Renni Abraham Mumbai: Delhi Chief Minister Arvind Kejri wal’s excise department policy for 2021-2022 is un der the CBI scanner, even as an excise policy along identical lines was intro duced in West Bengal by CM Mamta Bannerjee and a hush-hush meeting was held between Delhi Deputy CM Manish Siso dia and Telangana CM K Chandrashekhar Rao (KCR).Even as the excise pol icies are being investi gated for allegedly being tweaked to benefit pri vate liquor business houses at the cost of the respective state excheq uers, a foreign angle has also cropped up. One of the 15 prime ac cused against whom the CBI has issued look-out notice, Vijay Nair— founder of event and ce lebrity management firm Only Much Louder (OML)—has gone to ground after his linkages with Sisodia and affili ates of pro-Khalistani groups based out of Can ada, USA and the UK have surfaced. A person familiar with the development said, “Vijay Nair and Swara Bhaskar are part of a lobby group set up in the USA with the conscious agenda to undermine In dia through a targeted forum known as the Hin dus for Human Rights (HfHR). The advocacy group had even sched uled a fund-raiser event hosted by stand-up comic and Nair’s protégé Ka neez Surkha on Sunday in the US. Bhaskar had earlier denied any asso ciation with HfHR but was thereafter inducted into its advisory board.” He added that the CBI has also stumbled upon hush-hush meetings be tween Sisodia and KCR held recently at the Ober oi hospitality facility in Telangana.“Sisodia is believed to have shared detailed in tricacies regarding the Delhi Excise policy mod el with KCR, and also with his West Bengal counterpart, following which it was similarly enacted into law by the Mamta Bannerjee-led TMC government,” the source alleged. The fact that HfHR has tied up with two other perceived anti-India lob by groups abroad—the Indian American Mus lim Council (IAMC) and Organizations for Minor ities of India (OFMI)— with the three having formed a grouping known as AJA has not been missed by Indian intelligence agencies. “Particularly, OFMI was founded by Bhajan Singh Bhinder—who India has designated a terrorist, and who has been receiv ing funds from the Paki stani ISI for over 30 years for fomenting trouble in India,” the person added.
Cyberspaceinternet-basedvarioussocialmediaplatformstopropagateitsideology.isbeingcloselywatchedinthisregardbytheagenciesconcernedandactionistakenasperlaw.
TOP COURT SEEKS GUJARAT’S REPLY ON TEESTA’S BAIL New Delhi: The Supreme Court Monday sought a response from the Gujarat government on a bail plea by activist Teesta Setalvad, arrested for allegedly fabricating evidence to frame “innocent people” in the 2002 Gujarat riots cases. A bench headed by Justice U U Lalit issued notice to the state on the plea filed by Setalvad and posted matter on Aug 25.
Moni Sharma Moscow: The Russian Federal Security Ser vice (FSB) on Monday said that its officers had detained a suicide bomber, a member of the Islamic State terror ist group, who was plot ting a terrorist attack against one of India’s leadership“Russia’selite.FSB identi fied and detained a member of the Islamic State international ter rorist organization banned in Russia, a na tive of a country in Cen tral Asian region, who planned to commit a terrorist act by blowing himself up against one of the representatives of the ruling circles of India,” authority said. Following the row stirred by former BJP spokesperson Nupur Sharma’s comments on the Islamic Prophet Mo hammed, IS has threat ened to carry out at tacks across India. The IS-KP, operating in the Indian subcontinent, released a 50-page docu ment on the issue with pictures of PM Naren dra Modi petting a cow.
First India Bureau Mumbai: Even as the Supreme Court hearing on issues emerging from the vertical split in the Shiv Sena got postponed by a day, all the uncertainty could spur new political alignments in Maha rashtra. In fact, some statements by political leaders are being curi ously observed in state political circles.
PADMA AWARDS NOMINATIONS TILL SEPT 15
—Home Ministry
NEW ‘MAHA’ POLITICAL ALIGNMENTS IN THE OFFING?
Mumbai: A special court here on Monday extended the judicial custody of Shiv Sena MP Sanjay Raut till September 5 in a money laundering case linked to alleged irregularities in the redevelopment of a Mumbai ‘chawl’. Raut was arrested by ED on August 1 in connection with alleged financial irregularities in redevp of the Patra Chawl.
Sisodia shared excise policy details with Telangana, WB
The CBI has allegedly stumbled upon hushhush meetings between Sisodia and KCR held recently at the Oberoi hospitality facility in Telangana. “Sisodia is believed to have shared detailed regardingintricaciestheDelhi Ex cise policy model with KCR, and also with his West Bengal counter part, following which it was similarly enacted into law by the Mamta Bannerjee-led TMC government,” a person familiar with the issue told First India.
RUSSIA’S ACTIVE FSB: Principal security agency works to counter-intelligence, internal and border security, counter-terrorism, and surveillance of serious crimes and law violations.
New Delhi: Delhi depu ty CM Manish Sisodia, who caused a stir by claiming on Monday that the BJP offered to dismiss cases against him if he joined the party, has now claimed that the saffron party offered him the chief minister’s post if he caused a split in AAP. Meanwhile, the BJP on Monday dismissed Sisodia’s claim of re ceiving an offer from the saffron party to get all cases against him closed, BJP’s national spokesperson Gaurav Bhatia told at a press conference in Delhi.
New Delhi: Top executives of Indian arms of Apple, Google, Amazon, Netflix and Microsoft will on Tuesday depose before a parl panel looking into anticompetitive practices in the digital space, the committee’s chairman Jayant Sinha said. Panel has been looking into few aspects of competition in the marketplace.
New Delhi: PM Narendra Modi on Monday congratulated Indian wrestlers. He tweeted,”Our wrestlers make us proud again! Congratulations to our team on winning 16 medals (7 each in Men’s and Women’s freestyle and 2 in Greco-Roman) at the U20 World Championships.
‘WANTED TO TAKE REVENGE BY KILLING INDIAN LEADER’ A video released by the news agency purports to show the man, who identifies himself as ‘Azamov’, confessing to the plot. The man is believed to be a citizen of a country in Central Asia. “In 2022, I flew to Russia, from where he was supposed to go to India. In India, I was supposed to be met and given all the neces sary things to commit a terrorist attack on instructions of Islamic State for insulting Prophet Muhammad,” the detainee said in the video.
YASIN COURT’SREFUSESMALIKLEGALAIDOFFER
RAUT’S TILLCUSTODYJUDICIALEXTENDEDSEPTEMBER5
SISODIA SHOULD BE GIVEN RATNA:BHARATKEJRIWAL
Dormant throughout the political upheaval that toppled the Maha Vikas Aghadi (MVA) government, the Maha rashtra Navnirman Sena (MNS) on Monday sprung into action. MNS chief Raj Thack eray, who has been re cuperating from a hip bone surgery, held a meeting of MNS senior leadership on Monday and asked them to look at the uncertain politi cal scenario as an op portunity.Thackeray apparent ly told MNS office-bear ers that voters were fed up with the opportunis tic politics on display in Maharashtra, and they will vote for a party like MNS which fights for the sons-of-the-soil and MarathiThackerayself-pride.islikely to undertake a statewide tour once his physical condition improves. For the time being, he has asked MNS work ers to launch a fresh drive to rope in new memberships begin ning August 25. He has also scheduled another meeting with MNS of fice-bearers for Tues dayBelievedmorning.tobe unhap py in the party, Pune MNS leader Vasant
Prime accused in the CBI’s case, Vijay Nair on the lam as his linkages with Sisodia, and affiliates of proKhalistani groups have surfaced Dy CM Manish Sisodia
MNS looking to exploit uncertainty invoked after the MVA govt’s ouster; Raj Thackeray asks workers to begin induction campaign from August 25 MNS chief Raj Thackeray TECH GIANTS TO DEPOSE BEFORE PARL PANEL TODAY
Jammu: A special court on Monday offered legal aid to JKLF chief Yasin Malik, but he turned it down and again insisted on his physical appearance in hearing on the killing of four IAF personnel. The next date of hearing in the third week of September.
