) page 91 • AAugSlice17-30of 18.Saturday Night Youth Connection page 63 • Gangster 15 (19.50) £6.00 (£5.00) Aug 7-30 (notNo.17,I 28)Black21.50Light(23.Theatre 45) £6.00Company (£5.00) page 74 • The Time Machine Shrewsbury School page 63 • Glen Garry15.Glen The (£4. Laboratory Aug 25-30 14.00 (15.45) £7.00 (£5.00) Aug 21-23 00 (15.Ross 50) £4.50 00) page 92 • Aug Hard18-20 Positions Theatre 15.25 (15.The50)Laboratory £4.50 (£4.00)page 92 • The Arnold Crombeck Story Desirable Residence Theatre page 80 • JFK OD’d The Laboratory 91 (£4.50) Aug 9, 1 1, 1 3, 1 5, 1 7, 1 9, 2 1, 2 3 18. 0 0 (18. 5 0) £5.00 (£3. 5 0) Aug 9-39 (not 17,26) 15.30 (16.page 20) £5.00 • Aug Big Word • AAugLife17-30in the17.0Theatre Menagerie 7-30 18.Performance 00 (19.00) £5.0Poetry 0 (£3.00) page 73 0 (18.30) £6.50 (£5.50)Theatre Company page 94 • Aug Brief8,and Big Time Perfect Desirable Residence Theatre page 80 • Aug Made18-20 In Spain 10,12,14,16,18,20,22 18.00 (18.50) £5.00 (£3.50) 14.10 /Tony (14.40)Grounds £4.50 (£4.00)The Laboratory page 92 • The Dismissal • Aug Moliere’s L’Avare (The Miser)(£4.50)Moliere for Lunch page 94 Aug 24-30 13.40 (14.The30)Laboratory £5.00 (£4.5page 0) 91 24-30 16.20 (18.45) £5.00 • Eleemosynary • Aug My Sister Laboratory Bristol13-23Old(not Vic Theatre 9-21 (notin This 17) 11.House 30 (13.4The 0) £4.50 (£3.50) page 91 Aug 17) 14.3School 0 (15.3Graduating 0) £7.00 (£5.Students 00) page 75 • Aug Nobody Here But orUsIT)Chickens National Student00)Theatre Company page 95 • An Evening withStudent Gary Union LinekerDrama page 96 9-25 (not Mons 17. 1 0 (17. 4 Oxford Brookes Aug 9-30 (not Mons or 17) 21.55 (22.20)5) £4.00 £4.00 (£3. (£3.00) Aug 17-30 (not 21,28) 20.40 (22.10) £5.00 (£3.50) • Oleanna • Aug Fugue6-30 Bats Fork Tongue Theatre (Sheffield University Theatre Company) page 86 (not 12,page20)7316.50 (17.40) £5.00 (£4.00) Aug 17-23 16.10 (17.40) £5.00 (£4.00) • Aug A Kind Heart and15)a Big Pulse page 101 • Aug I Man21-234 Monologues The Laboratory 19.Crane’s 15 (20. £5.00InDonger (£4.50) Dark 14.00 (14.55) £4.50 (£4.00) page 92 • Aug Miles6-16 and Men Black Matter page 78 • Aug Rambling Dr Johnson 6-30 15.30 (16.30) £4.00 (£3.00) 7-30 13.Sam 00 (14.-The 00) £5.00 (£4.50) Show APIP Production page 71 • A‘Saunders • Aug Striker! Sutton Coldfield College Aug 10-16 14.4Sandwich’ 0 (15.40) £4.00Herrick (£3.5Theatre 0) page 89 16-23 21.00 (22.00) £5.00 (£4.50)page 105 • Aug Sex 6-23 and (not Death17) 14.National • Two The Laboratory 05 (15.Student 45) £6.00Theatre (£4.00)Company page 95 Aug 11-24 23) A14.ud:page 0010yd (15.91 1+I3+I4WC 5) £5.00 (£4.(F00)25” M awkward corners) • Aug Sexual8-23Perversity Disabled: Ent: (not 14yd 17,1/2+1. (not 12,17)in14.Chicago 00 (15.10)Absinthe £5.00 (£4.0page 0) 68 142


The Famous Spiegeltent jn Venue 87 TopI lamofWaverley Centre, Princes St Tix 558 8010 Box Office: I 1.30pm and on the door Stunning 1920’s ofmirror and wood dancesounds. salon provides the perfect surroundings for 30. . days nights music,festival jazz andlounge. laughter. dance,andmeet, party,salivating drink, hang,sightschil and- treat The Cabaret, Spiegeltentworldas your Comedy <& Revue • The Regency Rooms(01.with00)Lenny Beige page 31 Aug Aug 2218-21, 23.3024,2(02.5 23.30 00) £8.00 £8.00 • Shane PreviewsStAugJames 6,7 19.00page(20.310(21. 0) £5.00 (£6.00) Aug Aug 8-19,22-26,29,30 20,21,28 17.00 (18.20.30 00) £8.0030)(£6.£8.00 00) • Paul Zenon page 33 Preview Aug 9-30Aug(not8 23,22.0028) (23. 22.0000)(23.£4.0000) £7.50 (£6.50) Music • Amadinda at the Spiegeltent Hungarian Merlin(£5.International Aug 17 19.Overtures/ 00 (20.10) £6.50 50) Theatre page 51 • Aug Blue10,House The(00.Spiegeltent - sponsored by Beck’s Bier page 57 2 6 23.30 3 0) £6.00 (£4.00) Aug 23-25 17.00 (18.00) • Aug Kev Carmody 3The0) £6.00 Spiegeltent - sponsored by Beck’s Bier page 57 Aug 2114 18.18.0300 (19. (19.30) (£4.00) • The EricSpiegeltent Bogle in Concert sponsored Aug 20,21 20.00-(21. 30) £7.00by(£5.Beck’s 00) Bier page 57 • The The Spiegeltent Honkin’ Hep Cats by Beck’s Bier page 57 sponsored Aug 3-7 20.30 (22.30) £7.00 (£5.00) • The Hoodangas Aug 8,9,11-14 23.30 The (01.0Spiegeltent 0) £6.00 (£4.- sponsored 00) by Beck’s Bier page 57 • Judy Jacques’ Lighthouse The Spiegeltent sponsored by Beck’s Aug 4,5,7-10 17.00 (18.30) £5.00 (£4.00)Bier page 57 • The Knocking on Kevin’s Door Beck’s Bier page 57 sponsored Aug Spiegeltent 27-30 12.30- (13. 30) £6.00by (£4. 00) • Lajko andOvertures/ LorinszkyMerlin at theInternational SpiegeltentTheatre page 51 Hungarian Aug 15,16 19.00 (20.00) £6.50 (£5.50) • The Madam & Her- Orkestra Spiegeltent sponsored Aug 23-5,20.30 £5.0000)(£4.by00)Beck’s Bier page 57 Aug 8 -1327(22.19.17.0000)00 (20. Aug 15-19, (18. 0) Aug 30 23.3012.(02. 00)30)0Children Aug 21-25 30 (13. under 12 Free • Aug My Friend the Chocolate Cake page 53 15-17 23.30 (00. 3 0) £7.50 (£6. Aug 18,19,22-24 19.00 (20.00) 00) • The Rory McLeod -insponsored Concert Aug Spiegeltent 30 19.00 (20.00) £7.00 (£5.by 0Beck’s 0) Bier page 57 • Aug Ruby3-5Fruit Jungle The Spiegeltent 23.30 (01. 0 0) £6.00 (£4. 0 0) - sponsored by Beck’s Bier page 57 Aug 22-25 14.00 (16.00) • The Sensitive -New Age Cow Persons The Spiegeltent sponsored by Beck’s Bier page 57 Aug 9 19.0(00.0 (20. Aug 26,27 223.30 30)00) £6.00 (£4.00) • Judy Small The Spiegeltent sponsored Aug 17.00 (21. (18.330)0) £7.00 (£5.00) by Beck’s Bier page 57 Aug 2627 20.00 • The Well Oiled Sisters by Beck’s Bier page 57 The Spiegeltent(18.- sponsored Aug Aug 2522 19.17.0000 (20. 000)0) £6.00 (£4.00) Talks <£ Events • The Refreshing- sponsored Room by Beck’s Bier page 67 The Aug Spiegeltent 2-30 10.00 (17. 00) Free Food and Completely drink: All dayaccessible bar and -caferamped throughout, disabled toilet. Disabled:

VCNUCS Stockbridge Parish Church Venue 140 1/27B hour Saxe before Coburgperformances Street Info 332 0122 Box Office: Music • Chamber music concertsChamber sung by young people Edinburgh Aug 25-30 Festival 19.10 (21.ofYouth 15) £5.00 (£4.00)Choirs page 42 Disabled: Ramp access to street.

eio

The Subway k/2 Venue 79 691/2Cowgate Box best Office: hour before eachof theperformance The place to be i n the heart city The Cowgate’ open 7 nights a week, lots ofCrazy entertainment. l day during the festival with superb shows. Not to be missed. promotions.Open Free algiveaways. Musicals/Opera • Aug NiceI Girls 1-23 (notHarland Weds) Hamstrings 14.00 (15.4Theatre 5) £4.00 Company (£3.00) page 62 Theatre • Aug Blood,10-23Sweat and Tears16.00 Harland Hamstrings (not Weds) (17.45) £4.00 (£3.00)Theatre Company page 89 • Aug On the10-23Piste Harland20.00Hamstrings (not Weds) (21.45) Theatre £4.00 (£3.Company 00) page 89 • Aug Up‘n’Under Harland18.Hamstrings Theatre(£3.Company 10-23 (not Weds) 00 (19.45) £4.00 00) page 89 Food and Aldrink: Disabled: l on oneLightlevel.snacksSmallavailable step to Gent’s toilet. Telford College Venue 136 Crewe Toll Theatre • The Slab Boys Aug 15-23 (not IT)Dice19.3Theatre 0 (21.30)Company £6.00 (£4.page 00) 80 Disabled: Details not available

bs

Theatre Workshop F9 Venue 20 3410am Hamilton Place.MonTickets 226 5425 Box Office: I 1.30pm Sat, 10am 11 pm Sun. 1995world: HeraldNewAngelYork,Award winnerWarsaw, for venue programme.The best newandtheatre from around thePerformances, Managua, London, workshops and street carnival. All Liverpool, day cafe/bar.Inverness Come and joinKirkcaldy. the festival. Theatre • Aug Cleo18-24Theatre 10.15Workshop (11.35) £4.50page(£2.10850) • Aug Desires and Dreams Theatre(£2.Workshop 11-16 10.30 (11.30) £4.50 50) page 108 • Aug Diriamba! 8-25 (notTheatre 10,17) Workshop 17.30 (18.30)page £6.50108(£3.00) • Carnival Diriamba!AugNicaraguan 24 14.00 (17.Carnival 30) and Workshops Theatre Workshop page 108 • Aug Doctor Felix 17)Wierszalin 112 (£4.00) 14.00 (15.page 00)11-13, £7.00 Double11-23Bil (not (with Dybbuk)Aug 18-20 £9.00 (£7.00) • Aug Dybbuk Wierszalin page 112 30) £8.00 Double11-23Bil 21.(with15 (22. Doctor Felix) (£6. Aug00)11-13,18-20 £9.00 (£7.00) • Aug Fecund 11-25Theatre’s (not 17) 2715.45Theatre (17.00) Workshop £6.00 (£4.00)page 108 • Aug Naked8-23Wedding Theatre Workshop (not 10,17) 19.15 (20.15) £7.50 page (£6.00)108 • Aug Rats11-25 in the(notTunnel 17) 12.Theatre 00 (13.3Workshop 5) £6.00 (£3.page 50) 108 The Square Centre L12 • Shadow Boxing Theatre Workshop page Venue 77 Nicolson Square Methodist Church. Aug 8-25 (not 10, 1 7) 22. 4 5 (23. 5 5) £7.00 (£4. 01080) BoxNicolson Office: 1/2Squarehr before performances. • Aug Unreal21-25Estate Theatre Workshop page 108 Put at the centre of your festival. Cafe open Monday Friday 8. 3 0am21.30 (22.30) Free 3.30pm artists.Visitors for freshly cooked mealsatandchurch home-baking. chapelatandI lamgardens. visiting welcome services onQuietSundays and 6.3Exhibitions 0pm. by Food and drink: Cafe and licensed bar all day. Disabled: Ent: 3yd Flat. Mai n Aud:Cafe25ydaccessible. Flat.WC on leveldogs(Adapted). Studio: Lift available, Music voice braille • Aug Homage system,synthesiser, help available. Verybuttons. accessible. Minicom 226Guide 5425. admitted, induction loop 19-22to13.Segovia 00 (13.55) Segovia £6.00 (£4.Guitar 50) Trio page 56 Musicals/Opera • Aug Charles Wesley 1707 Jasperian Theatre Company page 62 BUS INFORMATION Aug 2421-23,25-30 14.30 (16.19.40)30 (21.40) £6.00 (£4.50) LRT 0131 Food and Ent: drink:15ydRestaurant and cafe2yd8.f!at.WC 30am - 3.(adapted), 30pm (Mon-Fri) SMT 0131 555 663 6363 9233 (24 h( Disabled: Flat 9 Str. A ud: or Ent. at side: 20yd ramped. Traveline 0131 225 3858 Aud: 4yd flat then ramped. Cafe: ent from side ramped. WC (adapted).Wheelchair kept on premises, Guide dogs admitted. 143


Tron9 9Ceilidh K12 Venue Square,House High St. Tickets 220 1550 Box Office: IHunter lam - midnight Comedy <& Revue ¥ • HovisStandPresley:Wherever Lay32 My Hat...That’s My Hat Comedy Club 00)pageI£2.00 Preview Tiny Mo's Speakeasy lm The Aug 8-24Aug16.0I 016.(17.0000)(17.£4.00 (£3.00) Venue 99 60 The Pleasance • The Lumberjacks on Ice: Comedy Take a dive& gambling down tojoint Edinburgh’s newest venue! Acabaret, pleasantlykaraoke situated,andpint-sized, il egal StandAugComedy 32from the Colony drinking crammed with comedy, more! Sumptuous Previews 3,0 4(18.17.4Club 30)0 £4.00 (18.page 40)(£3.£2.00 decor. Seats 12. Available for conferences, weddings, funerals & other acts. Aug 7-30 17. 3 00) Call Tiny Mo on 0131 556 1513. Music Comedy <8 Revue • Absolute Blues (00. and15)More • Aug Brand6-30X 20.00 Presents Aug 17-24 22.30 £6.00 (£5.page00) 38 (20.3Tiny 0) £2.00Mo’s Big Time Cabaret Tiny Mo’s page 33 • Aug Bachue Tradition 29-31Cafe19.3-0The (21.0New 0) £5.00 (£4.00) Tron Ceilidh House page 58 Disabled: Details not available • Chantan-The Aug 20-23 19.30 New (21.00)Tradition £5.00 (£4.0Tron 0) Ceilidh House page 58 • Brian McNeill-The New Tradition Traverse Theatre j? Aug 15-18 19.30 (21.00) £5.00 (£4.00) Tron Ceilidh House page 58 Venue 15 Cambridge Street, off Lothian Road Tickets 228 1404. Boxyour Office: 10ampulse - I I pm • James Aug I 1,Malcolm-The 13,14 19.30 (21.0New 0) £5.00Tradition (£4.00) Tron Ceilidh House page 58 Set theatrical racing an explosive mix of Scottish and international new work. The Observer.‘Where place to be...one ofshould the most important theatres in Britain.Times. . goodCallfood,nowgoodfor beer. ’ • Aug Rod 24,26-28 Paterson-The New Tradition 19. 3 0 (21. 0 0) £5.00 (£4.00)Tron Ceilidh House page 58 The you turn but the Traverse?’The your FREE brochure. • The Tron Ceilidh House Traditional Folk Music Sessions Tron Ceilidh15.0House pageFree58 Theatre Aug 4-30 0 (18. 0 0) Aug 4-30 21.00 (midnight) Free • Anna Weiss 6 Traverse • Valery Previews (20.Theatre 30)(£6.Aug00)page 7 14.109 00 (15.30) £6.00 Aug 10-16Ponomarev 22.00 (00.3Quintet 0) £7.00 (£5.Tron00) Ceilidh House page 58 Aug 812,19.16Aug 0019.(20.3019.3(21. 0)00£10.00 Aug 0 0) Aug 13, 1 7, 2 2, 2 7 11. 0 0 (12. 3 0) Aug 14 13. 1 5 (14. 4 5) Aug IS 15. 4 5 (17. 1 5) Aug 19, 2 3, 2 8 14. 3 0 (16. 0 0) Theatre Aug 20,24,29 17.00 (18.30) Aug 21,26,30 20.30 (22.00) • Aug Rita,5-24 Sue 14.and00 Bob • Blue Heart Theatre page20 109 (15.3Too 0) £4.00The(£3.Stand 00) Comedy Club page 105 Previews Aug11.019Traverse 11.0105)(13. 15) Aug 13.30 (15.45) £6.00 Aug 23, 2 8 0 (13. £10.00 (£6. 0 0) Food and Ent: drink:3ydRestaurant, snacks, licensed bar alStl day. Aug 24,29 13.30 (15.45)15) Disabled: 2 forStr.Aud:2yd Str+lyd+14 r. 7yd Help +2 Stravailable. HR.WC unadapted at Aug perf level. Unsuitable wheelchairs.+13Guide dogs admitted. Aug 21,22,2726,319.0 317.0 0(21.0 (19. 45) • Aug Celle-La Traverse Theatre page 109 912,20.00 (21.15) £10.00 (£6.00) Aug 67 19.17.00(18.15) Usher HallRoad j? Aug 13,14 1111.00(12.15) 30 (20.45) Venue 176 Lothian Aug Aug 15 13.30 (14.45) Music • The • The Orchestra Scotland page 53(£4.00) (£1.00 SC) Aug 7,Corridor 12,16 11.14.4155Traverse (12. 525)5) Theatre £8.00 (£5.page 00) 109 Aug 5National 19.30 (21.Youth 30) £16.00 (£8.00),of£10.00 (£6.00), £7.00 Aug 8,13,17 (15. Aug 9, 1 4 16. 4 5 (17. 5 5) Disabled: Details not available Aug 10,15 19.15 (20.25) • The Aug 7,Cub 12,16 Traverse 19.11.45(13.15) 15 (20.Theatre 45) £8.00page(£5.01090) Valvona Crolla as Aug 8,13,17 Venue 67 198.30am Elm<&Row, top of Leith Walk. Tickets 556 6066 Aug Aug 9,10,141514.16.1545(15.(18.45)15) Box Office: 5.30pm. Onefestival of the fringe finest delicatessens worldspace with ‘beyond a caffe bar, bakery, wine cellar, cookshop • The Designated Mourner and productions ninathetheatre Aug (13.525)5) £8.00Traverse (£5.00)Theatre page 110 Aug 20,21,19,2224,6,3,232908 14.16.11.144555 (15. cheeses, balsamic vinegars and iolive oils’ (Sunday Times). the treasure house of salamis, Aug (18. 2 5) Music Aug 22,27 19.15 (20.55) • Aug Disco7-30Pigs21.4Traverse • Aug Donald Cellist(£4.Valvona page 58 5 (22.50)Theatre £8.00 (£5.page 00) 110 30Edinburgh 11.Gillan 00 (12.Solo 0Quartet-A 0) £6.00 0Classical 0) & Crolla • Aug Earthquake Weather Traverse Theatre page 109 • The Choice & Crolla page 58 7,12,16,19,23,28 14.16.1455 (15. 415)5) £8.00 (£5.00) 25,26 11.Youth 00 (12.Orchestra 10) £10.00 Ensemble (£8.00) ValvonaValvona Aug 8,13,17,20,24,29 (18. • Aug Edinburgh & Crolla page 58 Aug 9, 1 4, 2 1, 2 6, 3 0 19. 1 5 (20. 4 5) Aug 27,28 11. 0 0 (12. 1 0) £6.00 Aug 10,15,22,27 11.45 (13.15) • Aug Loki 11,Ensemble • The Gogmagogs Traverse 12,18-20,2‘Masters 2,23 11.00of(12.the10)Baroque’ £6.00 (£4.0Valvona 0) & Crolla page 58 Aug 26-30 23.00 (00.Gigagain 10) £8.00 (£6. 00) Theatre page 109 • Aug Luca13-16 Villani11.Plays: Five Centuries of Guitar Valvona & Crolla page 58 • The Hanging Tree Traverse Theatre page 110 00 (12.00) £6.00 (£4.00) Aug 19,224,3,2298 11.19.4155 (13. (20.145)5) £8.00 (£5.00) • Valvona Neapolitan Songspage(Canzoni E Racconti di Napoli) Aug 20,21,26,30 & Crolla 58 Aug 14. 1 5 (15. 4 5) Aug (21.110)0) £6.00 (£4.00) Aug 22,27 16.45 (18.15) Aug 27,13-16, 28,2390 20.00 18.00 (19. • John Hegley Traverse Theatre page 109 Aug 8-17 22. 0 0 (23. 1 0) £9. 0 0 (£6. 0 0) Theatre Aug 19-24 23.00 (00.10) • Aug Christ8,9,Stopped at Eboli13.00Valvona Crolla(£4.0page • Aug Hellcab Traverse Theatre (18.page00) 109 11 -15,18-23,30 (14.10) &£6.00 0) 111 • Valvona Surely You’re Joking Mr111Feynman - Adventures of a Curious Character Aug 8,7,9,1113,2,4,1127,6,1,2120,9,6,2234,3,0 2211.98 419.16.5 14(13.55 (20. 30) £8.00 (£5.00) & Crolla page Aug 0 0) Aug 1 -16,18-23,30 18.00 (19.10) £6.00 (£4.00) Aug 10,15,22,27 14.15 (15.30) Aug 8,169,113.00(14.10) • Previews Knives InAugHens Traverse Theatre 10915) £6.00 • Aug TheVandegrifter 3 20.00 (21.15)(£6. Aug00)5 19.page00 (20. 8, 9 , 1 1,12,18-23,21Valvona 5-29 20.00& Crolla (21.10) page £6.00111(£4.00) Aug 7 19. 0 0 (20. 1 5) £10.00 Aug Aug 813,14.00(15.15) Aug 12,15)16,Aug 21,26,143019.14.3030(20.(15.45)45) Aug 25,26 30 15.018.0 0(16.0 (19. 10) 0) Aug 1 7, 2 2, 2 7 17. 0 0 (18. Aug 15,20,24,29 11.00(12.15) Aug 19,23,2820.30 (18.15) Food and Ent: drink:6ydRetail Delicatessen, Merchant and Caffe Bar for wheelchair users. • Aug Pay What Disabled: I Str.HelpAud: 45yd 8 StrWineHR.WC adapted. Unsuitable 10 20.00You(22.Can40) Premiere £2.00 or moreCommunicado Theatre Company page 77 Guide dogs admitted. available. • The Suicide Traverse Theatre page 109 Aug 12,14 115.6,2451,2(18.6,3205)11.Aug 00 (13.40) Aug 13,17 13.15 (15.55) £10.00 (£6.00) Aug Aug 8 17.00 (19.40) 15Aug18.20,15 2(20.4,2955)19.30 (22.10) Aug 22,19,2273,213.30(16.10) The158Venue Venue 15 Calton Roadlate Tickets 557 dance 3073 club style floors, one live music ji4 Visual Arts Three floors, three bars with licences, two floor with stage.Venue promotes major touring and local bands for last ten years • Aug Dazzle Contemporary 8-30 Dazzle 10.00 (midnight) Free Jewellery page I IS Comedy £ Revue Food and drink: Licensed bar and Henderson’s cafe, al l day until very, very late. Off the Fence(midnight) Comedy£10.00 Benefit(£7.00)LM Magazine page 26 Disabled: Ent: 16ydGuide flat.Aud:dogs15ydadmitted. flat to Wheelchair lift (large, braille buttons). WCloop. adapted atavailable. Ent and • Aug 17 20.00 Aud level, handrails. spaces, induction Help Very accessible. 144


Music • The Venue12,14-17,page19,2581 -24,26,28-30 22.30 (04.00) Aug 8-10, Food and drink: not Licence til 3/4 am Disabled: Details available

¥

Youth International at St Oswald's ns M6 Venue 128 10am Montpelier Park Info/Tix 346 1405 or 229 5562 Box Office: 10pm Having excelled in ‘96andYouth International Oswald’s withonceawardagainwinning, innovative from thecontribution UK,returns USA andtoto StLatvia people havetheatre an excitingdance and dynamic make toproving the arts. that young Musicals/Opera • Aug Chasing Deadlines 10.1500)(11.American 50) £3.00 High (£2.0School 0) Theatre Festival page 61 Aug 1710,118.2,1140 (19. • Aug Dido19-23 and Aeneas Operaworks page 16.00 (17.15) £5.00 (£3.00) 62 • The Hired(notMan28) The Aug 25-30 19.00RAT. (21.0Pack 0) £5.00page(£4.6300) • Aug Quilters American High School Theatre 2,15 22.45 (00.15) £3.00 (£2. 00) Festival page 61 Aug 10,II 118.15(19.45) • AAmerican (Rock-n-Roll) Midsummer Night’s Dream Aug 2,High 14 16.School 10 (17.Theatre 50) £3.00Festival (£2.00)page 61 Aug 10,16 110.10(11.50) • Tumbleweeds High School Theatre Festival page 61 Aug 12.1American Aug 11,14 122.3,1450 (00. 205)(13.55) £3.00 (£2.00) Wango’s Big Top m i i • Working Aug 3,/15Playing 10.10 (I 1.American 55) £3.00High (£2.0School 0) Theatre Festival page 61 Aug I171,116.10(17.55) Venue 164 2ThehoursMeadows Box Office: before performance Theatre Step intoWango’s Big Tope music, for Cirque Diesalslighting, stunt designer circus withseating, a twist.heating. 10 nights of Cabaret/Circus interactive • Asleep Page 0336 745321withforlivprogramme. Aug 26-30Under 15.45The (17.0Dark 0) £5.00Earth(£3.00)Gordonstoun Youth Theatre page 8i • AAmerican Company ofWayward Saints page 70 Dance/Physical • Aug Crash14-23Positions! Aug 14,High 17 (00. 14.School 1205)(15.Theatre 55) £3.00Festival (£2.00) 19.00 (21.Cirque 00) £7.50Diesal(£5.00)page 34 Aug 10,13 22.40 • The Diviners American High School Food and drink: Absolut bar and snacks at performance time. Aug 11, 1 3, 1 5 14. 1 0 (15. 5 5) £3.00 (£2. 00)Theatre Festival page 70 Disabled: Access to all areas. Aug 16 22.40 (00.25) • American Ladies in High Waiting / Silent Death Festival 10,I I 122.50 2 18.2(midnight) 0School (19.30)Theatre £3.00 (£2. 00) page 70 Whistlebinkies kis Aug Aug Venue 170 5/6 South Bridge Aug 16 12.20 (13.30) Music • The Love 22.30 of the Nightingale The0Pl0)ayer’s Company page 97 Aug 18-23 • Whistlebinkies Unplugged Cellar Club page 58 Aug 25-30 21.30 (midnight) (23.00) £6.00£6.00(£4.(£4. 00) Aug 4-30 13. 0 0 (17. 0 0) £2.00 • A Migration of Souls Edinburgh Youth(£3.Theatre Aug 4-30 22.00 (01. 0 0) £3.00 Aug 14-23 (not 17) 19.45 (22.00) £5.00 00) page 83 Aug 4-30 01.00 (05.00) £5.00 • The Outsiders American High School Theatre Festival page 70 Disabled: Details not available Aug 11, 1 3, 1 6 16. 1 5 (17. 4 5) £3.00 (£2. 0 0) Aug 17 12.15 (13.45) • Roomers 12,16 /14.Stages 2(19.0 (15. 40)7 £3.00 (i W J Christie's kio Aug Aug Venue 106 27-31 West Port, Grassmarket Tickets 229 4553 Aug 1315 16.18.2200 (17. 440)0) • Aug Serious Money American High School Theatre Festival page 70 Comedy <£ Revue • John Gillick:Comedy GenderClubis apage Mandatory Field Aug 910,18.12,1154(19.12.415)5 (13.45) £3.00 (£2.00) The Stand 32 • Swan Lake of clowns Youth Theatre - Latvia page 113 Preview 50) £2.00 Aug 25-30 17.- 3the0 (18.ballet 30) £5.00 (£4.00 SDC) Aug 7-24Aug20.002 20.00 (20.50)(20.£4.00 (£3.00) • Walking 2nd Nature page 103 • Scarlet Harlots The (22. Stand Comedy Club page 32 Aug 18-23 18.00 (19.10) £5.00 (£4.00) Previews Aug 7-24Aug 21.103,4(22.21.10 10) £4.0010)(£3.£2.00 00) Food and Ent: drink:sideRefreshments • JulThe31,Aug Stand2,29,30 The Stand Comedy Club page 32 Disabled: at Montpelierat2yd.timeAud:of performance. 3yd flat.WC not adapted. (23.30)(£4.£5.00 Aug 7-24 22.30 (00.21.30 30) £5.00 00) (£4.00) Disabled: Details not available YMCA Bi7 Key to Disabled Information Venue I 77 6pm-10pm, 73 Ferry Road Box Office: (10.30am-12.30, l.30-5pm at 48 Pleasance) in yards from road ii) number of steps After last fashionable year’s highlyeating successful shows, HAS returnsyear,toenjoy this exciting 120 sealer venue close Ent Entrance i)ii) distance style of steps - Str=straight, Sp=spiral, HR=handrail tobefore/after Leith’s our shows. Easyhouses parkingandandbars.This good bus service. a relaxing coffee and snack Aud Auditorium i) distance in yards from entrance to steps ii) number of steps and style Children’s Shows • The Happy13.Prince Aug 11-16 00 (14.00)Edinburgh £3.50 (£2.Acting 50) School page 7 WC (toilet).W (Women’s). M (Men’s). Level ofWC locations is noted with • Tom Sawyer’s Hunt(£4.Edinburgh a WC at the relevant floor. Door width given if less than 26”. If possible, Aug I14-16 1-13 14.19.3000Treasure (17. 030)0) £6.00 50) Acting School page 7 phone the venue in advance if you need assistance. Aug (21. Music • Aug Groovy Generations Edinburgh Acting School page 42 The publication ‘Access in Lothian’ is available from Lothian Coalition of 1-13 22.00 19.00 (21. Disabled People on 0131 555 2151 or fromTraveline on 0131 225 3858. Aug I14-16 (23.115)5) £5.50 (£4.50) Theatre Artlink is an organisation in Edinburgh'which may be able to help with • See How They Run Edinburgh(£4.Acting School page 82 questions about access, Telephone: 0131 229 3555. Aug Matinee19-23Aug19.2300 14.(21.3030)(17.£6.00 00) £6.0050)(£4.50) • Aug Tongue-tied Edinburgh Acting School page 82 19-23 22.00 (23.10) £5.50 (£4.50) Disabled: Disabled access and toilet 145

Viewforth Centre Venue 117 Noon 104 Gilmore Ticketsperformances 229 7659 Box Office: to 10pm,Place plus during Dance/Physical • Wumpa ... an adventure full figure theatre company page 35 Aug 7,9,12,14,16,18,20,22,25,27,29 Aug 8,11,13,15,19,21,23,26,28,30 19.18.0000(19.(18.50)50) £6.00 (£4.00) Musicals/Opera • Aug The 19-23 Fantasticks 20.15 (22.The 15) Fantastical £5.00 (£4.0Theatre 0) Company page 61 Theatre • Aug HankyI 1-16Park20.15Hanky Park Productions (21.45),£4.50 (£3.00) page 88 • Aug Misbegotten 26-30 20.1Son 5 (21.5Caveat 0) £5.00Theatre (£3.00)Co. page lb • Aug Truckstop 1 1,13,Goddess 15,19,21,23,Spellbound 26,28,30 18.19.Productions 0000(19.(20.00)00)£6.00page(£4.10500) Aug 8,7,9,12,14,16,18,20,22,25,27,29 Disabled: Level route from street to auditorium - no steps.