FLOOD THREAT LOOMS LARGE! Subarnarekha river flows over the danger mark owing to heavy monsoon rainfall at the Rajghat near Jaleswar in Balasore district on Monday.
ATTACK AGAINST TOP INDIAN LEADER FOILED
Russia detains IS suicide bomber plotting terrorist attack
BANTER?FRIENDLY
YOU’RE MESSING WITH WRONG PEOPLE: KCR’S DAUGHTER Hyderabad: Reacting to allegation that Telangana CM K Chandrashekar Rao’s daughter and MLC K Kavitha was the “middleman” between liquor mafia and AAP govt in Delhi excise policy case, Kavitha has called allegations “baseless”, said has nothing to do with it.
READ Crucial www.firstindia.co.in I https://firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia MUMBAI l TUESDAY, AUGUST 23, 2022 l Pages 12 l 3.00 RNI TITLE NO. MAHENG/2022/14652 l Vol 1 l Issue No. 108 OUR EDITIONS: JAIPUR, NEW DELHI & MUMBAI FUTURE OF THE SAFEWRESTLINGINDIANINHANDS:PM
BSE SENSEX 58,773.87 872.28 | NSE
BJP offered to make me CM, says Sisodia; Party refutes claim Arvind Kejriwal and Manish Sisodia in Ahmedabad on Monday.
IS is using
More was given deputa tion as an observer for the Baramati Lok Sab ha constituency by Thackeray. Baramati is likely to be in focus from September on wards when Union Fi nance Minister Nirma la Sitharaman, tasked by the PM, makes her first trip to the constit uency of Nationalist Congress Party (NCP) MP Supriya Sule. In the 2019 Lok Sabha polls, the Sena-BJP had won combined 41 out of 48 seats, while NCP managed to win 04, and Congress, AIMIM and Vanchit Bahujan Agha di won 01 seat each. While the Bharatiya Janata Party (BJP) managed to breach the neighbouring Madha constituency, Sule won the Baramati seat again.MNS has a base in Pune where it had won a few seats in the Pune Municipal Corporation (PMC) and the work of its councillors was ap preciated.Adayearlier in Pune, when asked if MNS could join hands with Uddhav-led Shiv Sena, Raj Thackeray’s wife Sharmila Thackeray did not rule out the pos sibility. “There is noth ing of this sort in play,” she said. When asked if Uddhav had initiated such a move to join hands with his cousin Raj, she said, “Saad ghatali tar baghuya (If an overture is made, we willPoliticalsee).” circles are also abuzz after a state ment made by Uddhav Thackeray’s aide Vi nayak Raut on Sunday praised Deputy Chief Minister Devendra Fadnavis for telling BJP workers that they want to come to power in the BMC to fulfil Bal asaheb Thackeray’s dreams for Mumbai. “Devendraji has ex plained the reality to his party workers and admitted that they can no longer seek votes in the name of (Prime Minister) Narendra Modi.”
OPEN
VIGILANCE BUREAU ARRESTS FORMER PUNJAB MINISTER Chandigarh: Former Punjab minister Bharat Bhushan Ashu has been arrested by the vigilance bureau after allegations of corruption against him. Bharat Bhushan, former food and civil supplies minister, is at the centre of allegations in a transport scam in which tenders were allocated on fake registration numbers of vehicles.
New Delhi: Centre on Monday launched Rashtriya Puruskar Portal to bring together awards of various ministries, depts, agencies of GoI under one platform. The last date for nominations is September 15.
—PHOTO BY PTI
New Delhi: Delhi CM Arvind Kejriwal on Monday said that Sisodia should get ‘Bharat Ratna’ for reforming Delhi govt schools, but is being hounded by Centre due to political motives. “The entire country’s education system should be handed over to him,” he said.
NIFTY 17,490.70 267.75











Maha govt to set up cyber intel unit: Fadnavis First India Bureau Mumbai: The Ma harashtra govern ment will soon launch a cyber in telligence unit, Deputy Chief Min ister Devendra Fad navis said on Mon day. Fadnavis’s an nouncement came in response to a query in the Maha rashtra Council.Legislative According to him, cyber crimes had gone up—especially in the aftermath of the COVID-19 pan demic—as people preferred online transactions to cash ones.“We track websites and social media, but a cyber intelligence unit is also impor tant because online fraud is rising. I want to assure you that the government will es tablish a cyber intel navis said that in sev eral cases the cyber criminals operated from not just other states, but other countries as well. He gave the exam ple of Chinese “loan apps”, some of which operated from Nepal. “Many of these apps’ call centres operate from Nepal,” he said, adding that the state government was in contact with the Nep alese authorities for any cyber crime-re lated andqualifiedmentthatministerThenecessarytionssuchule,aberciltheFadnaviscollaboration.alsotoldLegislativeCounthatthestatecyunithadprepared‘CyberWatch’modwhichtrackedloanapplicaandwastakingaction.deputychiefalsosaidthestategovernwaslookingformanpoweroutsourc
NEWS MUMBAI | TUESDAY, AUGUST 23, 2022 02 www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
First India Bureau Thane: bailineonestrainsconditionedsomesionreconsiderRailwaysdaydra(NCP)CongressNationalistPartyMLAJitenAwhadonMonurgedCentral(CR)toitsdeciofreplacingofthenon-airlocalwiththeAConthemainbetweenMumandThane.
`
First India Bureau Mumbai: Over 50,000 personnel employed with the Maharash tra home guards will soon have a safety net of Rs50 lakh insur ance cover in case of deaths and a Rs20 lakh cover for serious injuries. Following a decision taken to open accounts for all personnel with a leading private bank, the insurance cover has been extended for the home guard personnel as Accordingwell. to a de partment official, sala ries were previously deposited directly into employees’ bank ac counts. Since all the accounts were not in the same bank there was no way to get some benefits from the banks, which they pro vide in case of bulk ac counts.Ifthe salary ac counts of police forces across the state are opened in the same bank, they are entitled to insurance cover in case of death and other incidents.Commandant Gener al of Home Guards, BK Upadhyay said that he received several re quests from personnel from across the state to provide them with in surance cover in case they met with an acci dent in the line of duty. The issue being faced by state home guards was brought to the attention of the Maharashtra govern ment, and talks with a private bank were held. The bank agreed to provide insurance coverage as a special case if all accounts were opened with them. This was execut ed by government au thorities despite the fact that some ac counts could only func tion as salary accounts for a specific period due to the high attri tion rate due to the force being voluntary in “Nownature. even home guards have death in surance cover of Rs50 lakh, Rs20 lakh cover for serious injuries and in case of hospi talization an amount of Rs1,000 per day will be provided for two weeks,” said an officer. The services of home guards are used by the Railways to have personnel in the la dies’ coaches at night, to prevent occurence of crimes against women onboard. They are also called to assist the traffic police and local police, especially duringCitizensfestivals.canregister to secure employment as home guards. After undergoing a month of training, they are de ployed to their postings across the country.