A A.A. Milne’s Winnie the Pooh - Richard Medrington’s Puppets Abigail’s Party - Bablake at Diverse Attractions Absent Friends - Pounds, Dollars and Cents Absolute Blues and More - Absolute Blues And More The Accident - Brentwood Theater Company Accidental Death of an Anarchist - In Your Space Productions Accidental Death of an Anarchist - Stanley Theatre Group Acid Brass - Flux:The Edinburgh New Music Festival Acid Reign - Z Theatre Company Acoustic Mania - Antonio Forcione & Neil Stacey Acoustic Underground - Fringe Club Acrobat - Assembly Rooms The Act - Ed Byrne & Brendan Burns Adam Hills - Stand Up and Deliver - Gilded Balloon Adolf - The Laboratory Adult Child / Dead Child - Outhouse Productions The Adventures of Peter Rabbit - lanTurbitt’s Puppet Theatre After Penny - Gilded Balloon Aki Sato Solo Dance performance - Japan Experience Alibis for Life by Sean Hughes - Sean Hughes Alice and Mr Dodgson - Tall Stories Alistair McGowan Moving the Goalposts All Classical Music Explained:The Masterclass - Rainer Hersch All for Mairi’s Wedding - Diverse Attractions All In The Timing - California Faultzone Along Came a Spider - Max Fisher Amadinda at the Museum - Hungarian Overtures/ Merlin International Theatre Amadinda at the Spiegeltent - Hungarian Overtures/ Merlin International Theatre America’s Golden Age of Rock’n’Roll - A Cappella Style The Fabulous Fourmel’dyhides Amphion Anglicus - Songs of Mirth and Madness Harpsichords at St Cecilia’s Hall Anais Anagram - Demarco European Art Foundation Anam - The Famous Grouse House - Scottish International presents The Anatomist - The Desperado Theatre Company Andy and Edie - Fireraisers Theatre Company Andy Sheppard & Jazz Jamaica Flux:The Edinburgh New Music Festival Angels Memories - DAH Teatar -Demarco European Art Foundation The Angie Le Mar Show - Angie Le Mar Anglia Brass Academy - Festival of British Youth Orchestras Anna Weiss - Traverse Theatre Annie - Hard Knock Kafe Kids Annie - Stage 84 Antigone - Exacting Theatre Company Antigone - Teatr Ludowy - Krakow, Poland Antonio Forcione Trio - Antonio Forcione & Neil Stacey Anything for Laughs - The Fun Factory Aphra Behn & Nell Gwyn - 17th Century Career Girls Theater Ten Ten Apu - Dancing with the Inca Aqua - Craft From the Island of Funen Aqua - Craft from the Island of Funen Paolo Aragona Arborea Musica - Harpsichords at St Cecilia’s Hall Are You Talking To Me? - Good Idea Company Arj Barker’s Letter to America The Arnold Crombeck Story - Desirable Residence Theatre Art Exhibition and Sale of Paintings - Holyrood Art Club Arthrob Defining a Nation Artificial Limbs: A Do-It-Yourself Guide to Inner Happiness Plasticacid Theatre Company Artisan - Edinburgh Contemporary Craft Fair The Art of Cruelty - Bare And Ragged Theatre Art of Silence - Quaker Festival Committee The Art of the Dentist - Royal College Of Surgeons Of Edinburgh Art, Sex and Politics - German Cabaret Songs The Studio Theatre Company Asian Blue - Japan Experience Asleep Under The Dark Earth - Gordonstoun Youth Theatre As You Like It - Megalomania Atta Ullah Khan Essa Khailvi - Edinburgh Mela 146

9 II 100 38 74 90 105 47 113 38 49 34 17 23 91 96 7 87 36 24 106 26 23 80 76 86 51 51 42 50 79 43 80 85 47 79 26 45 109 62 63 83 106 38 86 106 38 114 38 50 23 11 80 116 64 97 115 73 118 118 57 66 88 94 65

Auden and Isherwood’s The Ascent of F6 Daedalus Theatre Company Aurelius,The Valiant Apprentice - National Youth Music Theatre Awarehaus Theatre - The Famous Grouse House - Scottish International presents Away Wi’ The Faeries - The Laboratory A-Z of Comedy? - Adam Crow and Mitch Benn A-Z ofTaboo - Poulter and Duff

78 62 85 91 10 30

B Babushka and The Bear - The Famous Grouse House - Scottish International presents Babybird - Flux:The Edinburgh New Music Festival Bachue Cafe - The New Tradition -Tron Ceilidh House Back 2 the 60s - The Scottish Theatre and Music School David Baddiel Bill Bailey Ballad of aTin Man -The Wey Valley Theatre Company The Ballad of Jimmy Costello - MPS - Guy Masterson Productions Banquet of Musick - Philomusica of Edinburgh Barbys, Bulls and HaggisrThe Comedy Feast Barnet Schools Symphony Orchestra Festival of British Youth Orchestras Baroque Concert - Philomusica of Edinburgh The Barra McNeils - The Famous Grouse House - Scottish International presents Barrie - The Realistic Theatre Company of Edinburgh Barry Sorts It Out - Barry Sorts it Out Battlefield Band in Concert BBC New Comedy Awards - BBC Radio 4 BBC Television Bea Love at Midnight The Bear - Cambridge Opera Group The Beatles Beat - Fringe Club The Beaux’ Stratagem - Strut & Fret Theatre Company Becket - Exacting Theatre Company BeckettLand - Action Theater Bedfordshire County Youth Second Orchestra Festival of British Youth Orchestras The Bedseller’sTale - C.C.T. Beginnings - from Voices of the South Voices Of The South & Theatre Whatsit Behind the Aquarium at the Last Pizza Show - Gilded Balloon Behind the Mask - Agape Theatre Co. Lenny Beige - One Man and His Talent Being and Bondage Indian Dance Society in Association with Romanska A Benefit For Waverley Care - An Aids Trust The Summer of Love Dance Party Mitch Benn - The Laboratory Beowulf - Gilded Balloon The Bespoke Overcoat - Oxford Out of the Blue Best of Scottish - Gilded Balloon Best of So You Think You’re Funny? - So You Think You’re Funny? Best Of The Fest Betty and Bobby’s Macbeth Queen Margaret College Drama Department Beyond Ecstasy - Venus Productions Pleasance Festival of Theatre ‘97 Beyond The Brink - Grin Reaper Bhangra at The Mela - Edinburgh Mela The Big Picture / An Dealbh Mor Big RivenThe Adventures of Huckleberry Finn American High School Theatre Festival The Big Spree - The Famous Grouse House Scottish International presents The Big Squeeze - Mel & Sue, Geraldine McNulty and Emma Kennedy Big Top Extravaganza! The Big Value Comedy Show... Early Screaming Blue Murder Comedy The Big Value Comedy Show... Late Screaming Blue Murder Comedy Big Vern V the Shootahs - Fringe Club Big Wednesday - Fringe Club Big Word Performance Poetry

7 47 58 31 11 11 112 95 54 11 45 54 44 63 73 40 12 12 12 61 49 105 83 68 45 76 111 87 69 13 36 57 25 87 97 21 32 13 101 99 23 65 119 61 43 27 13 31 31 49 49 73


Birth of a Man - The Edinburgh University Footlights 61 Bite Me - Angel Fish Theatre 70 Blood and Honour - Double Edge Drama 82 Blood, Sweat and Tears - Harland Hamstrings Theatre Company 89 Blood Wedding - De Montfort Theatre Company 80 Blood Wedding - Sternberg Theatre Actors Repertory Society 105 Blood Wedding - ‘Bodas de Sangre’ - Z Theatre Company I 13 The Bloody Chamber - Grid Iron Theatre Company 88 Adam Bloom 13 Blude Red - AFG (Cutting Edge Theatre Company) 68 Blue at the Throat - Aidan Dun - Pleasance Festival of Theatre‘97 100 Blue Heart-TraverseTheatre 109 Blue House - The Spiegeltent - sponsored by Beck’s Bier 57 Blue Remembered Hills - Only Human Theatre Co. Pleasance Festival of Theatre ‘97 98 B Minor Mass - St Mary’s Cathedral 56 Bob Downe - Jazzy! 17 Bodies Electric 34 Bolshoi Circus 74 Jane Bom-Bane 40 Boogalusa - Fringe Club 49 Born to be Wilde - Pounds, Dollars and Cents 100 Bosnia Future - Demarco European Art Foundation 34 Bottom Of The Bill In A One-Man Show (Free) Peter Buckley Hill 13 Bowhouse Project - The Famous Grouse House - Scottish International presents 85 Boy’s Life - Assembly Rooms 71 Paul Brady: Solo in Concert - Assembly Rooms 39 Jo Brand Benefit - Assembly Rooms 11 Brand X Presents Tiny Mo’s Big Time Cabaret - Tiny Mo’s 33 Brian Kay’s Sunday Morning - BBC Radio Scotland 40 Brief and Big Time Perfect - Desirable Residence Theatre 80 Brigadoon - Edinburgh Youth Music Theatre 61 Brighton Theatre Events present Kiss and Tell - Gilded Balloon 88 Brighton Theatre Events: The Blues Brother - Assembly Rooms 10 Marcus Brigstocke 13 Bringwonder’s Word Magic - Bringwonder the Storyteller from New Zealand 7 Bristol Old Vic Theatre School presents The Converse is also True - Gilded Balloon 88 The Britcom Benefit The Paramount Comedy Channel presents The Britcom Benefit 30 Brodie! - Brunstane North 61 The Broken Heart - The Unseam’d Shakeseare Company 110 Lorna Brooks - The Famous Grouse House - Scottish International presents 43 Peter Buckley Hill And Some Comedians - Free Again 13 Buddhist Meditation - Friends Of The Western Buddhist Order 65 Bugsy Malone - Edinburgh Workshop For The Expressive Arts 61 Bugsy Malone - Northwest Leicestershire Youth Theatre 62 Bully-Dozer - Diverse Attractions 81 Bunty the Bouncer - Neptune Theatre Liverpool 27 Burach - The Famous Grouse House - Scottish International presents 44 Burns For Breakfast - The Famous Grouse House - Scottish International presents 83 Butoh Dance by ImreThorman withYasumune Morishige (cello) Japan Experience 36 Bye Bye Blackbird - MPS - Guy Masterson Productions 95 Ed Byrne: Psychobabble 13 3 no 3> o

c Cabaret - Trip 26 Theatre Company The Cagebirds - The Ugly Duckling Theatre Company Caledonian Beer Festival - Caledonian Brewery A Calendar of Love - Diverse Attractions Caliban - Marcos de Azevedo & Eduardo Bonito (Brazil) Californian Poppy - The Famous Grouse House - Scottish International presents Calluna - The Clarsach (Scottish Harp) Society Calum Colvin: Pseudologica Fantastica - Portfolio Gallery Cameo - Philomusica of Edinburgh Camera Obscura A Canal Runs Through It - The Far Canals

63 110 40 81 75 83 41 118 54 114 19

Candides - Cirque Baroque Cantabile Celebrate Brahms St Andrew’s & St George’s At Festival Time La Cantatrice Chauve - LesVagues Francaises The Canterbury Tales - Bablake at Diverse Attractions The Canterbury Tales - Really Necessary Travelling Actors Cantus Angelicus! - St Andrew’s & St George’s At Festival Time Captured Shadows - National Library of Scotland Scott Capurro Kev Carmody - The Spiegeltent - sponsored by Beck’s Bier Stephen Carroll - Caledonian Folk At The Guildford The Cast - The Famous Grouse House - Scottish International presents Castle To Cowgate - Edinburgh Renaissance Band Cat ATheatre Company - Daylight Robbery - Gilded Balloon Catriona McKay (Clarsach) and Chris Stout (Fiddle) The Clarsach (Scottish Harp) Society Cat Scratch Fever - Fringe Club Caughtt Shortt - Slap Me Productions presents Kate Shortt Ceilidhs - The Famous Grouse House - Scottish International presents Ceilidhs in the Carpenter’s Arms - Nights In The Carpenter’s Arms Celle-La - Traverse Theatre Cello Alchemy - Karen Kaderavek - Cellist Cello & Piano - Philomusica of Edinburgh Cello & Piano - St Andrew’s & St George’s At Festival Time Ceramix - The Adam Pottery Ceremonial Kisses - Lusty Juventus C’est La Vie! - Theatre Transformations The Chairs - Assembly Rooms Chamber music concerts sung by young people Edinburgh Festival ofYouth Chamber Choirs Chanson d’Amour - St Andrew’s & St George’s At Festival Time Chantan - The New Tradition -Tron Ceilidh House Charles Wesley 1707 - Jasperian Theatre Company Chasing Deadlines - American High School Theatre Festival Chaucer in the Sky with Diamonds - Modernising Theatre Company The Cheese Shop Presents...BOOF! The Cheviot, the Stag and the Black, Black Oil Eclipse Theatre Company Chicks With Flicks - Jackie Clune The Chic Murray Story - Doug Healy as Chic Murray Chikuzan - Japan Experience Children of a Lesser God - American High School Theatre Festival The Chipolatas - The Famous Grouse House - Scottish International presents Chloe Poems in Universal Rentboy - Pantomime Prods Chopin and the Spirit of Poland St Andrew’s & St George’s At Festival Time Choral Concert - Edinburgh Royal Choral Union Choral Masterpieces of Five Centuries Ex Collegio Cantabrigiensi A Chorus of Disapproval - Stage 2 Christie in Love - Howard Brenton - Asylum Theatre Company Christmas in July - Yes & No Theatre Co Christ Stopped at Eboli -Valvona & Crolla Chrysalis-The Cathedral Concert Charlie Chuck Cinderella - Strut & Fret Theatre Company Circus Workshop - Magic Carpet Theatre Clara - The Laboratory Clarity of ColounTribal Rugs of Southern Iran Out of the Nomads Tent Classic FM Live at the Caledonian Classic FM Live at The Caledonian Classic FM Live at The Famous Grouse House Cleo - Theatre Workshop A Clockwork Orange - Gilded Balloon Close to You The Clothes off our Backs Club Graffiti - Cafe Graffiti Club Latino and ‘Sonora La Calle’ - Assembly Rooms Club Seals Cluicheadairean Dhun Eideann and Friends Edinburgh Gaelic Drama Group Cluub Zarathustra - Attention Scum

76 56 93 11 101 56 I 17 15 57 41 43 42 87 41 49 32 44 53 109 51 54 56 114 36 107 71 42 55 58 62 61 94 15 82 15 17 51 69 7 30 56 42 42 105 72 112 111 41 15 105 8 91 117 87 77 I 15 40 39 15 82 15 147


INDCX OF SHOW TITLCS C’mon Black - Gilded Balloon Coalition - St Andrew’s & St George’s At Festival Time The Coates Duo - St Andrew’s & St George’s At Festival Time Colin Baxter’s Edinburgh - Stockbridge Bookshop The Collected Works of Roger La Borde - Studio One Gallery Columcille - Stray Theatre Company Comedy Masterclass - BBC Radio 4 The Comedy Storm - Gilded Balloon The Comedy Zone Come On Everybody, Sing! - Angelic Voices Company - Cambridge University ADC A Company ofWayward Saints -American High School Theatre Festival Composers Ensemble (plus Special Guest Vocalist) Flux:The Edinburgh New Music Festival The Condos - Hey Get a Life! - Gilded Balloon The Converse Is Also True - Bristol Old Vic Theatre School Graduating Students Cornography - Kronis & Alger (USA) The Corridor - Traverse Theatre Count Arthur Strong’s Drama Masterclass - Larry Trafalgar Presents Courtyard Readings - Scottish Poetry Library Coward’s Choice - Bunbury & Co Cracked -Y Touring Theatre Company Crash Positions! - Cirque Diesal Creative Continuity - Architecture on the Fringe I I C.R. Fun - The Edinburgh Comedy Revue The Critic - Double Edge Drama Critical Condition - The New Light Bulb Theatre Company Cruising - Gallus Theatre Company - The Famous Grouse House - Scottish International presents The Cub - Traverse Theatre Cuba Libre at the Palladium - Cuba Libre Scottish Cuba Defence Campaign Benefit Curiouser ...and Curiouser - Hong Kong Youth Arts Festival Cut! Censorship and self-censorship in the media LM Magazine Cyrano - Foolery Czech It Out! - St Andrew’s & St George’s At Festival Time

87 55 56 119 119 105 II 20 16 38 61 70 47 21 75 36 109 25 103 61 113 34 114 17 82 95 83 109 41 7 66 86 56

D Daily Choral Evensong - St Mary’s Cathedral The Daily Telegraph Open Mic Award - Grand Final Dallas and Packer Go Large! - Dallas And Packer Dancing at Lughnasa - The New Buckenham Players Dancing Goddess - Paintings - Mieko Nishimura Dancing in Shadows - Sandy Walsh Dandelions - The Ashcombe School Theatre Group Danny and the Deep Blue Sea Oxygen House and Merlin Theatre Company Jeanne D’Arc - Proscenium Theatre Company Dave Johns - On The Edge Dave White and Donny O’Rourke - The Famous Grouse House - Scottish International presents David Hume violin, Nelda Hardie piano - Philomusica of Edinburgh David Pollock - Goldberg Variations - Harpsichords at St Cecilia’s Hall Dawntreaders - Fringe Club The Day of the 43 Sunsets - Small Planet Productions Dazzle - Dazzle Contemporary Jewellery Dead on the Ground - Hoipolloi - Pleasance Festival of Theatre‘97 Deaf Shepherd - The Famous Grouse House - Scottish International presents Dear Miester Mandela - Capab (South Africa) Death and the Maiden - Venue 123 De Morochas, Pelandrunas y Abacanadas - Gilded Balloon Denise Stoklos in Casa - Assembly Rooms Departed Soul - Taihen (Japan) The Designated Mourner - Traverse Theatre Designed by Architects - Inhouse Desires and Dreams - Theatre Workshop Desperate Lines - Imago Devadasi - Devayani 148

56 16 16 95 117 112 71 97 63 16 43 54 50 49 104 115 98 43 76 111 35 71 37 110 116 108 90 35

Dido and Aeneas - Operaworks Die on Stage, Loud American Bastard - Steven Alan Green A Dinner Engagement - Cambridge Opera Group The Dinner Party - Demarco European Art Foundation Diriamba!-Theatre Workshop Diriamba! Nicaraguan Carnival and Workshops Theatre Workshop Disco Pigs - Traverse Theatre Disintegration - Dze-Ya? Belarus State Theatre Demarco European Art Foundation The Dismissal - The Laboratory The Divine Comedy & Michael Nyman Flux:The Edinburgh New Music Festival The Diviners - American High School Theatre Festival DIY - the musical - K C Productions Ltd Doctor Faustus - Bare And Ragged Theatre Doctor Felix-Wierszalin Doctor Steiner’s Stranger than Ficton Show - Marcel Steiner Pleasance Festival of Theatre ‘97 The DOM Concerts - DOM Festival of Art, Music and Animation Donald Black and Malcolm Jones - The Famous Grouse House - Scottish International presents Donald Gillan Solo Cellist -Valvona & Crolla Don Giovanni - Opera Invention Don Juan Hits Middle Age! - Venue 123 Don’t Drink the Water - American High School Theatre Festival Dorothy of Oz - Burklyn Youth Ballet Dorset Youth Orchestra Chamber Ensembles Festival of British Youth Orchestras Dorset Youth Orchestra - Festival of British Youth Orchestras Dotty Quaver’s Last Symphony - On the Road Dracula - Bare And Ragged Theatre Dracula - Be Ba Theatre Drama, Poetry and Science - Demarco European Art Foundation Dripdry - Crazy Horse Theatre Company Dr. Johnson’s Dictionary - Cambridge ADC Pleasance Festival of Theatre‘97 Drop the Box - The Famous Grouse House - Scottish International presents The Drouth - Festival Spirit The DumbWaiter - Red Eye Productions Duncan Chisholm & Ivan Drever - The Famous Grouse House - Scottish International presents Dundee Schools Symphony Orchestra Festival of British Youth Orchestras Durham County Youth Chamber Orchestra Festival of British Youth Orchestras Durham Early Music Consort Festival of British Youth Orchestras Dusty Fruit - Rejects Revenge Pleasance Festival ofTheatre ‘97 Dybbuk - Wierszalin Dylan Moran - Gurgling for Money

62 23 61 79 108 108 110 79 91 47 70 62 73 112 97 42 43 58 62 III 10 34 45 45 8 73 73 64 78 99 44 47 101 44 45 46 45 98 112 27

E Earthquake Weather - Traverse Theatre East Coast Project - Flux:The Edinburgh New Music Festival Jenny Eclair Eclectic Guitar with Jonathan Prag - Alborada Productions Eclipse - The Laboratory Edinburgh Barock - St Andrew’s & St George’s At Festival Time Edinburgh Festival Book Fair Provincial Booksellers Fairs Association Edinburgh International Youth Orchestra Festival of British Youth Orchestras The Edinburgh Quartet - A Classical Choice Valvona & Crolla Edinburgh Schools Jazz Orchestra Festival of British Youth Orchestras Edinburgh Schools Wind Ensemble Festival of British Youth Orchestras Edinburgh University Chamber Orchestra Festival of British Youth Orchestras Edinburgh Youth Orchestra Ensemble - Valvona & Crolla Edith Simon Works - Edith Simon Gallery

109 47 17 38 91 55 118 46 58 46 46 46 58 115


INDCX OF SHOW TITUS E & E Murmur - Hundred Heads Egiku Hanayagi - Contemporary Japanese Dances Japan Experience Eleemosynary - Bristol Old Vic Theatre School Graduating Students Eleemosynary-Venue 13 Elephant Wake - Catalyst Theatre (Canada) Ella Fitzerald A Tribute - The Famous Grouse House I - Scottish International presents Elsa Edgar - Bob Kingdom Elsie And Norm’s Macbeth - Company Theatre Emotional Baggage - Cambridge Footlights The Emperor’s New Clothes - Blunderbus Theatre Company Enemy: Project Ibsen - Aurora/Western Connecticut State University Ensemble - St Andrew’s & St George’s At Festival Time The Epic of Gilgamesh - Bristol Travelling Theatre Eric Bogle in Concert - The Spiegeltent - sponsored by Beck’s Bier Ernst Giselbrecht: Architect - Architecture on the Fringe I Etoko Dance Company - Japan Experience The Evening Before the Millenium After - Oxygen Productions An Evening with Gary Lineker j Oxford Brookes Student Union Drama An Evening With Gary Lineker - West End Theatre Company An Evening with Jack Dee - Jack Dee Every Dog Has Its Day - The Tarantinos An Exciting & Colourful Exhibition of Contemporary Arts & Crafts - The Blackadder Gallery Exhibitions - Japan Experience The Expert at the Card Table - The Laboratory Eyes and Teeth - Active Performance Productions Eyes in the Big City - Eva Meier

89 36 75 I 11 76 43 91 77 13 7 72 56 75 57 114 36 97 96 112 16 58 I 14 119 25 68 53

F The Face of Denmark - Scottish National Portrait Gallery Faces of War - Z Theatre Company The Fall of the House of Usherettes - Forkbeard Fantasy Falstaff - Breakwith Productions The Fantasticks - The Fantastical Theatre Company Faust - FluxrThe Edinburgh New Music Festival Faust Flambe! - Venue 13 Fecund Theatre’s 27 - Theatre Workshop Feel Real - a play about frotting reality - Prominent Theatre Feiffer’s People - American High School Theatre Festival Female Parts - The Laboratory Ferdi the Ferret - Optimism Festival Ceilidh - The Clarsach (Scottish Harp) Society Festival Masses - Old St Paul’s Music ‘97 A Festival of Brass - David A Hall Whitburn Band Festival Spirit Festival...What Festival? - Diverse Attractions Fiddle, Harp and Voice - The Clarsach (Scottish Harp) Society Fiesta Latina - Fringe Club Fife Youth Jazz Orchestra - Festival of British Youth Orchestras Fife Youth Orchestra - Festival of British Youth Orchestras Fife Youth String Orchestra & Percussion Group Festival of British Youth Orchestras 50 Ways to Kill Your Lover - Venue 13 Find Me - Manchester Metropolitan Drama Society The Finest Acoustic Music Sessions The Famous Grouse House - Scottish International presents The Fire Poet - Philip Wells Fire Rope and Liberty - Bob Hellon & Catherine Side First Impressions - BBC Radio 4 Fisherman’s Moon and The Logos Collection - Diverse Attractions Fishtales - Rowan Tree Company Flamenco Puro - Azabache: Cuadro Flamenco de Diego Mora Flook! - The Famous Grouse House - Scottish International presents Flor de Obesessao - Pia Fraus Theatre Company Flute Dreams - Frei Zinger Flux Clubs - Flux:The Edinburgh New Music Festival The Folk Divas The Famous Grouse House - Scottish International presents Fool House - Trestle Theatre Company Forbidden Fruit - Nottingham Playhouse Roundabout TIE Forces of Peace - ARTTS International Pleasance Festival of Theatre‘97

118 113 86 74 61 47 111 108 101 69 92 8 41 53 42 47 119 41 49 46 46 46 111 93 44 112 74 12 80 103 40 44 37 58 47 43 110 95 100

>

‘ i

| j

Four Poets, Eleven Composers St Andrew’s & St George’s At Festival Time Francis Martineau - Philomusica of Edinburgh Frankie Boyle & Ruby Slippers in Scots Pished Gilded Balloon Frans Ruhl Presents Amsterdam Comedy Explosion Gilded Balloon Jason Freeman French Baroque Music - Harpsichords at St Cecilia’s Hall Fringe Annual General Meeting Fringe Club Cabaret Fringe Club Disco Fringe Poster Exhibition Fringe Sunday Fugue - Bats A Funny Thing Happened on the Way to the Forum Union Theatre Fun Song Factory ‘On Stage’ - Pleasance Festival of Theatre ‘97 Future Star’s Magic Dancing - Demarco European Art Foundation

56 54 21 20 19 50 66 19 49 I 19 66 73 63 8 34

G The Gadflys - Gilded Balloon 49 Gagging Britannia - The Laboratory 91 Gangster No. I - Black Light Theatre Company 74 The Garden - Teatr Snow (Theatre of Dreams) 106 Garland - Judy with love 90 “Gasp!” - Economical Truth Pleasance Festival of Theatre‘97 100 Genesis?..! Did It My Way - Smarx Arts Crew 63 Geno Washington - What’s in the pot? Pleasance Festival of Theatre ‘97 54 The Gents - Gilded Balloon 21 Gerard Kenny and Abracadabarets at the College - Abracadabarets 38 Get a Life - Hourglass Productions 89 Gilbert & Sullivan Go Wilde - Bunbury & Co 61 Kevin Gildea 19 Gillian McDonald - Highlands & Islands - The Aldridge Gallery 114 Glasgow Girl - Leith Gallery Productions 93 Glasgow Schools String Orchestra Festival of British Youth Orchestras 45 Glen Garry Glen Ross - The Laboratory 92 Glimpse (Sundays, Wednesdays, Fridays) - Afterthought 69 Glimpse (Tuesdays,Thursdays, Saturdays) - Afterthought 69 Glitter - St Andrew’s & St George’s At Festival Time 55 Glub Glub!-Yllana 33 Glynn Nicholas - Crossing the Line 29 Gods Boyfriend - Fringe Club 49 The Gogmagogs Gigagain - Traverse Theatre 109 The Golden Crescent Story - Persian Village 117 The Golden Pathway Annual - Second Thoughts 103 Goldsmiths’Youth Orchestra - Festival of British Youth Orchestras 46 Gone Fission - Venue 123 11 I Goodnight Desdemona (Good Morning Juliet) The Totally Portable Theatre Company 108 Dave Gorman - In the Pleasance with the Microphone 23 Grace - Jade Theatre Company - Pleasance Festival of Theatre‘97 98 Boothby Graffoe 23 Grand Graffiti - Cafe Graffiti 40 Grease the Night Club 49 Gregg Fleet’s Underwater World - Gilded Balloon 23 Grimms Fairy Tales - Leicestershire Youth Arts 7 Groovy Generations - Edinburgh Acting School 42 Guardian International Student Drama Award Pleasance Festival of Theatre‘97 97