—FILE PHOTO
First India Bureau Mumbai: The Maha rashtra Legislative Assembly on Monday passed an amendment to an Act, under which heads of nagar parishads and pan chayats can be elected directly by the voters. Chief Minister Eknath Shinde tabled a Bill to amend the Maha rashtra Municipal Council, Nagar Pan chayats and Industrial Townships Act, 1965. The amendment was introduced to change the existing practice of elected representatives choosing the heads of nagar parishad or mu nicipalRaisingcouncil.objection to the Bill, Leader of Op position Ajit Pawar said, “This is against the spirit of democracy. This government has not only played with the democratic norms, but has also given excess powers to the elected heads. This will cause frustration among elected members, as most of the powers are delegated to the head.” The amendment would restrict candi dates from the Sched uled Castes (SC) and Scheduled Tribe (ST) communities to become the city head. Earlier, the posts of civic heads used to be reserved for wom en, SC, ST, Other Back ward Classes (OBC) or open. There is no such provision in the amend ment, claimed Pawar. However, the amend ment was later passed with majority voting in favour of it. Voters will be able to elect heads to civic bodieswithoutdirectlyanymiddleman Traffic on the expressway would be monitored in real-time with the new system.
tryMumra)tionsfromedformerthewaysagitationTherecommuters.willbeaniftheRaildoesnotresolveproblem,saidthestateminister.Awhadfurtheraddthatcommutersintermittentsta(suchasKalwa,donotgetenintothetrainsand to add to it, now the non-AC local train ser vices have been re duced. Besides, the fare of the AC locals was too high for the common man, he said. On Friday, hun dreds of commuters had squatted on a rail way track near the Kalwa station, block ing the path of an empty AC local train for 20 minutes to de mand resumption of a non-AC service in the morning peak hours. The CR has added 10 AC locals, replac ing the existing nonAC locals on the main line, but com muters are unhappy with the decision.
The Central Railway (CR) has added 10 AC locals, replacing the existing non-AC locals on the main line.
Maha Assembly passes amendment for elections of NP, panchayat heads
ment is going to intro duce an Artificial Intelli gence-based traffic man agement system on the Mumbai-Pune Express way. The system will en able police personnel to receive the location of a caller immediately,” said theWhenminister.aperson makes a call after an accident, the system would enable police to locate the near by mobile phone tower and zero-in on the exact location of the caller. This system will also help in maintaining a concurrent live tracking of traffic, he said. When Mete’s driver made a call to police, he merely said that he was outside a tunnel. He could not even inform the police which tunnel he was talking about. Fi nally, the was located outside a third tunnel under jurisdiction of Raigad police, said the deputy chief minister.
—Devendra Fadnavis, Maharashtra Deputy CM
THE ACCIDENT ‘CR should reconsider replacing non-AC locals with AC trains’
The driver changed lanes and tried to over take a heavy commercial vehicle in the middle lane from the left side. There was already another heavy vehicle in the left lane and there was no space for overtaking it. It was an utter ly wrong judgement of the driver.”
JOB POSTINGS ‘Govt
The decisiongovernmentstatehasextendedthisprovisionforallhomeguardsfollowingatakentoopenaccountsforallpersonnelwithaleadingprivatebank to introduce AI traffic mgmt system’
Addressing the me dia, the MLA from Kalwa-Mumbra in Thane said the deci sion to replace the ex isting non-AC locals with the AC trains was causing hard ships to
Govt to bear education cost of students who lost parents to COVID-19: Patil
First India Bureau Mumbai: Maharash tra Minister Chan drakant Patil on Monday said the state government will bear the educa tion expenses of col lege students who have lost both their parents to the COV ID-19 pandemic. The government will pay their fees of the en tire course. The deci sion will cost the state exchequer more than Rs2 crore annually, and there will be no need for the state government to pass similar decision every year,” he said. The state higher and technical education minister made the an nouncement at the state Assembly while re sponding to a question by Congress legislator Shirish graduateAroundChaudhary.931underand228post graduate students of various government colleges were orphaned in the nCoV pandemic. 32-year-old man cheats students `62L on promise of MBBS admission; held Palghar: Sudhanshu Choubey (32) has been arrested in Palghar district for allegedly duping seven students of Rs62.12 lakh by promising them admission in medical colleges, a police official said on Monday. “He told people he had contacts with the Medical Council of India and took money after promising them admission in colleges. He sent victims fake emails about the admission process. One person came forward and filed a complaint with Manickpur police after which an investigation was launched,” said As sistant Commissioner of Police Padmaja Bade.
First India Bureau Mumbai: Days after the death of Maha rashtra Legislative Council (MLC) mem ber Vinayak Mete in a car crash on the Mum bai-Pune expressway.mentbasedArtificialgoingrashtradaydraChiefMaharashtraExpressway,DeputyMinisterDevenFadnavisonMonsaidtheMahagovernmentistointroduceanIntelligence-trafficmanagesystemonthe
—FILE PHOTO
50 lakh insurance cover for 50,000 state home guards soon
Wrong judgement on part of driver led to saysMete’sVinayakaccident,deputyCM
Jitendra Awhad Chandrakant Patil Deputy CM Devendra Fadnavis
FUTURE SECURED lll
It will enable police to immediately get the lo cation of a person mak ing a call to them after an accident, said Fadnavis in the state Assembly. He also claimed that it was an “utterly wrong judgement” on part of Mete’s driver that led to theFadnavisaccident.was on Mon day responding to a calling attention no tice in the state As sembly by triedchangedlegislatorCongressVarshaGaikwadonMete’sdeathintheaccident.“Thedriverlanesandtoovertakea heavy commercial vehi cle in the middle lane from the left side. There was already another heavy vehicle in the left lane and there was no space for overtaking it. It was an utterly wrong judgement of the driv er,” said phones,helppeoplestateorhicledriver’shindsideimpact“Thus,Fadnavis.theaccidentwasonMete’swhowassittingbeinthecar.Thesideofthevewasnotaffecteddamaged,”saidthehomeminister.Afteranaccident,makecallsforfromtheirmobilehenoted.“Thestategovern







A single bench of Justice SM Modak passed the order on Au gust 17 while hearing two petitions of a wom an and her estranged husband. A copy of the order was made availa ble on TheMonday.couplehas been embroiled in a matri monial dispute and had filed two separate appli cations in the local courts of Pune and Thane.Thehusband, a resi dent of Pune, sought for transfer of the applica tion filed in the Thane court, while the woman from Mumbai sought transfer of the Pune case to Thane. In his plea, the man said he has the custody of their two minor chil dren, who were being cared for by his mother and sister, and hence, he would not be able to keep travelling to Thane.Thewife in her peti tion said that she was unemployed and would not be able to travel to Pune.While ruling in fa vour of the woman, Jus tice Modak noted that the husband has his family to look after the children and has not laid out any other rea son for not wanting to travel to Thane.