149


H Haggis, Neeps and Burns - The Scottish Theatre and Music School Hair - Leicestershire Youth Arts Hancock’s Last Half Hour - Company Theatre The Handwriting, the Soup and the Hats - Annex Theatre - USA The Hanging Tree - Traverse Theatre Hanky Park - Hanky Park Productions Hans Up! - Nottinghamshire Education Theatre Company The Happy Gang Sing-a-long - Pleasance Festival of Theatre ‘97 The Happy Prince - Edinburgh Acting School The Happy Prince - Tall Stories Hard Positions - The Laboratory Steve Harley - Assembly Rooms Hattie Hayridge: Random Abstract Memory - Assembly Rooms Have You Seen My Pussy? - Mirador Productions Have You Seen This Girl? - National Youth Theatre Pleasance Festival of Theatre‘97 Having a Good Time - Diverse Attractions Haydn/Mozart - Philomusica of Edinburgh Heaven 17 - Flux:The Edinburgh New Music Festival Heavy Breathing - Crazy Horse Theatre Company Gareth Hedges - The Laboratory John Hegley - Traverse Theatre Hellcab - Traverse Theatre Hello,We’re the Nualas - Gilded Balloon Henry’s Cellar Bar Herbie Flowers with Marvyn Hanglider - My Mum’s aYoghurt Highly Recommended Here I Paint Myself, Frida Kahlo - Corazon Productions with Paradise by way of Kensal Green Heroin Lies - Newbury Youth Theatre Richard Herring’s Excavating Rita Hey Gringo - Stephen Frost Hiawatha - Leicestershire Youth Arts Highland Regional Youth Orchestra Festival of British Youth Orchestras The Hired Man - The RAT Pack His Majesty Commands - Arborea MusicaAnd Friends Hit The Road - On the Road Holding Hands with Angels - Theatre West Holyrood Slim and Guitar Junior - Caledonian Folk At The Guildford Homage to Segovia - Segovia Guitar Trio Hommage A Mary Wigman - Compagnie Yvette Bozsik The Honkin’ Hep Cats - The Spiegeltent - sponsored by Beck’s Bier The Honorable UrashimaTaro - California Faultzone The Hoodangas - The Spiegeltent - sponsored by Beck’s Bier Hopscotch-Venue 13 Horse plus Guest Players Hot Club Jazz - The Kimbara Brothers Hot Flushes - Diverse Attractions Hot Mikado - Edinburgh Youth Music Theatre The House of Bernarda Alba - Demarco European Art Foundation Hovis Presley: Wherever I Lay My Hat...That’s My Hat The Stand Comedy Club Hummingbirds - Cambridge ADC - Pleasance Festival of Theatre‘97 The Humpff Family - Fringe Club Hung Le - Now and Zen - Gilded Balloon Hypnotist Hugh Lennon & His Hypno-Dog - Firkin Fringe Hysteric Studs - Waxen Patience Theatre I Ian Carr (guitar) & Karen Tweed (piano-accordian) The Famous Grouse House - Scottish International presents Ian Shuttleworth: Critical Mass (‘Comic Genius’ - The Independent) Pleasance Festival of Theatre‘97 Ian Stone - Bit of Didley Squat I Beg Your Pardon? - Charlie Cheese I Can’t Remember Anything - Assembly Rooms I Dare You - Railtrack - Pleasance Festival of Theatre‘97 If I Am Medea? - Demarco European Art Foundation Image and Form - Edinburgh College Of Art The Imaginary Invalid - Theatre of Eternal Values 150

103 62 77 71 110 88 8 8 7 106 92 39 10 94 97 81 54 47 78 52 109 109 21 50 50 77 95 23 19 7 46 63 39 62 107 41 56 34 57 7 57 III 51 52 80 61 79 32 99 49 23 19 112

43 99 24 15 71 8 79 115 107

The Importance of Being Earnest Absolute Banana Theatre Company The Importance of Being Earnest - Short Back & Sides An Impromptu Afternoon with Schubert St Andrew’s & St George’s At Festival Time Improverts - Edinburgh University Theatre Company Incarnate - Cambridge University ADC In Love 2 with Janie Anderson and Gregg Fleet - Gilded Balloon Inner Sense Percussion Orchestra The Famous Grouse House - Scottish International presents Innocent Millions Dead or Dying - David Mitchell & Robert Webb Inside the Island - KCS Theatre Company Instant Sunshine - Anniversary International CD & Record Fair International Photography - The Edinburgh Photographic Society Into the Sky of Miles - Bruised but Conscious Productions Into the Woods - Plunge! Productions in transition - Double Edge Drama InYer Face - Demarco European Art Foundation In Your Dreams - Demarco European Art Foundation The Island - Theatre De Simplicite It Came From Planet Rimelle... - Fox Youth Theatre It’s Uncanny!-TheWeird Sisters The Itsy Bitsy Liz Webb Show - Liz Webb I Violan - Philomusica of Edinburgh

68 104 56 17 76 20 44 16 90 24 66 I IS 75 63 81 79 79 107 7 112 33 54

J Jammed by Joan Tewkesbury - Festival Theatre USC-USA 85 Bert Jansch The Famous Grouse House - Scottish International presents 44 Jaques and his Master - Eclipse 82 The Jazz Club 51 Jazz from Kulu Presents - Jazz Jam Session 51 Jealousy - Red Fish Theatre Company 101 Jeugdorkest Nederland - Festival of British Youth Orchestras 45 Jewellery VIII - Galerie Mirages 116 JFK OD’d-The Laboratory 91 Jill Peacock &Viv Gee in Burns Baby Burns - Gilded Balloon 20 Jimeoin 24 Jo Brand, Mark Lamarr, Jeff Green, Richard Morton & Andy Robinson 24 Joburg Streets - Assembly Rooms 39 Jocelyn Steele - Philomusica of Edinburgh 54 JockTamson’s Bairns The Famous Grouse House - Scottish International presents 44 Jo Enright: Not Tonight Josephine Enright 17 John Gillick: Gender is a Mandatory Field - The Stand Comedy Club 32 John Kitchen - The Three Couperins Harpsichords at St Cecilia’s Hall 50 The Johnny Vegas Show - Johnny Vegas 33 John’s Book of Alleged Dances - Mr McFall’s Chamber 53 John Shuttleworth’s Open House - BBC Radio 4 12 Journey - Demarco European Art Foundation 79 Judy Jacques’ Lighthouse - The Spiegeltent - sponsored by Beck’s Bier 57 Jump! - Crying in Public Places 78 Jump to Cow Heaven - Assembly Rooms 71 Just a Minute - BBC Radio 4 12 ‘Just a Tickle’ from Amnesty International 10 K Kaleidoscope - The Barely Ensemble Demarco European Art Foundation Kaleidoscope - BBC Radio 4 Kamikaze Freak Show - Gilded Balloon Kantaro - Philomusica of Edinburgh Kanzerstik - Double Ego - Pleasance Festival of Theatre ‘97 KC Productions presents Silly Cow - Gilded Balloon Keep in a Cool Place - Leitheatre Keep It Up! The Famous Grouse House - Scottish International presents Kelvin Ensemble - Festival of British Youth Orchestras Kenny Young & the Eggplants Kenny Young and The Eggplants: The Eggplant Evolution Tour

78 12 21 54 99 87 92 43 46 51


INDEX OF SHOW TITLES The Kerouac Triangle - City Light Productions Khamasseen - American University In Cairo Khublai Khan’s presents: James James - The Magic of... Khublai Khan’s Mongolian BBQ and Bar Killing Larry - Negative Equity Theatre Company The Killing of Sister George - Leicestershire Youth Arts A Kind Heart and a Big Donger - Pulse Kissing the Goldfish Kit and the Widow’s New Show - Kit And The Widow Kiwi Odyssey - Bringwonder the Storyteller from New Zealand Knives In Hens - Traverse Theatre Knocking on Kevin’s Door The Spiegeltent - sponsored by Beck’s Bier Kookie presents Anthem For Doomed Youth - Gilded Balloon Kosh Kabaret present Three Point Turn - Gilded Balloon Koyo Yamamoto in “Made in Japan” - Japan Experience Krapp’s Last Tape - Assembly Rooms

77 70 25 95 92 101 25 25 74 109 57 20 35 24 71

L Labi Siffre - A Day In The Knife - Gilded Balloon Labyrinth - Demarco European Art Foundation Ladies in Waiting / Silent Death American High School Theatre Festival The Ladychapel - Diverse Attractions Lajko and Lorinszky at the Spiegeltent Hungarian Overtures/ Merlin International Theatre Lajko Felix and Lorinszky Attila Hungarian Overtures/ Merlin International Theatre The Last Suit - The Blasted Heath Players The Last Vegas Lounge Act - The Ghost Road Company (USA) The Late, Late, Late Breakfast Show - Gilded Balloon Late ‘N’ Live - Gilded Balloon Latin! by Stephen Fry - Counterweight Productions Pleasance Festival of Theatre ‘97 Lawrence Leyton’s Mindf*** The League of Gentlemen Leandre, Mes Lunatic - Gilded Balloon Lee and Herring - This Morning With Richard, Not Judy II Stewart Lee - King Dong vs Moby Dick Leicestershire Arts Symphonic Wind Band & Youth Dance Festival of British Youth Orchestras Lemon Sisters - Demarco European Art Foundation Lend Me a Tenor - American High School Theatre Festival Lenny Henry - Poor White Trash and the Little Big Horns The Queen’s Hall Leona Munro soprano, Lucia Micallef piano Philomusica of Edinburgh Leonardo Was Right - Stephen Frost ‘Let it Be’ - The Musical - The Arthur Terry School Jackie Leven - The Famous Grouse House Scottish International presents The Lied Trio Plays Beethoven to the Beatles Lies, White Shirts and a Bottle of Bleach - ACTS Life and Death in Milton Keynes The Famous Grouse House - Scottish International presents A Life in the Theatre - Menagerie Theatre Company Life’s a Gatecrash - K.486 Life Stories - Z Theatre Company Life with Idiots - Venue 123 Light and Illusion - Edinburgh International Science Festival The Lightning Man - Young Pleasance Pleasance Festival ofTheatre ‘97 Like a Goddess - Bharata Natyam Dance - Devayani Lillian by William Luce - Festival Theatre USC-USA Lippy presents Nine lives,Ten Tales - Gilded Balloon A Little Fight Music - Pellew International The Little Mermaid - C Vivien Liu - St Andrew’s & St George’s At Festival Time Live Music at the Carpenter’s Arms Nights In The Carpenter’s Arms Lives Worth Living - Venue 13 Livingstone - Quest for the Source of the Nile Theatrum Botanicum - Theater of Plantes Sean Lock Logan Murray in Uncle Ron Explains It All - Gilded Balloon

49 34 70 81 51 51 74 87 20 20 99 92 25 21 25 26 46 79 69 54 54 86 61 44 52 68 83 94 91 113 III 7 97 35 85 88 30 7 55 53 III 108 26 21

Loki Ensemble - Crude! Tiranno Amor Arborea Musica And Friends Loki Ensemble ‘Masters of the Baroque’ - Valvona & Crolla Loki Ensemble - Singet Den Herren Harpsichords at St Cecilia’s Hall The Lollipop Foundation - Demarco European Art Foundation The Long Good Friday - The Corporation Pleasance Festival ofTheatre ‘97 Look Homeward, Angel - American High School Theatre Festival Loose Ends I - BBC Radio 4 Loose Ends II - BBC Radio 4 Lothians Schools Orchestra - Festival of British Youth Orchestras The Love of the Nightingale - The Player’s Company Lovers - Diverse Attractions Theatre Complex Lovers - Kassiopia Theatre Company Love’s Torments - Music by Handel and his Contemporaries Harpsichords at St Cecilia’s Hall Love Theatre Company presents Monsters - Gilded Balloon Low Level Panic - Kismet Theatre Company Loyko The Russian Gypsy Band - Assembly Rooms Lrg Lot GrtVu - The Ghost Road Company (USA) LucaVillani - Philomusica of Edinburgh LucaVillani Plays: Five Centuries of Guitar - Valvona & Crolla Lucy Carolan - J S Bach Partitas - Harpsichords at St Cecilia’s Hall L’Ultima Recital Lumberjacks on Ice: Comedy from the Colony The Stand Comedy Club Lush - White Rabbit Cowboys The LWT Comedy Writing Award Forum LWT Comedy Writing Award M Fred MacAulay - for one night only - Gilded Balloon McCalmans - The Famous Grouse House Scottish International presents The McCluskey Brothers - Fringe Club Dougie MacLean Tony McManus - The Famous Grouse House Scottish International presents Brian McNeill - The New Tradition -Tron Ceilidh House Donna McPhail Macbeth - Demarco European Art Foundation Macbeth Pruned and Henry V Pulped - Flying Pig Theatre Company Macbeth - Shakespeare’s text & Verdi’s music - Angelic Voices Macbeth Speaks - The Touring Company Machinal - Penn Theatre Ensemble Machine Gunners - Leicestershire Youth Arts Mad - Grassmarket Project (GMP) Madam & Her Orkestra - The Spiegeltent - sponsored by Beck’s Bier Made In Spain / Tony Grounds - The Laboratory Mad Forest - Nottingham University New Theatre Company Mad Pudding The Famous Grouse House - Scottish International presents Mae West: All Of Me - Home is where the art is Pleasance Festival ofTheatre‘97 Magdalena - Tagus Theatre Lisbon Magic Bob’s Cabaret for Kids - Gilded Balloon The Magic Show - Ian Kendall Mahler: Symphony No 7 - Scottish Sinfonia Mark Maier Main Ladki Solah Baras Ki (I’m The Girl of Sixteen) Edinburgh Mela James Malcolm - The New Tradition - Tron Ceilidh House Malopo African Dance & Poetry - Mamelodi Theatre Organisation The Mambo Club Mandela Village - The Arts Out Of Africa The Man In The English Lunatic Asylum Synaesthesia and Theatr lolo Goch The Man In The Welsh Lunatic Asylum Synaesthesia and Theatr lolo Goch Mannix Flynn in Talking to the Wall - Gilded Balloon Maria Cardona Dance (Spain) Maridos y Hujeres (Husbands & Wives) - La Folia Teatro (Spain) Marion Pashly Pulls it off - Gilded Balloon Mark Little: Psychobubble - Assembly Rooms

39 58 50 34 98 69 II 12 46 97 81 90 50 87 91 40 87 54 58 50 26 32 112 26 23 43 49 52 44 58 26 79 86 38 108 97 8 88 57 92 96 43 100 106 7 24 56 26 65 58 37 52 64 106 106 88 37 92 20 10 151


INDCX OF SHOW T1TLCS Mark Wilde and Alan Jacques St Andrew’s & St George’s At Festival Time 55 Michael Marra The Famous Grouse House - Scottish International presents 43 Marriage - Dze-Ya? Belarus State Theatre Demarco European Art Foundation 78 Marriage of Convenience - Venue 13 III Marvin Hanglider - The Power of Negative Advertising Highly Recommended 23 Marvin’s Room - Absolute Banana Theatre Company 68 Marvin’s Room - American High School Theatre Festival 10 Massive Deja-Vu - Gilded Balloon 21 Masters of the Concerto - Arborea Musica And Friends 39 Masters of the Keyboard - St Andrew’s & St George’s At Festival Time 56 Matilda Liar! - Those Theatre People 108 Matt King in La La Land - Gilded Balloon 20 Max Maven:Thinking in Person - Assembly Rooms 11 The MC of a Striptease Act Doesn’t Give Up - Gilded Balloon 88 The Mean Fiddler at Edinburgh Festivals 52 Measure for Measure - Diverse Attractions Theatre Complex 81 Measure for Measure - No Grey Suits 95 The Mechanicals - Z Theatre Company 113 Medea - Diverse Attractions Theatre Complex 81 Medea - Soup Kitchen Theatre 104 Meditation - Diverse Attractions 65 Meet Your Maker - Artisan in Action Edinburgh Contemporary Craft Fair 65 Memories from the Invisible - The Dylan Dog Theatre Company 82 Memory Man - Paul Clark - Pleasance Festival ofTheatre ‘97 98 Menage A Deux - St Andrew’s & St George’s At Festival Time 55 Men - the Final Frontier - Diverse Attractions 81 The Merchant of Venice - The Famous Grouse House Scottish International presents 83 Merlin in Scotland - The Merlin Society (Scotland) 117 Merlyn Trio - St Andrew’s & St George’s At Festival Time 55 Mervyn Stutter’s Pick of the Fringe 27 Michael Chekhov Acting Workshop - Cygnet Theatre 78 Michael Ladomery tenor, David Lyle piano Philomusica of Edinburgh 54 A Midsummer Night’s Dream - Arkle Theatre Company 71 A Midsummer Nights Dream - The Laboratory 36 Isobel Mieras - The Clarsach (Scottish Harp) Society 41 A Migration of Souls - Edinburgh Youth Theatre 83 Mika - Assembly Rooms 39 Mike Hatchard’s Piano Recital - Highly Recommended 50 Miles and Crane’s Men In Black - Dark Matter 78 Milton Jones: Joyrider 24 Minds Meetings - Bridge Design - Architecture on the Fringe I 64 Mi Salsa - Edinburgh Latin American Society - The Queen’s Hall 54 Misbegotten Son - Caveat Theatre Co. 76 Les Miserables - Red Shift Theatre Company 103 Miss Broadmoor - Landlady to Thespians - Laffa Jaffa Productions Pleasance Festival ofTheatre ‘97 99 Miss Itchy’s Bastard Breakfast Show - Gilded Balloon 20 Miss Julie - 20toTheatre 110 MISTER V.- Campaign to FreeVanunu Pleasance Festival ofTheatre‘97 99 Moliere’s L’Avare (The Miser) - Moliere for Lunch 94 Molloy - Gare St Lazare Players - Pleasance Festival ofTheatre ‘97 100 Moondance - Gilded Balloon 7 Moroccan Tapestry - Galerie Mirages 116 Bruce Morton 27 Mother Courage - GASP 86 Mothers Unleashed present Perineum Intact-A - Gilded Balloon 21 Mozart and Beethoven - Harpsichords at St Cecilia’s Hall 50 Mozart Requiem - Philomusica of Edinburgh 54 Mr Anderson’s Fine Tunes - BBC Radio Scotland 40 The Muckle Sangs - The Living Tradition The Famous Grouse House - Scottish International presents 44 Mud / Tent Meeting - Festival Theatre USC-USA 85 Multiple Division - Diverse Attractions 81 Murder House - Diverse Attractions Theatre Complex 81 Al Murray the Pub Landlord - King of Beers Al Murray The Pub Landlord - King of Beers 27 Museum - American High School Theatre Festival 69 A Musical Tour Around Europe - The Clarsach (Scottish Harp) Society 41 Music at St Michael and All Saints - St Michael & All Saints Church 56 Musiche Virtual! - Philomusica of Edinburgh 54 152

Music in my Mouth - A Perret and a Well Oiled Limb 30 My Friend the Chocolate Cake 53 My Sister in This House - The Laboratory 91 Mystery Juice The Famous Grouse House - Scottish International presents 43 N Nagwanti - Param Para Theatre - Edinburgh Mela 65 The Naked Guest - Animus - Pleasance Festival ofTheatre ‘97 100 Naked Wedding - Theatre Workshop 108 National Youth Choir of Scotland - Festival of British Youth Orchestras 45 The National Youth Orchestra of Scotland The National Youth Orchestra Of Scotland 53 Native Colors - American High School Theatre Festival 70 42nd Street - Edinburgh Workshop For The Expressive Arts 61 Neapolitan Songs (Canzoni E Racconti di Napoli) Valvona & Crolla 58 Ne’er the Twain - Edinburgh People’s Theatre 82 Neil Stewart & Dan Perry - World Music on 2 Guitars 58 The Net Files - Diverse Attractions 81 Never Mind the Rain Forests - Partially Total Theatre 97 The New Jim Rose Circus 29 The New Mexico Masque and Mummer’s Play American High School Theatre Festival 70 The News Quiz - BBC Radio 4 12 Newsrevue 29 The New York Broadway Duo - Rosemary George & Richard Shadroui 55 New York Jazz! 53 Nice Girls - Harland Hamstrings Theatre Company 62 Nicole Bunting - In the Thighs of the Beholder - Gilded Balloon 20 The Nigel Clark Quintet - Fringe Club 49 The Night of the Great Season - Akne Theatre Demarco European Art Foundation 79 Nightshift - Sheep Thrills Theatre Company Pleasance Festival ofTheatre‘97 100 The NightThoreau spent in Jail American High School Theatre Festival 70 The Nimmo Twins in Posh Spice Nude! - Gilded Balloon 21 Nobody Here But Us Chickens - National Student Theatre Company 95 Northern Broadsides: Anthony and Cleopatra - Assembly Rooms I I Northlands Festival The Famous Grouse House - Scottish International presents 44 North-South-East-West Musical Spectacular - Edinburgh Mela 65 Graham Norton 29 No Spring Chickens/A Wee Word - Diverse Attractions 81 Nostalgia - Demarco European Art Foundation 79 Notturno (Crepuscolo & Resurrezione) Demarco European Art Foundation 35 Now We Are Very Old: An Audience With A.A. Milne Richard Medrington’s Puppets 103 Nukanya Dreaming - NND Ngarindjeri - Narungga Dreaming 37 o Obediently Yours, Orson Welles - Festival Theatre USC-USA Oblivious - With Wings & Nemesis Theatre Companies Of Cakes, Men and Angels - Square Watermelon Productions Off the Fence Comedy Benefit - LM Magazine Of Mice And Men - Edinburgh Theatre Arts Old Books, Old Prints & Paintings of Scottish Castles The Old Town Bookshop Ole! Oleanna - Atlantic CTC Oleanna - Fork Tongue Theatre (Sheffield University Theatre Company) Oleanna - Optimism Oliver! - Forth Childrens Theatre Olympus On My Mind - Festival Theatre USC-USA Omid Djalili is Ethnic Once a Catholic - The Scottish Theatre and Music School I Man 4 Monologues - The Laboratory One Of The Boys - Straight Up Theatre Company I to I - Alex Milligan I 2 Look Out 4 Only Just - Leaveners Theatre Company On the Piste - Harland Hamstrings Theatre Company

85 112 105 26 83 I 17 29 72 86 96 61 85 29 103 92 105 119 30 92 89


Open House - California Faultzone 76 Opera Circus - Shameless! - Assembly Rooms 39 Opera Circus - King Stag - Assembly Rooms 39 The Opera Diva - Petticoat Opera 62 Opium Eater - Australian National Theatre Company 72 Organ Recitals - St Andrew’s & St George’s At Festival Time 55 Organ Recitals - St Mary’s Cathedral 56 Organ Spectacular - St Andrew’s & St George’s At Festival Time 56 The Original Edinburgh Literary Pub Tour 96 Othello - William Shakespeare - Asylum Theatre Company 72 Other People’s Footsteps - Diverse Attractions 80 O Tuneful Voice... - Harpsichords at St Cecilia’s Hall 50 John Otway - Gilded Balloon 49 Our Country’s Good - Northwest Leicestershire Youth Theatre 95 Out of Focus - Southern Light Drama 104 Out of Order - Eskmouth Theatre Company 17 Out ofTime - First Among Sequels 85 The Outsiders - American High School Theatre Festival 70 The Overcoat - Credo Theatre - Demarco European Art Foundation 79 Owen O’Neill - Off my Face 30 Oxford Concert Party - Europe’s only Baroque & Tango Orchestra 54 The Oxford Revue - Gilded Balloon 20 Oz - King of Clubs - Ozmosis Productions 62 P The Paddie Bell Festival Folk Show 54 Painter in Residence & Exhibition - Alan McPherson I 16 The Paradox of Insanity! I Mean Humanity!! Seventh Son Productions 103 Parallel Lines The Famous Grouse House - Scottish International presents 85 Parsons and Naylor - The Merry Onions of Dorking Parsons & Naylor 30 Pasi Kutvonen - Gallery MacColl 116 Rod Paterson - The New Tradition -Tron Ceilidh House 58 Paul Capsis returns in Cabaret - Gilded Balloon 49 Pay What You Can Premiere - Communicado Theatre Company 77 Pearlfishers - Fringe Club 49 Peatbog Faeries - A Folking Palaver at La Belle Angele 49 Peepolykus - I am a Coffee 30 A Perfect Ganesh - Festival Theatre USC-USA 85 Perrier Pick of the Fringe Award Shows - Perrier Pick Of The Fringe 30 Perth Youth Orchestra Chamber Ensembles Festival of British Youth Orchestras 46 Perth Youth Orchestra - Festival of British Youth Orchestras 46 Phantarch in Alba - Demarco European Art Foundation 35 Phillida Bannister contralto, Alpin Smart guitar Philomusica of Edinburgh 54 Phil Nichol is a Spy - Gilded Balloon 21 Piano Favourites - Philomusica of Edinburgh 54 Piano Recital - St Andrew’s & St George’s At Festival Time 56 Picasso: Selected Graphic Works Edinburgh Printmakers Workshop and Gallery 115 The Picture of Dorian Gray - Bare And Ragged Theatre 73 The Pigsty - Red Sox 103 Pinter Revue! - Smashing Theatre Company 104 Pips and Panda’s Magic Egg - Purves International Puppets 8 The Pit and the Pendulum - Shattered Windscreen Theatre Company 103 Place - Home! Time - Unknown - The Wey Valley Theatre Company 112 Playing Burton - MPS - Guy Masterson Productions 95 Playing the Game - Jacknife 90 PMT Theatre Co Presents I’m OK You’re OK - Gilded Balloon 87 Poole Harbour Bridge Design Competition Architecture on the Fringe I 114 Poolside Learning Cafe - Brainpool 64 The Porridge Men - Fringe Club 49 Porteous and Archer Experience - Porteous & Archer 30 Portrait Game - The Laboratory 36 The Portrait of a Lady: Sargent and Lady Agnew National Gallery of Scotland 117 Post - Arthrob 119 Postcards - Diverse Attractions 81 The Post Off Poems - Nick E Zinc Productions Pleasance Festival of Theatre‘97 100 Pots of Red Jam - Red Jam 103 Margarita Pracatan 54

The Prince of West End Avenue - Kerry Shale The Prince’s Trust - Action Greg Proops Prufrock: Live! - Empty Space Theatre Co Pleasance Festival of Theatre‘97 Psycho Zydeco PuccinkThe Dream of Puccini - Performance Exchange Puckerlips - Limb

103 54 30 98 54 97 93

Q The Quest - Hungarian Overtures/ Merlin International Theatre A Question of Attribution - The Broken Dream Theatre Company Quilters - American High School Theatre Festival

89 75 61

R Radio 5 Live at the Fringe - BBC Radio Scotland Raeburn - Scottish National Portrait Gallery at The RSA Rainbow Magic - Sylvia Troon’s Kenspeckle Puppets Raised on Songs & Stories - The Wey Valley Theatre Company Ralph Steadman - Etchings & Lithographs - Rogues’ Gallery Rambling Sam -The Dr Johnson Show-APIP Production The Rape of Lucrece - Looking Glass Productions The Rape of Lucretia - Young Opera Rapscallion Productions: Bring Me Sunshine - Assembly Rooms Rats in the Tunnel - Theatre Workshop Ray Davies:The Storyteller - Assembly Rooms Ready or Not - Lucid Productions Redemption Song - Agape Theatre Co. Red Zone - Derevo - Pleasance Festival of Theatre‘97 The Refreshing Room - The Spiegeltent - sponsored by Beck’s Bier The Regency Rooms with Lenny Beige Remember Bakelite? - Montresor Remember, Remember - Albatross Theatre Company John Renbourne The Famous Grouse House - Scottish International presents Report for an Academy - Mathis Schrader Reservoir Dogs - Festival Theatre USC-USA Re-Tune To Murder - Punchline Productions The Revenger’s Tragedy - Bare And Ragged Theatre Richard III - Oddbodies - Pleasance Festival of Theatre‘97 The Rich Fulcher Show - Rich Fulcher Rich Hall’s Louisiana Hayride - Gilded Balloon A Right Royal Variety Gala Evening - Gilded Balloon The Right Size: Do You Come Here Often? - Assembly Rooms The Right Wrong - Lawnmowers The Ripple Effect - Revelations - Pleasance Festival of Theatre‘97 Rita, Sue and Bob Too - The Stand Comedy Club The Rivei^Merchant’s Wife - Demarco European Art Foundation Road - QMW Theatre Company Road Rage - Gilded Balloon Robert Burns - Diverse Attractions A (Rock-n-Roll) Midsummer Night’s Dream American High School Theatre Festival Rodney Bewes:Three Men in a Boat - Assembly Rooms Roman Scandals - Nottinghamshire Education Theatre Company Romeo and Juliet - Cygnet Theatre Romeo and Juliet - Demarco European Art Foundation Romeo And Juliet - Leicestershire Youth Arts Romeo & Juliet - Schhh! Theatre Company Roomers / Stages - American High School Theatre Festival Rope - Absolute Banana Theatre Company Rory McLeod in Concert The Spiegeltent - sponsored by Beck’s Bier Royal Mile Historical Walks Edinburgh Festival Voluntary Guides Association RSAMD Junior Academy Orchestra Festival of British Youth Orchestras Ruby Fruit Jungle - The Spiegeltent - sponsored by Ber'c’s Bier Russian Anguish - Demarco European Art Foundation The Russian Gypsy Band - Loyko

12 118 9 112 118 71 93 63 71 108 39 93 61 98 67 31 117 69 44 94 85 30 73 99 19 20 23 10 92 100 105 79 101 87 81 61 71 95 78 79 92 103 70 68 57 65 46 57 79 52 153


INDCX OF SHOW TITLCS S St Andrew’s and St George’s Choir and Orchestra St Andrew’s & St George’s At Festival Time St Matthew - Petticoat Opera Jerry Sadowitz - Assembly Rooms Salsa Viva - The Famous Grouse House - Scottish International presents Sanctuary Gardens - Festival of Healing The Sandy Brechin Band The Famous Grouse House - Scottish International presents A‘Saunders Sandwich’ - Herrick Theatre Scalded Cats - Caledonian Folk At The Guildford Scared Weird Little Guys Scarlet Harlots - The Stand Comedy Club Schoolhouse Rock, Live! -Voices OfThe South & Theatre Whatsit Science Made Easy - The Laboratory A Scots Measure - The Clarsach (Scottish Harp) Society Scottish-American Ballet Scottish Borders Wind & Chamber Orchestras Festival of British Youth Orchestras Scottish Chamber Choir - St Mary’s Cathedral Scottish Eccentrics Festival Exhibition Judith Glue Interiors and Gallery Scraps - Re-Act Theatre Scuola Geovia - St Andrew’s & St George’s At Festival Time The Seagull - Eclipse The Seal Wife - Attic Theatre Company Secrets of the Theatre Explained Edinburgh International Science Festival See How They Run - Edinburgh Acting School Seelyhoo - The Famous Grouse House - Scottish International presents Seizer - Boilerhouse The Sensitive New Age Cow Persons The Spiegeltent - sponsored by Beck’s Bier Septet - Gandini Juggling Project Serious Money - American High School Theatre Festival The Servant of Two Masters - The Shoestring Players 70 Hill Lane - Improbable Theatre - Pleasance Festival of Theatre‘97 Sex and Death - National Student Theatre Company Sexual Perversity in Chicago - Absinthe Sganarelle’ - Diverse Attractions Sgathach - The Famous Grouse House - Scottish International presents Shadowboxing - Axis Shadow Boxing - Theatre Workshop Shakespeare for Breakfast - C Shakespeare’s Best Bits! - The Shakespeare Workshop Shakti in Tibetan Book of the Dead Shambhala Sharon Shannon - Assembly Rooms Shelagh Martin Expands Shelf-Life - Peppery Edge Productions She Stoops to Conquer - The Makars and DMDC Shiho Sound Japanesque Shirley Valentine - Diverse Attractions Shooglenifty - A Folking Palaver at La Belle Angele Shooting an Elephant - H H Productions Pleasance Festival of Theatre‘97 Shopping and F***ing - Out of Joint/ Royal Court Theatre Short Story - BBC Radio 4 Simon Lipson in Pieces - Gilded Balloon Junior Simpson Sir Bernard Chumley’s Grand Tour Frank Skinner Skrimshanker - Keyhole Theatre Company The Slab Boys - Dice Theatre Company Slap Slap Slap - Firkin Fringe Slavs! - Edinburgh University Theatre Company Sleep and Caliban’s Island - Diverse Attractions Theatre Complex A Slice of Saturday Night - Youth Connection Judy Small - The Spiegeltent - sponsored by Beck’s Bier Small Change - Venue 13 Smart Women, Stupid Choices The Famous Grouse House - Scottish International presents Smiley in Confessions of a Catholic Buddhist - Gilded Balloon Snog and Other Stories - Diverse Attractions Theatre Complex Sola - Fringe Club Soldier On A Monday - Gilded Balloon 154