We recently learnt there are many CSIR institutes which do not have proper sanitary pad disposal machines. So what is the Minis try of Science and Technology doing for the betterment of female researchers? — PhD student at NCL
Power debts led to cholera tragedy in Maharashtra village RURAL REALITY
First India Bureau Mumbai: Taking suo moto cognizance of re cent incidents of su perstitious practices involving women and children reported in Aurangabad, Nagpur and Pune, the Maha rashtra State Women Commission (MSWC) on Monday demanded strict action against tantriks and self-pro claimed godmen, as well as those promot ing such practices.
No sanitary pad disposal mechanism at CSIR insts
Mumbai: Police scanned footage from 214 CCTV cameras to nab two alleged chain snatchers, an official of the Kasturba Marg police station said on Monday. “Police in plain clothes arrested Feroz Nasir Sheikh in Thane district when he came near the bike.
First India Bureau Pune: A woman PhD student from Pune’s National Chemical Labora tory in an interac tion with Union minister Jitendra Singh has flagged the lack of proper sanitary pad dispos al mechanism in many institutes of the Council of Sci entific and Indus trial Research (CSIR). The Minister of State for Science and Technology acknowl edged the issue dur ing the interaction on Sunday, while the di rector of the National Chemical Laboratory (NCL), which is a con stituent member of the CSIR, said an “in ventive” solution is in the offing and will be deployed at the hos tels and labs. Singh visited the NCL to inaugurate the new buildinginstitutionalofCSIRURDIP.Replying to her, Singh said, “Of course, that is an is sue. I think the fact that there were fewer female researchers in the past also has a bearing. As the num ber of female re searchers has been increasing, that will also be taken care of.” “We are trying to bring that solution by deploying it in hostels and laboratories. It is taking little time, but at least there is a solution,” NCL direc tor Dr Ashish Lele said, when the minis ter asked him to elaborate on the issue raised by the PhD student.
TIMECHANGEFOR
SIX ANCIENT METAL IDOLS STOLEN FROM TEMPLE IN JALNA DISTRICT
Thane: The district administration, Thane Municipal Corporation and the local police razed an illegal struc ture built in a joint operation on Monday. The presi dent of the Thane Zilla Patrakar Sangh, Sanjay Pitale informed that the plot had been allotted to the Sangh in 1988 for the construction of Patrakar Bhavan. However, following the misuse by the developer, the Sangh took up the issue with the collector and state government.
“The fact that the ap plicant (wife) is a lady, her inconvenience needs to be given more priority because the law considers women as a class belonging to the weaker section of soci ety and needs more pro tection,” said the court. It further held that the woman had also come up with a griev ance that while living with her husband, she was ill-treated and she was apprehensive about visiting the same city again.
Zafar Yunus Zafari alias Zafar Chavhan was held later,” the official added.
First India Bureau Mumbai: While trans ferring a matrimoni al dispute case from Pune to Mumbai at a woman’s request on Monday, the Bombay High Court said, “The law considers women as a class belonging to the weaker section of society that needs more protection, and hence their inconven ience has to be given priority.”
COPS CHECK FOOTAGE FROM 214 CCTV CAMERAS TO NAB CHAIN SNATCHERS CIVIC BODIES RAZE ILLEGAL STRUCTURE IN THANE OVER VIOLATIONS
Jalna: Six ancient idols, made of five metals, were allegedly stolen from temple in Jalna district. The theft came to light on Monday morning when the temple priest found that the idols were missing. According to sources, the idols were installed in the temple in 1535. The police are examining the CCTV footage from the temple to identify the suspects, an official said.
MAHARASHTRA MUMBAI | TUESDAY, AUGUST 23, 2022 03 www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
3 medics dismissed, 4 suspended after baby born outside PHC dies
First India Bureau Palghar: A 15-year-old girl who was believed to have drowned in a drain in Nalasopara in Palghar district— and for whom author ities carried out an extensive search op eration—has been traced to Uttar Pradesh, a police offi cial said on Monday. “We were informed that a 15-year-old girl had slipped into a nul lah on August 17 and had been swept away.
Aurangabad: At least 25 people were rescued from a fire that erupted on a state transport bus in Aurangabad district, an official said on Monday. The incident took place on the intervening night of Sunday and Monday in Dhoregaon of Gangapur. The blaze broke out on the bus around 01.45 am that was travelling from Nashik to Hingoli, the official said. At least 25 passengers were rescued from the vehicle before the fire gutted it, he said, adding that the rea son for the blaze was yet to be ascertained.
First India Bureau Mumbai: In Pachdon gri village, a hilly hamlet in Amravati district with a popu lation of less than 1,000 people, water woes are directly con nected to power woes. Or, to be more pre cise, power-debt woes. While the outstand ing power bill might sound trivial to many— it’s just Rs52,000 pend ing for about five months—the reality faced by the villagers is something else alto gether.
CRUCIAL READ
Civic teams carried out a search operation. Now we have been told she is at her uncle’s house in Uttar Pradesh,” Inspec tor Mahendra Shelar of Pelhar police station in Vasai said. He said an investiga tion would be launched to find out why the Dhaniv Baug girl had gone to UP without in forming her parents and why the police were given wrong informa tion about her falling into a drain.
While ruling in favour of the woman, Justice Modak noted that the husband has his fam ily to look after the children and has not laid out any other rea son for not wanting to travel to Thane. “The fact that the applicant (wife) is a lady, her inconvenience needs to be given more priority because the law considers women as a class belonging to the weaker section of society and needs more protection,” said the court.
BUS RESCUEDPASSENGERSFIRE,CATCHES25
The dismissals and suspensions of medical personnel attached to the Vidul PHC came after an inquiry by District Health Officer Prahlad Chavhan. —FILE PHOTO Bombay High Court. —FILE PHOTO We seniorwrittenhavetopoliceofficials,in cluding Nagpur police commissioner, to take action against ‘tantriks’ and ‘babas’.” —Rupali Chakankar, MSWC chief
The dismissals and suspensions of medical personnel attached to the Vidul PHC came af ter an inquiry was con ducted by District Health Officer Prahlad Chavhan, who visited the facility on August 20, an official said. The action has been taken by the Yavatmal zilla parishad chief ex ecutive officer, Chavhan said.Of the two medical of ficers who have been dismissed, one is on bond and the other is on contract, while the talu ka health officer has been issued a show cause notice, he said.
While transferring a matrimonial dispute case from Pune to Mumbai single bench Justice SM Modak passed order
MSWC demands action against ‘tantriks’ over superstitious practices
In a hilly hamlet of Amravati district, water pump didn’t function due to electricity outage, leading residents to drink contaminated well water
‘Women considered as weaker section, need to give priority’
The power out age, because of lack of payment of bills, caused a cholera out break that claimed five lives, the villagers claim.The lack of power led to dry taps—which were just recently in stalled in houses— which made people walk 2km to fetch drinking water from a well. A well that had been contaminated by sewage, which led to the cholera outbreak in the“Ifvillage.water supply had continued, the deaths could have been avoid ed as people consumed contaminated water from a well,” said Sanjay Bhuta Ja munkar, the 32-year-old council head for Pach dongri, and four other villages in western Maharashtra.“Thiswas our first power bill for operating the water pump. We weren’t sure we had to pay it,” said Jamunkar, noting that the council paid.Pachdongri gets its power from the staterun Maharashtra State Electricity Distribu tion Co. Ltd (MSEDCL), which warned its 30 million consumers last December it would dis connect supplies for those who did not pay theirDatabills.from MSEDCL showed rural consum ers owe more than Rs60,000 crore—10 times more than unpaid dues from urban con sumers of Rs6,200 crore. Local officials who turned off the power supply to Pachdongri said they had informed the village council about the impending cut if it failed to pay at least some of its dues. “If they have used power, they need to pay for it,” said Dilip Khanande, superinten dent engineer for MSEDCL in Amravati. Following the cholera outbreak, the state gov ernment ordered that the power supply to public water works not be disconnected. The state was also consider ing clearing the village councils’ debts, power utility officials said.