55 62 11 43 67 44 89 40 31 32 63 25 41 37 46 56 I 16 101 56 82 72 7 82 43 74 57 35 70 104 97 95 68 80 44 72 108 75 67 37 56 39 27 97 93 56 80 49 100 96 II 20 31 31 32 90 80 19 83 81 63 57 III 85 23 81 49 87

Song Recital - St Andrew’s & St George’s At Festival Time Sostenuto - St Andrew’s & St George’s At Festival Time Sounds Sensational - Edinburgh International Science Festival Southampton University Chamber Choir Festival of British Youth Orchestras Southampton University Chamber Orchestra Festival of British Youth Orchestras So You think You’re Funny? The Spite Boys - The Laboratory Sports Revue presents - Don’t Cry for me Gareth Southgate Gilded Balloon Ssshhh...! - Hong Kong Youth Arts Festival Stacked - Backstage Theatre Company Stages - Think Twice Theatre Company The Stand - The Stand Comedy Club Stand Up Straight Stanza - BBC Radio 4 Star of German Comedy!!! - Earl Okin Star Wars Trilogy In Thirty Minutes - Festival Theatre USC-USA Stephen Frost’s Celebrity Pub Quiz Stephen Frost’s Impro All Stars Steve Martland Band - Flux:The Edinburgh New Music Festival Steven Berkoff in Massage - Assembly Rooms Still Game - Gilded Balloon Still Horny After All These Years - Earl Okin Shane St James Stone Me - It’s The Lad Himself - Company Theatre The Story of the Fallen Hero - Guandaline Sagliocco A Story with an Ending - Tomee Theatre Straker Sings Brel with 4 Fenders - Red Sox The Strange Case of Dr Jeckyll and Mr Hyde as told to Carl Jung - Venue 13 Strictly Scottish Striker! - Sutton Coldfield College Studio at the Fringe - Royal National Theatre Studio Stung - Momentary Fusion A Sublime Discord: Sand & Chopin Demarco European Art Foundation Sub-Post Office of Death - Spontaneous Combustion Suburbia by Eric Bogosian - Festival Theatre USC-USA Suffer the Children - Gresham’s Youth Theatre The Suicide - Traverse Theatre Sunday Lunch - Sleeve Productions Sunday Night Live! - Nights In The Carpenter’s Arms Sunday Services - St Mary’s Cathedral A Supercollider for the Family - Ben Moor Surely You’re Joking Mr Feynman - Adventures of a Curious Character -Valvona & Crolla Surfing - Assembly Rooms Surrealism and After:The Gabrielle Keiller Collection Scottish National Gallery of Modern Art Swan Lake - the ballet of clowns - Youth Theatre - Latvia Swan Song by Jonathan Harvey - Pleasance Festival of Theatre ‘97 Sykes & Nancy - Oddbodies - Pleasance Festival of Theatre ‘97 Sylvia by A.R. Gurney - Festival Theatre USC-USA Symposium on Love:The Devastating little breath of Eros Keti Productions Inc.

55 55 7 45 45 32 25 21 7 72 108 32 32 12 29 85 19 19 47 71 88 29 31 16 88 108 54 III 37 105 66 37 78 32 85 88 109 104 66 56 27 111 71 118 113 98 100 85 66

T June Tabor - The Famous Grouse House - Scottish International presents 44 Taika & Jemaine: Humourbeasts - Gilded Balloon 21 Take Me to Your Lieder - Philomusica of Edinburgh 54 Tales From aTraveller - Les EnfantsTerribles 93 The Talking Cure - The Cambridge Mummers 76 Talkin’Vagabond Jazz - Assembly Rooms 10 The Taming of the Shrew - Megalomania 94 Tandem - Caledonian Folk At The Guildford 40 Tango Palace - Sexteto Canyengue 56 Tannas - The Famous Grouse House - Scottish International presents 43 Tapestry - Fresh Blood Theatre 86 The Tarantinos 58 A Taste of D’Unbelievables - Gilded Balloon 20 A Taste of Honey - De Montfort Theatre Company 80 Tbilisi Ballet, Georgia - Assembly Rooms 34


INDCX OF SHOW TITUS The Tears of Friday Evening - Seduction Opera Pleasance Festival of Theatre‘97 98 Teechers - H.D.G. Productions 89 TeeCHeRS - Leicestershire Youth Arts 92 Teenage Fanclub - Flux:The Edinburgh New Music Festival 47 Temenos Vocal Quartet - St Andrew’s & St George’s At Festival Time 55 The Tempest - Illyria 90 The Tempest (a Storm in a Teacup) - Master Rosencrantz’s Little Eyases 94 Ten Days’ A-Maze, or the Prodigious Mysteries of the Saragossa Manuscript - The Cherub Company 76 10 Steps to starting a theatre company - ITC Pleasance Festival ofTheatre ‘97 66 lOYears of‘So You Think You’re Funny’ - So You Think You’re Funny? 32 Terrorist Tarts Undercover - S.A.S - A New Force in Comedy 31 Terry Pratchett’s Witches Abroad - The Wotjacallem Players 112 Terry Titter’s Full Length - Neptune Theatre Liverpool 29 Theatre Train - Venue 13 9 Theatrical Book Event - Showstoppers 119 Theatrical Company, Gumbo - Japan Experience 90 They Shoot Horses, Don’t They? National Youth Theatre of Great Britain 95 Think No Evil of Us...My Life With Kenneth Williams David Benson 73 Mark Thomas 32 Those Jammy Cows Aha! Sister City Sisters From Dunedin, New Zealand 10 Threads of Life - The Works Theatre Company 112 Three 32 Three Billigoats Gruff and Three Little Pigs - John Peel Puppets 7 The Three Canadians in Ben Hur - The Epic - Gilded Balloon 21 3 Men and 2 Dogs 33 Three-Piece Suite - Soup Kitchen Theatre 104 ThreeWeeks Fringe Showcase - Venue 123 III Thyestes - Conspiracy Theatre 77 The Tie - Tagus Theatre Lisbon 106 The Time Machine - Shrewsbury School 63 Time-Share - The Studio Theatre Company 105 Time to Stand and Stare - Edinburgh Zoo 115 Timon - Edinburgh University Theatre Company 83 Tina C in Rhinestone Cowgirl - Gilded Balloon 21 The Tinderbox - Purves International Puppets 8 Tindersticks - Flux:The Edinburgh New Music Festival 47 Tin Pan Ali - National Youth Music Theatre 62 To Be Remembered - The Underground Theatre Company Ltd. 110 To Each His Own - Dead and gone to Granny’s Broken Heart Theatre Company 75 Tom and the Magical Flower - Venue 13 9 Tommy Tiernan & Jason Byrne 33 Tomorrow is a lovely day - Only Human Theatre Co Pleasance Festival ofTheatre ‘97 98 Tom Sawyer’s Treasure Hunt - Edinburgh Acting School 7 Tongue-tied - Edinburgh Acting School 82 The Topp Twins 33 Torch! - Melody Cooper 16 The Town That Went Mad - Volcano Theatre 112 The Traditional Music of Bengal Choudhury & Co-The Bangladesh Festival Of Food And Culture 64 Trafford Tanzi - Crumpet Theatre Company 78 The Tragedy of Man Hungarian Overtures/ Merlin International Theatre 89 The Trial - K.486 91 A Tribute to Maxine Daniels - Highly Recommended 50 Trilogy of Sorrow - Tamar Theatre Company, West Leigh 106 Tripterranus - Comedy Cafe Roadshow 15 A Trip To The Farm - Aurora/Western Connecticut State University 7 TheTron Ceilidh House Traditional Folk Music Sessions Tron Ceilidh House 58 Truckstop Goddess - Spellbound Productions 105 Trust Byron - George Costigan 77 Tumbleweeds - American High School Theatre Festival 61 21 yrs @ 6.am - Ablaze Theatre Company 68 Two - Bold As Brass Entertainment 74 Two - The Laboratory 91 Two - Jim Cartwright - Asylum Theatre Company 72 Two Pairs of Shorts - QMW Theatre Company 101 Two Rooms - Blue Ridge Theatre Festival Demarco European Art Foundation 78 Tympanal! - Fringe Club 49

u The Umbilical Brothers are back with ‘Don’t Explain’ Gilded Balloon Uncle Bob-The Marsh Understanding Magazine Poetry and Play Reading Diverse Attractions Under The (Pink) Fringe - Gay Men’s Health Undine - A Bit Of Rough Theatre Company Unidentified Human Remains and The True Nature of Love Gilded Balloon Unreal Estate - Theatre Workshop Unreliable Romances (Mondays: Free Show) - Afterthought Untune Me That Tune - St Andrew’s & St George’s At Festival Time Up ‘n’ Under - Harland Hamstrings Theatre Company Up The Duff - Aha! Sister City Sisters From Dunedin, New Zealand Urban Minefields - Oscar McLennan Pleasance Festival ofTheatre ‘97 Midge Ure - Flux:The Edinburgh New Music Festival Urusei Yatsura & Mogwai & Delgados Flux:The Edinburgh New Music Festival The Usual Suspects Live - BBC Radio Scotland

23 93 81 I 19 68 87 108 69 55 89 69 99 47 47 12

V Vagabond John The Famous Grouse House - Scottish International presents Valery Ponomarev Quintet - Tron Ceilidh House Valium - Optimism The Vandegrifter - Valvona & Crolla Un Vento Impetuoso - La Canapia The Venue Vice and Verse:The Poetry of Murray Lachlan Young Assembly Rooms La Vie Simple - Diakonos Physical Theatre A View from the Bridge - In Medias Res Theatre Company A View from the Kirk - St Andrew’s & St George’s At Festival Time Vinegar Tom - QMW Theatre Company Vinyl Anorak - Graham Duff Visible Sound - Jeff Lorber &Tom Reyer Demarco European Art Foundation Vivaldi - The Four Seasons - Philomusica of Edinburgh Vivien:The Other Side of Gone With The Wind Festival Theatre USC-USA Vladimir McTavish in 101 Great Moments in Scottish Sport Gilded Balloon

85 58 96 111 25 58 10 35 90 55 101 17 119 54 85 20

w Wake Up Dead - HankWangford Walking - 2nd Nature Walking on the Roof - Diverse Attractions Wallingford Parish Church Choir The Wannadies plus support Flux:The Edinburgh New Music Festival Wardrobe Man - Loaded Theatre Company War! - What is it Good For? - Zendo Martial Art Show Warwickshire Youth Chamber Orchestra Festival of British Youth Orchestras War with Wind - Waves Dance Company - Edinburgh Mela Wasp by Steve Martin - Third Stage Productions Waykis - Caledonian Folk At The Guildford We Are Here... Are You There? - 104 Theatre Company Weepie - Limb Weetzie Bat - Gilded Balloon The Weight of Smoke - Firefly Productions The Well Oiled Sisters - The Spiegeltent - sponsored by Beck’s Bier WemyssWare and its History Wendy and the Lost Boys - The Clarsach (Scottish Harp) Society We’re All Sweet Here - Diverse Attractions West End Craft and Design Fair Whale Music - Exacting Theatre Company Whale Music - Stray Dogs Theatre Company Mike Whellans - Caledonian Folk At The Guildford

58 103 80 58 47 93 37 45 65 108 40 96 93 87 85 57 119 41 80 119 83 105 41 155


Whistlebinkies 58 Whistlebinkies Unplugged Cellar Club 58 Who is Reginald Lummy - Oxford Brookes Student Union Drama 96 Whoops Vicar is that your Dick - Newsrevue 29 Whose Solo is it Anyway? The Famous Grouse House - Scottish International presents 43 Who’s Laughing Now? - Double Edge Drama 82 Why The Whales Came - Leicestershire Youth Arts 7 Mr Wilde & The Virgin - The Broken Dream Theatre Company 75 Will Gaines - Jazz Hoofer 37 William Revels (baritone) David Arditti (piano) Philomusica of Edinburgh 54 Will Lorimer:Adam + Lilith - ‘Before The Fall’ - Jenners 116 Will You Remember? - Better Out Than In Theatre Company 73 Wind In The Willows - Leicestershire Youth Arts 7 Wired - The Laboratory 36 With Great Pleasure - BBC Radio 4 12 The Wizard of Castle Magic - Magic Carpet Theatre 8 The Wizard of Oz - The Scottish Theatre and Music School 63 Women and Wallace by Jonathan Marc Sherman Festival Theatre USC-USA 85 Women of a Certain Age - Theatre Works 32 Women Spread the Word - Diverse Attractions 81 Richard Wood The Famous Grouse House - Scottish International presents 44 Word Play - Sol Survivor 104 Working / Playing - American High School Theatre Festival 61 Wounded Women - Hungarian Overtures/ Merlin International Theatre 89

The Wrestling School: Wounds to the Face - Assembly Rooms Wrestling With Demons - Venue 13 The Wrigley Sisters The Famous Grouse House - Scottish International presents Wumpa ... an adventure - full figure theatre company

71 III 43 35

Y The Yankee Doodle Dandies - Venue 13 Yeats in Performance - Diverse Attractions Theatre Complex You Are My Mother - Backchat Theatre Co Pleasance Festival ofTheatre ‘97 Young, Gifted and Green - Young, Gifted & Green Young Pleasance goes STORE CRAZY Pleasance Festival ofTheatre ‘97 You Only Miss the Water When the Well Runs Dry Demarco European Art Foundation

III 81 99 33 99 34

z Zadok the Priest - Old St Paul’s Music ‘97 Paul Zenon Zero - Frantic Assembly - Pleasance Festival ofTheatre ‘97 Zoot Money, Woodstock Taylor and a Strawb

53 33 98 58

FOR ALL YOUR BROADCAST AND AUDIO VISUAL EQUIPMENT HIRE Call Oscar Askin on ’ 0131 554 9421 For an EFFICIENT LOCAL service PROJECT MANAGEMENT & TECHNICAL SUPPORT

n m

156

32, JANE STREET, LEITH EDINBURGH EH65HD FAX: 0131 554 9422 Part of The Metro Group


o B

XJT) £

° o'.2? 3 &> I •£ -g •CtuC 00oX 00Ho T3 UJ

cuCT) S

o' Ij^ UJX

cs ^w ^ QJ O& U Q, ^&*5 2W2ElQJ=

Oi Oi

u> u

1

,

(2

Q. S

75 « £ e ^


*997 Fringe Tickets Becking Form - continued


Edinburgh

Festival

Beck's and the Edinburgh Festiual go together like Corky and the Juice Pigs. This year, not only does Beck's prouide you uiith the map to plan your route from oenue to uenue, uie mill also supply the method of transport. Look out for the Beck's Picksham Carts 'running' throughout the city centre. There hasn't been a more stylish may to arrioe at Ulauerley since the Flying Scotsman.