Girl feared drowned in drain found living in UP
Yavatmal (PTI): Two medical officers and one auxiliary nurse midwife (ANM) were dismissed, while a pharmacy officer, two health assistant and a woman “health visi tor” were suspended on Monday in connec tion with a woman delivering a child in the verandah of a pri mary health centre in Yavatmal in Maha rashtra some days ago in the absence of trained personnel. The incident had tak en place in Vidul PHC in the district’s Umarkhed taluka on August 19 and the child died soon after, leaving health officials of the facility facing allegations of negli gence from the woman’s father.Hehad claimed his daughter was brought to Vidul PHC in an au torickshaw in the ab sence of an ambulance, but did not find any medical personnel when they reached, forcing her to give birth in the verandah of the facility.
“We have written to senior police officials, including Nagpur police commissioner, to take action against ‘tantriks’ and ‘babas’,” said MSWC chief Rupali Chakankar. In Nagpur, a six-yearold girl with speech im pairment was allegedly killed by her parents on the directions of a tantrik, who claimed that the child was pos sessed by an evil spirit, ChakankarSimilarly,said.avideo of another incident report ed in Aurangabad is be ing shared on social me dia, in which a godman can be seen placing his hands on a woman’s head claiming to heal her of ailments, she said. “In Pune, a woman was forced to bathe na ked in front of people to bear a son. Following the incident, the woman’s husband, in-laws and the godman were arrested by the local police,” Cha kankar said. It is the MSWC’s re sponsibility to deal with such activities, she said, adding that an aware ness programme will be held to address the same.






IN-DEPTH
REKHA
Antarctica woke up to a sunrise after four months of pitch black darkness as the sun remained hidden
Like musicians in an orchestra, every organism plays its part, making the symphony of life possible and enjoyable. Sadly, such partnership and bonding is often lacking in families and organisations since many are influenced by self-interest. But how can one learn to cooperate better?
Editor-In-Chief: Dr Jagdeesh Chandra Editor: Anita Hada Sangwan responsible for selection of news under the PRB Act SPIRITUAL SPEAK Be on your guard; stand firm in the faith; be courageous; be strong. Bible Dr Jitendra @DrJitendraSinghSingh Thanks PM Sh @NarendraModi for your focus on the infrastructural development of remote rural areas in the hill districts of #JammuAndKashmir. Thanks Rural Development Minister Sh@girirajsinghbjp for accepting our request with a special consideration and sanctioning the construction of road from Dansal to Assar via Lalhote, Bulandpur, Charote in district #Doda under Central #PMGSY scheme.
fter four months of darkness, the sun is finally out over the frigid world of Antarc tica. The European Space Agency (ESA) announced the Sun’s arrival as the 12-mem ber crew of the Concordia research station woke up to a bright morning on the south ern extreme of the world. ESA released a picture of the sun rising above the ho rizon captured by medical doctor Hannes Hagson on August 5, who said, “Time here has the strange quality of both passing really quickly and very slowly at the same time, and in just two days we expect the re turn of the sun to grace us here at 75 degrees south!
The returning daylight cer tainly has us all cheered up and starting to sense the be ginning of the final part of thisTheadventure.”crewliving in the frigid environment braced for extreme temperatures that fell down to 80 degrees Celsius under a pitch-black sky. The crew has been busy conducting biomedical re search, gathering data from crew urine, stool, and blood samples, as well as cogni tive and psychological measures through question naires to study the effects of isolated, confined, and ex treme environments on the human body.
EVERYTHING ABOUT THE PLACE IS EXTREME z THE ANTARCTIC LONG NIGHT BEGAN IN MAY THIS YEAR z WITH THE SUN, NOW OUT, A NEW BATCH OF RE SEARCHERS WILL POUR IN z THE CREW BRACED EX TREME TEMPERATURES THAT FELL DOWN TO − 80 DEGREES CELSIUS
Kiren @KirenRijijuRijiju Railway Projects for MANIPUR were conceived in 1990. It’s only @ narendramodi Ji, who has fulfilled it. Now, all North East States are connected and more projects are on the pipeline to link NE with rest of India. And reservation provisions are made easy for the passengers.
l Vol 1 l Issue No. 108 l RNI TITLE MAHENG/2022/14652NO.Printed and published by Anita Hada Sangwan on behalf of First Express Publishers. Printed at Dangat Media Pvt Ltd, No.22, Dighe MIDC, Vishnu Nagar, TTC Industrial Area, Dighe, Navi Mumbai-400701. Published at Plot No. 3 Scheme C of Manglorean Garden Home, CHS Limited, Survey No. 5, 6C (Part) Ville Parle East, Mumbai 400057.
A SHARMA
THE VIEWS EXPRESSED BY THE AUTHOR ARE PERSONAL
THE LONG NIGHT ENDS IN ANTARCTICA!
The writer is Editor, News at First India
The writer is a personal development skills facilitator. rekhakumar@protonmail.com
PERSPECTIVE MUMBAI | TUESDAY, AUGUST 23, 2022 04 www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
H
T KUMAR
MONI
MIRACULOUSTEAMWORK! he ‘web of life’ – how fitting that expression is, for life is a network of interconnected and interdependent organ isms. We are a part of that web. In our body, quietly at work, in our digestive tract, is an army of friendly bacte ria assisting us to stay healthy by aiding in diges tion. Images fall on the retina of our eye just as they do on a camera’s film. Why is the world not upside down to us? It is because the brain has developed the habit of re versing the impressions. It is miraculous team work be tween the eye and the brain. Muscles can only contract, but skeletal muscles work in pairs. When one contracts, the other muscle relaxes. On a calm ocean, suddenly bubbles appear. Here, two whales working as a team perform an underwater bal let. Another example is of ants, who are a model of co operation and order – they work together to drag objects larger than themselves. In nature, mutual support and harmony can be seen at every level. The team work needed to maintain life is awe – inspiring.Likemusicians in an or chestra, every organism plays its part, making the symphony of life possible and enjoyable. Sadly, such partnership and bonding is often lacking in families and organisations since many are influenced by self-inter est. But how can one learn to cooperate better? As never before, we see disunity all around. Personal jealousies, ambitions, rival ries, color, education and competition have divided people. Wherever one looks, one sees differences – nation al, racial, cultural, language as well as economic differ ences. There is a singular lack of oneness. It is natural for one to de sire freedom. But acting too independently is not practi cal. A ‘give and take’ action is essential because we need one another. Any person, who desires everything to be done his own way, develops the habit of making issues over small matters. By refus ing to cooperate, he/she is unable to ‘fit Differencesin’.threaten and weaken a team. Uncontrolled and offensive words create tension. A quick apology re stores cooperation and unity. Often, offences are of a small nature, solely due to thought lessness, a lack of tact and a momentary excitement with out evil intent. One can be broad minded to forgive the offence. Thus, the dark clouds will be dispersed and the sun will shine again in one’s rela tionships.Thedesire to belong is in herent in everyone. One wants to share life and interests with others and to feel accepted and recognized. A competitive spirit works against a coop erative attitude. In the long run, it is counter-productive since it produces a win-at-anycost outlook, and hampers qualityOutshiningwork. others and over taxing oneself in the quest to get ahead, results in frustra tion. So is it wise to stir up competition with others? Does one enjoy the company of highly competitive persons? The win-only psychology downgrades so many other virtues and skills like dedica tion, brilliance, effort, cour age and ethical performance. To minimize these, would be self-limiting. Competition may motivate initially but achievers find motivation in the activity itself, in being creative, in making improve ments and new discoveries. Cooperation is the course of wisdom. It is far more im portant for survival and pro gress. It is an act of working with others towards a com mon end. Implicit in coopera tion is the goal to attain. It re quires our willingness to yield for the sake of realizing the common goal. It also means the giving up of little things for the sake of bigger things. At one’s place of work, the matter of cooperating in a team can come up. At times, the way certain things are be ing done, may not make sense but that is no reason for not doing the given task. If the course pursued is not cor rect, most likely, time will prove it. In the meantime, one can do one’s best to make it aTheresucceess.isoften the tendency to take oneself too seriously and to limit one’s cooperation when things are not being done the way one sees it right or if one is not given a suffi ciently prominent role. This is a test of one’s loyalty to the cause or the organization. To limit our cooperation according to our own terms leads to loss of many benefits. Giving up one’s preferences for the sake of common good leads to mutual well-being. We may feel that the part we play is small, but the small acts that promote team spirit are like the small stitches that hold a garment together and makes it strong.