SGTIOUS DIGT


MAP INDEX All venue have a grid reference which refers to the map opposite. Venues beyond the range of the map have a grid reference followed by the word Outer. The distance given alongside indicates the distance from the Fringe Office. 1 Fringe Office, 180 High Street JI2 23 Assembly Fringe Club.Rooms, Teviot54Row,George BristoStreet. Sq. LI11 II 78 Jaffa Cake, 28 King Stables Road K10 Reid Concert Hall, Bristo SquareSquare, High St. KI2 LI I 9 Iron Ceilidh House, 9 Hunter 1011 Diverse HolyroodAttractions, Park,foot Riddles of RoyalCourt, Mile. off LawnmarketKI6 J11 1314 Comedy Harry Younger Hall, Lochend Close,St,byCanongate J15I Cafe Roadshow, Charles Fringe Club LI 15 Traverse Theatre, Cambridge St, off Lothian Rd J9 1617 StSouthside Courtyard, Davie St Place LI 3 Peter’s Church Hall,Centre, Lutton55a PI3 1819 C,Edinburgh Buddhist Grange Rd PI Over-Seas House, 100 Princes Street. 110I 2021 Theatre Workshop, HamiltonTerrace. Place. Roman Eagl e Lodge,342 Johnston KI0F9 22 Demarco EuropeanYorkArtLane/Albany Foundation,St Mary’s School, 2324 StChaplaincy Centre,College, I BristoDrama Sq, near Fringe Club H13 LI 2 Queen Margaret Dept, Clerwood Terr. HI Outer (4 miles) 25 Drummond Community Drummond Community HighBroughton School,Theatre, Bellevue Place FI3 2627 The Palladium, Place GI4 Lauriston Hall, Lauriston Place K9 2829 Apex, Greyfriars House, Candlemaker Row KlK10I 31 -35KirkGrassmarket 3031 The NetherbowTheatre,43 High Street. JI3 St Cecilia’s Hall, Street & Cowgate. K13 32 Continental ShiftscnratoffNiddry Springwell Ardmillan Terrace, Gorgie Rd.House, L3 3334 The Pleasance,60The Pleasance. LI4 Famous Grouse House, 5 Chambers St KI2 36 Gilded Balloon IClose , People’s Palace, Old Fishmarket K12 3738 The George Theatre, George GildedSquareBalloon Theatre, 233 Square. Cowgate. M12 KI2 4041 The QuakerTheatre, Meeting19House, 7 Victoria Terrace. H10 J11 l Street Hil Street. 4243 HiPortfolio Gallery,43 Candlemaker RowStreet. KI2 KM Royal Museum of Scotland, Chambers 4445 Scottish Portrait Queen Street H12 Old St. PaulNational ’s Church & HalGallery, l, JeffreyI Street. J13 4647 The PI4112 The Salisbury Cafe Royal,Centre, 17 West2 Salisbury Register Road Street 4849 Bonnington Resource Centre,Place 200 Bennington Rd C16 Bedlam Theatre, I lb Bristo LI I 51 Diverse Attractions Complex, 112 West Bow, Grassmarket K11 5253 Festival ECF KingsClub,Hall,South Clerk Street NI3 9-15 ChambersStreetStreet KI2 54 The Cellar Bar,Chambers KI2 55 Randolph Studio, Inst. Francais d’Ecosse, 13 Randolph Cres. H8 56 Scottish Poetry Library,Tweeddale Court, 14 High Street. K13 5758 BBC Scotland, StudioSchool, One, 5Canongate Queen Street. HIJ15I Mile Playhouse, Primary 59 Royal Edinburgh 18-22 Greenside PI. HI4 6061 The Canongate J15 HauntedChurch, Vaults,Canongate, meet outsideRoyalTheMiCityle Chambers, High Street J12 6263 Continental Shifts at St Bride’s, 10 Orwell Terr National Gallery of Scotland,The Mound J11K5

64 Royal Scottish Academy,The Mound 111 65 StCowgate. Ann’s Community Centre, South Gray’s Close, KI3 6667 Valvona Scottish &National Gallery ofRow,Modern 19 ElmChurch, topMuirdaleTerr. ofArt,LeithBelford Walk.Rd G15H5 68 Blackball StCrolla, Columba’s Queensferry Road, Blackball. CI Outer 69 Broughton High School, I Carrington Road.(2.75 miles)E7 7172 Queen’s St Ninians,HalComely l, Clerk Bank Street.Road N13E6 7375 The Edinburgh College of Art, Lauriston Place. KI0L8 MamboCentre, Club,West Tollcross. 7778 The Square Nicolson Sq Methodist Church. LI 2 Edinburgh Zoo,69 Corstorphine Rd HI Outer (3 miles) 7980 The Cowgate Berties,Subway, 7 Merchant Street, off Candlemaker Row KI2 KI I 8182 Southside, GarageTheatre.Grindlay Court Centre, Southside Community Centre,Grindlay St K9 Nicolson 83 St117Serf’s ChurchSt. Hall, Clark Road, Goldenacre MI2 A12 Footlights andFirkin, Firkin,587 Spittal Street K9 868587 The Physician and Dalkeith Road Famous Spiegeltent,Top ofWaverley Centre, PI4 Princes St J12 8889 StRoxburghe Stephen’sHotel, Centre,38 Foot of HoweSquare. Street FI019 Charlotte 9091 StGraffiti, Corner Broughton & EastPlace London Streets G13J7 Mary’s Cathedral, Palmerston 92 Dr Watt’s Library, 3 Robertson’s Close, Cowgate KI3 9394 James Gillespie’s School, Lauderdale Columcille Centre,High2 Newbattle Terrace St. N8 to Dominion Cinema) 9596 The St(nextMichael and Al l Saints Church, Brougham St P5P6L9 Aldridge Gallery, 124 Morningside Road 97 Overtures at the Edinburgh Playhouse, Greenside PI H14 9899 Tiny Marcos,Mo’s55Speakeasy,60The Grove Street. Pleasance LI4K7L8 100 Central Hall, West Tollcross. 101102 Scotch La BelleMalt Angele, 11 Hasties Close,Vaults, off Guthrie St KI2 Whisky Society,The 87 Giles St. Leith. BI9 103 Street Gallery 104 MandelaVillage, Murrayfield ParishScotsman Church Market Hall, Ormidale Terr JI2 HIStreet Outer (2 miles) 105 Old Town 27-31 Bookshop, VictoriaGrassmarket KlK10I 106 The W J Christie’s, West8Port, 107 Guildford Arms, I West Register St. (off East EndCastle, PrincesCraigmillar St) 112 109 Outer (3Stmiles) 111 StCraigmillar Andrew’s & St George’s Church,PI413 George HI I 112 The RossLibrary Theatre,ofPrinces Gardens 115 National Scotland,83Street George IV Bridge KlJ10I I 16 Waterstone’s Booksellers, George 117 Viewforth Centre, 104 Gilmore Place Street HI0M6 118 GPO end Building, Bridge KI0113 119 Arthrob.The Granny’s Green,OldCastle of theNorth Grassmarket 120 Inverleith Church HallManagement , Ferry Rd (oppSchool, Granton Rd) SqLA912 121122 StEdinburgh University 7 Bristo Cuthbert’s Parish Church, 5 Lothian Road 123 SouthSheraton Bridge Resource StreetRd KI3J9J8 124 The Grand Hotel,Centre, FestivInfirmary al Sq, Lothian 125 St Mark’s Unitarian Church, Castle Terrace 126 CSt cubed, St John’sWest Hall, West End Princes Street J91919 127 John’s Church, End, Princes Street 128 Youth International at St Oswald’s, Montpelier Park, Bruntsfield N6 129 Studio One Gallery, 130 Photographic Exhibition10 Stafford Centre,Street, 68 Great King St G1118 131132 Greyfriars Kirk,Commission Greyfriars PI,forCandlemaker KM Royal Fine Art Scotland, Row. KI5 Bakehouse Close, 146 Canongate 133 Rogues’Gallery, 58 St Stephen Street FI0

134 Montresor, 35 St Stephen Street Row. 135 The AdamCollege, Pottery, 76 Henderson EI0B5F9 136 Telford Crewe Tol l 137 Church Hil Theatre, Morningside Road 06 139 The Honeycomb, Blair Street KI2 140 Stockbridge Parish36Church, 7BSt.Saxe CoburgLane.St N14 EI0 142 Out of the Nomad’s Tent, 21 Leonard’s 143 out of the blue,The Bongo Club, 14 New StPrintmakers (off Royal MiWorkshop le) & Gallery, JI4 144 Edinburgh 23 Union St. GI4 145 10a Union(TopStreet 146 Gay RoyalMen’s CollegeHealth, of Surgeons, Floor) 9 Hil Sq GI4 L13 147 LeithRaeburn Links Place. D20E8 149 Cirque Galerie Baroque, Mirages, 46a 150 The City Cafe, 19 Blair Street. K12 151152 Augustine MeadowbankUnited CentreChurch, and Stadium, George IVLondon BridgeRd KlJ19I 153 Gallery MacColl, 117Street Comiston Rd P6 Outer (2 miles)112 154 Jenners, 48 Princes 155 R.I.A.S. Gallery,Bookshop, 15 Rutland Square.West Circus PI G9J8 156 Stockbridge 157 The Candlish Hall, First 26Floor,NorthSt George’s West, Shandwick PI 18 158 The Venue, 15 Calton Road JI4 160 Camera Obscura, Castle Hi l , Royal Mi l e . JI0 162 Henry’s Cellar Bar, 8-16 Morrison Street K8 163 Danish Cultural Institute, 3 Doune Tee 164 Wango’s Big Top,The Meadows MMG9 165 Cannonball House, Castle Hil , Royal Mile JI0 166 Bruntsfield Primary, Montpelier N6 167 John’s StRd K14 168 Moray Moray House House Theatre, Student’sCanongate/St Union, 37 Holyrood KI4 169 The Blackadder5/6Gallery, 5 Bridge Raeburn Place F9 170 171 Whistlebinkies, Griselda Hil WemyssSouth Pottery, 89 West Bow, K13 Victoria St KM 172 The Matthew Architecture Gallery, 20 Chambers St KI2 174 Inhouse,28 Howe 175 Judith Glue, 60 HighStreet Street on the Royal Mile GI0 K13J9 176 Usher Hal l , Lothian Road 177 YMCA, 73 Ferry Road BI7 178 Outside Beehive65 Inn, KI0 179 The LeithLeiththeGallery, TheGrassmarket Shore B19 180 South Parish Church Halls,Henderson St CIS 183 Caledonian Brewery, Slateford Road St, Leith B19M2 184 Raj Restaurant on the42Shore, Henderson 185 The Magdalen Chapel,41 Cowgate KM 186 43Khublai Khan’s Mongolian Restaurant, Assembly Street, Leith C20 187 StSeventh Giles Cathedral, High Street, 3Royal Mile J12 188 Day Adventist L12 189 The Meadows Big Top,TChurch, he Meadows,BristoMelvPlace il e Dr NI2 190 Persian Village, 98 Morningside Road P6 191 Brunton Theatre, High St, Musselburgh K22 Outer (5 miles) 192 Scottish International the Quad, University OldGarden, College,atInverleith South Bridge 193 Royal Botanic Row DlKI2I 194 Kirk o’ Field Church Hall, 138 Pleasance (entrance on Brown Street) 9 Queen Street M13 195 Royal College ofConference Physicians, HIK8I 196 Edinburgh Int i Centre, Morrison St D18 197 Leith Community Education Centre, Newkirkgate 198 Ugston MilHaddington Barn.Ugston Mil , K22 Outer (15 miles) Spittalrigg, 199 Edinburgh Festival Theatre, 13-29 Nicolson St LIJ82 AB Tattoo FilmhouseOffice/Jazz Tickets J12 CD Festival Office JI2G5 Book Festival i Tourist Information 112

DON’T HANG AROUND ...TAKE THE BUS! SPECIAL FESTIVAL RATE £1 0 all week for all LRT buses (excluding Night Buses) £4.50 airline coach service Available from the Fringe Box Office in the High Street (in person and by post) 160


! I I A Mad God's Dream The Story of Literary Edinburgh An exhibition celebrating Edinburgh's great literary tradition and pivotal role in Scottish writing. 9 August - 4 October for the,

At the City Art Centre for the 1997 Festival, a veritable Olympics of the Arts is being held. Participate in a truly international celebration of excellence and achievement. Faster, Higher, Stronger An Exhibition about the Olympic Dream The story of the Olympic Games, from Ancient Greece to Atlanta. A unique collaboration with the Olympic Museum, Lausanne, Switzerland. Exhibition concept by LEEL. 9 August - 4 October

For the Olympic Games of the Arts, the special price of £3(£2) gives entry to all the exhibitions.

r

City Art Centre *

City Art Centre 2 Market Street, Edinburgh EH 1 1DE Tel: 0131 529 3993 Open Monday to Saturday 10am - 5pm Sunday 12-5pm http://www.cac.org.uk

A Life of Lorca Drawings, photographs, books and manuscripts The first showing in Britain of drawings by this immensely talented Spanish poet, dramatist, musician and artist, tragically killed during the Spanish Civil War. 9 August - 28 September

Pissarro in Venezuela Little known drawings and watercolours from the young Pissarro's visit to Venezuela in 1852-4, critical to the development of the great Impressionist. 13 August - 4 October . eDINBVRGH •

OLYMPIC MUSEUM LAUSANNE


A

B

Edinburgh Fringe Venues & Street Plan This is a schematic representation of central Edinburgh. Each number shows the location of the venue in question. Venues shown in a white circle are outwith the area of this map but the listings give approximate distances to these outer venues. Tourist Information on Princes Street (I 12) can supply detailed street maps of the city.

THE RRTH OF FORTH PORTOBELLO

C

m® ®JL

ROYAL BOTAN GARDEh^S * C f LElTH

D

.

INVERl PAR E Wl

m.

^ -A K STATION

F

TOURIST INFORMATION CATHEDRAL

G

FILM FESTIVAL OFFICE TATTOO OFFICE EDINBURGH INTERNATIONAL FESTIVAL OFFICE BOOK FESTIVAL

MAIN COACH PARKS i GALLERY Ol MODERN AR1 H

ON-STREET COACH PARKING COACH PARKING FOR EDINBURGH CASTLE AND THE PALACE OF HOLYROODHOUSE

TOST AIRPOI' "l m & J

CLOSED ROAD BRIDGE FRINGE OFFICE (The coloured bonds represent the distance from the Fringe office measured in quarter mile stages).

SQUARE

’ gm

SBI Wkm

CALTON HILL

1

HAYMARKET

f THE PALACE OF HOLYROODHdUSE '"ilwffp"

K

L

FRINGE OFFICE 180 HIGH STREET

PUCE

FRINGE CLUB BRISTO SQUARE M MEADOWS N

O

P

GRAN

ARTHURS SEAT



Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.