TOP TWEETS BALL IS NOW IN FIFA’S COURT TO ALLOW AIFF TO HOST WORLD TOURNEY ope is in sight for In dia to host the Un der-17 women’s soccer world championship. The FIFA ban on In dia’s football federation is expect ed to be lifted after the Supreme Court acceded to Central govern ment’s request to postpone elec tion to the All-India Football Fed eration’s executive committee. The court dissolved the threemember Committee of Adminis trators it had earlier appointed. The CoA will hand over charge to the federation’s acting generalsecretary. Former football captain Bhaichung Bhutia, who was plan ning to contest the AIFF election, however, filed an intervention ap plication, supporting the reforms which the court intended to bring in the federation following allega tions of corruption. Bhutia sub mitted that the reforms within AIFF “cannot be held to ransom because of FIFA’s suspension…” On the other hand, taking on FIFA would have come as a dampener for young women foot ball enthusiasts waiting for their moment under the sun. Women’s sports are becoming popular globally. Recall how England cel ebrated its women’s soccer team’s victory over Germany in the European Championship.
To limit our cooperation according to our own terms leads to loss of many benefits. Giving up one’s preferences for the sake of common good leads to mutual well-being. We may feel that the part we play is small, but the small acts that promote team spirit are like the small stitches that hold a garment together and makes it strong







To Receive Free Newspaper PDF Daily Whatsapp: Telegram: Click the above link☝ & subscribe us on your preferred platform. https://bit.ly/fiwhatsappmumbai https://t.me/thefirstindiamumbai







BJP to strategise against NC meet
POLLS:MUNICIPALLDF WINS 21 SEATS, UDF C-19
Bhind: The MP police have registered an FIR against three journalists claiming that they ran false and misleading news of an incident in Bhind. Police registered a case against local journalists Kunjbihari Kaurav, Anil Sharma and NK Bhatele after a com plaint by Rajeev Kaurav, Medical Officer. It was alleged that on 15 August, the journalists shared a false video of 76-year-old Gya Prasad Vishwakarma who was being taken to the hospital on a handcart.
INCLUSION OF NON-LOCALS IN VOTER LIST
SKM leaders claimed at some locations, farmers were being stopped from reaching the protest site on Monday Farmers flock to Del to take part ‘Mahapanchayat’in
SKM
New Delhi (Agen cies): Union education minister Dharmendra Pradhan on Monday in vited Australian uni versities and skilling institutions to explore possibilities of setting up campuses in India and areas of collabora tion with their Indian counterparts.“Wehadfruitful dis cussions on further strengthening our coop eration in education, skill development, re search collaborations, innovation and entre preneurship… I am glad that both Australia and India recognise the value of education and innovation in the growth, development and prosperity of our societies,” tweeted Pradhan, who is on a four-day visit to Aus tralia and co-chaired Australia India Educa tion Council’s sixth meeting with his coun terpart, Jason Clare. Clare and Pradhan agreed to establish a working group on trans national education to strengthen institution al partnerships and open new opportunities for collaborations be tween universities of the two countries.Prad han said the two coun tries agreed to expand their cooperation in learning, skilling, and research. In a state ment, the education ministry said Pradhan stressed the research collaboration between the two countries in the areas of Ayurveda, Yoga, Agriculture, etc.
FIR AGAINST 3 JOURNOS FOR RUNNING FALSE, MISLEADING REPORT IN BHIND
MSP
Asuncion: External Af fairs Minister S Jaishan kar has unveiled a bust of Mahatma Gandhi in Paraguay and visited the historic Casa de la Inde pendencia from where the South American country’s guaySA,isregion.ingAmericahisBrazilJaishankarthanmovementIndependencestartedmoretwocenturiesago.arrivedinonthefirstlegof6-dayvisittoSouthaimedatboostbilateraltieswiththeJaishankar,whoonhisofficialvisittoisalsovisitingParaandArgentina.
MUMBAI | TUESDAY, AUGUST 23, 2022 06INDIA www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
New Delhi: Union Min ister of State (Independ ent Charge) Science & Technology; Minister of State (Independent Charge) Earth Sciences; MoS PMO, Personnel, Public Grievances, Pen sions, Atomic Energy and Space, Dr Jitendra Singh today announced 75 “Amrit” Grants for Biotech initiatives in volving StartUps, indus try, academia and re search bodies in inte grated collaboration. The Minister said, DBT-BIRAC 75 Amrit Team Grant Initiative will give a big boost to Prime Minister Naren dra Modi’s call for “Jai Anusandhan” . Jitendra Singh said,
Modi has placed concept of ‘Team India’ before nation: Amit Shah Bhopal (ANI): Home Minister Amit Shah on Monday chaired a Cen tral Zonal Council meet ing in Bhopal where is sues like connectivity, power, sharing of river water and other matters were discussed. Shah said that the Central Zonal Council States are major centres of food grain production and have taken concept of ‘Team India’ of PM Modi to ground & PM has always worked to strengthen the spirit of cooperative federalism.
K’TAKANOTICESTREATMENT:TO577HOSPS
Amit Shah with Pushkar Singh Dhami, Shivraj Singh Chouhan and other dignitaries during the 23rd meeting of Central Zonal Council of MP, UP, Uttarakhand and Chhattisgarh, in Bhopal on Monday.
SKM leaders claimed at some loca tions, farmers were being stopped from reaching Jantar Man tar, a claim denied by the Delhi Police.
New Delhi: Centre has urged SC to end the tenure of the CoA and direct that the day-to-day manage ment of AlFF shall be looked after by AIFF administration led by the acting Secretary General. The final draft will be submitted today and that the mandate of CoA be declared to be over in full from August 23. Centre tells SC that one of concerns of FIFA was that admin istration, management of AIFF should be conducted by a duly elected body. Minister Dharmendra Pradhan with Indian community members in Sydney on Monday.
New Delhi: BJP presi dent J P Nadda on Sat urday spoke to seven heads of missions, in cluding the Russian en voy, his third such inter action as part of the party’s outreach initia tive. The BJP’s foreign affairs wing chief Vijay Chauthaiwale said Na dda conveyed his par ty’s thanks to the coun tries which helped in the rescue of Indian students from Ukraine during the Russian in vasion. He said some members of the Com monwealth of Inde pendent States were among those who at tended the meeting. The Russian envoy also spoke in Hindi, Chau thaiwale sad. Nadda elaborated on the structure, depart ments and growth of the party and also took questions from the en voys. With this, Nadda has so far interacted with 33 foreign envoys as part of the ‘Know BJP’Afterinitiative.themeeting, Na dda tweeted, “It was an honour to meet with del egates from different countries today at our party HQ under the ‘Know BJP’ initiative. Nadda interacts with 7 envoys as part of ‘Know BJP’ initiative
Jammu: National Con ference president Fa rooq Abdullah on Mon day said all opposition parties are against the new law (inclusion of non-locals as voters in Jammu and Kashmir) and they are thinking of moving the court on the“Wematter.will invite the leaders of all national parties to Jammu & Kashmir in September and keep our issues be fore them,” Abdullah told reporters during an all-party meeting at hisAbdullahresidence.also said he had requested L-G Manoj Sinha to call an all-party meeting to dis cuss the bly,”lefttomorrowtogetherpresentferencesceptsidered.However,developments.itwasnotcon“Wedonotacthis.WehavedifbutallpartiesherehavecomerealisingthatwecouldbeoutofourassemAbdullahadded.
New Delhi (Agen cies): Hundreds of farmers from differ ent states started reaching Delhi amid heavy security ar rangements to par ticipate in a ‘ma hapanchayat’ called by the Samyukta Kisan Morcha (nonpolitical) at Jantar Mantar on Monday.
The government has said the Kashmiri migrants will continue to be given the option of voting at their place of enrolment.
23RD MEETING OF THE CENTRAL ZONAL COUNCIL
Bengaluru: Notices have been issued to 577 private hospitals by the Karnataka health department after it received complaints that they collected money – amounting to Rs 18 crore – from the SudhakarMinisterofduringtientschargingwhilegovernmentsimultaneouslyCovid-19pafortreatmentallthreewavesthepandemic,stateforHealthKsaid.
NOTHING WRONG WITH TOUCHING FEET OF ‘MY GURU’ AMIT SHAH: TELANGANA BJP CHIEF Hyderabad: Telangana BJP chief Bandi Sanjay on Monday said there was “nothing wrong” with touching the feet of someone he considered “guru”. Responding to the criticism from the TRS and the Congress of a viral video showing him fetching the shoes of Home Minister Amit Shah at the Mahankali temple.
National Conference president Farooq Abdullah speaking to the reporters after the all-party meet in Srinagar on Monday. The Jammu and Kash mir People’s Confer ence (JKPC) chairman Sajad Gani Lone, however, did not par ticipate in the meeting. “We as a party neither accept the clarification given by the govern ment in totality nor do we reject it. We know the current adminis tration here or in Delhi doesn’t hold political parties in Jammu and Kashmir in high esteem,” Lone said Lone also said that they will sit on a hunger strike in front of Parliament in Delhi if the rights of the people of Jammu and Kashmir are compro mised. He further said that the decision to add non-locals to the voter list is not part of the law.
Union Minister Dr Jitendra Singh launching DBT-BIRAC 75 Amrit Team Grant Initiative to give a big boost to the Prime Minister’s call for “Jai Anusandhan” at DBT office, at CGO Complex, New Delhi on Monday.
“The mahapan chayat is a one daylong peaceful event where we will reiter ate our demands such as a legal guarantee on MSP and cancella tion of Electricity Amendment Bill 2022 among others,” said Abhimanyu Singh Kohar, SKM (non-po litical) member and organiser of the ‘ma hapanchayat’.
14
Jammu (PTI): The BJP has convened a meeting of its leaders here on Monday to chalk out thetheafterhadelectoralvotersinclusiongarrooqferencecalled"all-party"strategy"chalkingsaid.partypartyseniorcalledRavinderinrevisednon-localsueConferencecalledagainst"counter-strategy"athemeetingbytheNationalovertheisof"inclusionofvoters"intheelectoralrollsJammuandKashmir.J-KBJPpresidentRainahasthemeetingofleadersattheheadquarters,aspokespersonHesaidthemeetisbeingheldtoouta"counter-againstthemeetingbyNationalConpresidentFaAbdullahinSrinaovertheissueofofnon-localintherevisedrollsintheUT.TheNCpresidentcalledthemeetingremarksrelatedtoadditionofvotersinrevisedrollsbythe
Pradhan calls Aussie varsities to set up campuses
UT's Chief Electoral Of ficer Hirdesh Kumar raised hackles of the regional parties. The government on Saturday had issued a clarification, saying the reports of a likely addi tion of over 25 lakh vot ers after the summary revision of electoral rolls is a "misrepresen tation of facts by vested interests".TheKashmiri mi grants "will continue to be given the option of voting at their place of enrolment or through postal ballot or through specially set up polling stations at Jammu, Ud hampur, Delhi, etc," it said. Kumar had recent ly announced that the UT was likely to get around 25 lakh addi tional voters, including outsiders, after the spe cial summary revision of electoral rolls being held for the first time after the abrogation of Article 370.
‘WILL SIT ON HUNGER STRIKE IN DELHI IF…’: SAJAD LONE
EXPLORING POSSIBILITIES EXPERTS TO BE HIRED AS FACULTY
PHOTO—FILE ANIBY—PHOTO CRUCIAL READ
Chief Electoral Officer Hirdesh Kumar had said the UT was likely to get around 25L additional voters
Singh announces 75 “Amrit” Grants for Biotech initiatives
Tomorrow, we could be left out: Farooq
75 milestones-drivenbitiousportedgrantsmulti-institutionalinter-disciplinary,wouldbesupforhigh-risk,amresearchideas,col laborative research in all domain specific areas of the biotech sector. Jitendra Singh said, Startups, Industries, Academia and Research Bodies can form Team Science Grant in a Pub lic-Private Partnership mode to avail grant of Rs 10-15 Crore over a period of two to three years for inter-disciplinary, highquality research. The Minister said, in order to address national priori ties to propel India as a global leader in biotech nology, the grants would be broadly provided in the areas of health, ag ribiotech, climate change, synthetic biolo gy and sustainable biore source management.
FARMERS STOPPED FROM ENTERING DELHI, CLAIMS BKU LEADER New Delhi: BKU leader Jagjeet Singh Dallewal Monday claimed that farmers, who were coming to Delhi to protest at the Jantar Mantar in sup port of various demands raised by farm unions, were stopped from entering the Union Territory. “Vehicles were stopped at the Karnal bypass. We are doing this peacefully and our programme is only for a day,” he said, requesting the adminis tration to allow the vehicles to move. SKIPS MEET
MIN INBUSTUNVEILSOFBAPUPARAGUAY CENTRE URGES SC TO GIVE CONTROL TO AIFF FROM COA, AGREED FIFA TERM Mattannur: The Left Democratic Front (LDF) proved its worth again for the sixth consecutive time in Mattannur municipal elections in Kerala. The LDF won 21 of 35 seats in the Mattan nur municipality after the counting results of the elections were declared on Monday. The Congress-led UDF, managed to double the seats in the region by winning 14 seats.
FIGHT FOR











Inflation expected to drop below 6% by March 2023
MSME LENDING
TOISSUANCESBANKS’ROADBLOCKBULLETDELHI-VARANASITRAINHITSAT-1BONDLIKELYDECLINE
ADANI SHARESPOWERCLIMB 5 PER CENT ` ENDS FLAT AT 79.84/US DOLLAR
New Delhi (Agencies): Reli ance Jio is the sole telco to have gained revenueexpenselargelyfirstinsharemarket(RMS)thefiscalquarter,attheof loss-making Vodafone Idea (Vi) which ceded further ground to its stronger rivals, analysts said. Jio gained 30 basis points sequentially, tak ing its RMS in the fiscal first quarter to 43.3% while Bharti Airtel’s was flattish at 36%.
New Delhi (PTI): The pro posed high-speed railway corridor between Delhi and Varanasi has hit a roadblock with the Rail way Board rejecting the feasibility report on the project citing multiple curves along the route which will not be suitable for a bullet train to run at 350 kmph. The decision was taken at a meeting held by Railway Board Secretar last week to re view the bullet train pro ject. The feasibility study report was presented by the NHSRCL.
BANKS ISSUE MORE CDs TO SECURE CHEAP FUNDING
New Delhi (Agencies): By the end of this fiscal, In dia’s headline retail infla tion is predicted to decline below 6%, ending the cur rent cycle of rate increases, analystsAnalystspredicted.expect the RBI to increase repo rate by 50–60 basis points by De cember taking it to 5.9%.
TARUN BAJAJ GETS ADDITIONAL CHARGE AS SECY IN MCA
India hands over 21K tonnes of urea to Sri Lanka
business BRIEFS
McLAREN TO FORAY INTO INDIAN MARKET THIS YEAR New Delhi (PTI): British luxury carmaker McLaren Automotive on Monday said it is set to enter Indian market this year with the opening of its first dealer ship in Mumbai in October. The Indian market would be the automaker’s 41st global territory. The opening of the first retail outlet in Oct is a part of company’s global expansion plans and growing presence in the Asia Pacific region.
*Rates till the edition went to print.
While Rural India has tak en the lead in the growth of MSMEs with several wom en entrepreneurs, the jour ney has been riddled with a series of challenges and problems. One of the big gest issues afflicting the MSME sector is the Lack of Formal Credit. In India, access to formal credit is one of the biggest challenges faced by MSMEs with the credit gap pegged at around INR 25 trillion. Hence, these organizations opt for informal credit sources that charge high rates of interest. Hence, the cost of borrowing increas es which acts as a deterrent for MSMEs to access credit and hampers their growth. While the reasons can be numerous, one of the big gest roadblocks faced by fi nancial institutions in ex tending loans to MSMEs is their (MSMEs) informal structure. Most banks and lending institutions offer loans to businesses by ana lyzing their credit score, income-tax returns, bal ance sheet, and banking history. MSMEs find them selves lacking here since most of them are unstruc tured and lack formal docu mentation and/or good banking habits. As of July 29, 2022, around 9.8 million MSMEs were registered on the gov ernment’s Udyam Registra tion Portal. With policies favoring this sector and awareness programs, the government is making at tempts to formalize this unstructured sector so that they can avail of credit and various other facilities. The role of Small Finance Banks In 2015, when the RBI is sued licenses to 10 entities for setting up Small Finance Banks in the country, it also mandated them to work with the un-served and the under-served population of the country. The government also defined Agriculture and MSMEs as priority sectors and made it mandatory for SFBs to extend at least 75% of loans to these sectors.
New Delhi (Agencies): Revenue secretary Tarun Bajaj received additional charge of the post of Sec retary, MCA with immedi ate effect on Monday. This comes a few days af ter the appointment of Rajesh Verma as Secre tary at BhavanRashtrapatitoPresident Mur mu. Earlier this year he was given the additional charge of Economic Af fairs Secretary till August 12. It was the second time in this calendar year that Bajaj was given the additional charge of eco nomic affairs secretary.
New Delhi (PTI): Indian banks have increased their fundraising activity through the issuance of certificates of deposits, as funding in the banking system continues to con tract, analysts said. “Banks are not raising de posit rates, as they are able to get funds easily from money market by is suing CDs, and that too cheaply, and they may continue to opt for this route of fundraising for next few weeks,” IDBI Bank said in a note.
RISE IN MSME INCLUSION z As of July 29, 2022, around 9.8 million MSMEs were registered on the govt’s Udyam Portal. z With policies favoring this sector and awareness programs, the govt is making attempts to formalize this unstructured sector so that they can avail of credit & other facilities.
“If the growth trend con tinues, we have no reason to believe it won’t,” ACMA President Sunjay Kapur said when asked if the sec tor could see double-digit growth in the current fiscal as well. “Everything we see is pointing in the right di rection. Demand is good, manufacturing is looking strong. Unless something happens that we are not in control of, like a pandemic, lockouts or a global reces sion, it is in the right direc tion,” he added.
New Delhi (PTI): Shares of Adani Power on Monday jumped 5% after the firm said last week that it will acquire DB Power at an enterprise value of `7,017 crore. The stock climbed 5% to settle at `432.80 -- its highest permissible limit for the day -- on the BSE. At the NSE, it jumped 4.98% to `432.50. In traded volume terms, 50.59 lakh shares were traded at the BSE and over 2.45 crore shares at the NSE during the day.
New Delhi (Agencies): The hydrocarbon-onshore division of L&T’s energy business has secured a large contract from Indian IOCLCorporation.Oilisimple menting the Panipat refinery expansion (P-25) project to enhance refining capacity from 15 to 25 MMTPA to meet the growth in demand of petro leum products and to increase their profitability and competi tiveness in the long run.
Amar Bahl, Head of Secured Business Loan (SBL), AU Small Finance Bank.
MARKETS FALL FOR 2nd DAY; SENSEX, NIFTY DOWN OVER 1% Mumbai (PTI): Equity benchmarks continued to remain weak on Monday with the Sensex and Nifty falling over 1% each, dragged down by bank stocks and negative global market trends. The 30-share BSE Sensex, which had started the trade on a weak note, tumbled 872.28 points or 1.46% to settle at 58,773.87. The broader NSE Nifty declined 267.75 points or 1.51% to finish at 17,490.70. From the Sensex pack, Tata Steel, Asian Paints, Larsen & Toubro, Wipro, UltraTech Cement, Bajaj Finance, Bajaj Finserv, Tech Mahindra, Kotak Ma hindra Bank and Axis Bank were the major lag gards. On the other hand, ITC and Nestle India ended higher. Equity investors poorer by over `6.57 lakh crore in two days New Delhi (PTI): A de cline in equities for two sessions has eroded inves tors’ wealth by more than ` 6.57 lakh crore. In two straight sessions, the benchmark index has tanked 1,524.13 points or 2.52%. The weak trend in the broader market have pulled down the market capitalisation of BSE-list ed firms by ` 6,57,758.04 crore to ` 2,73,95,002.87 crore (over ` 273.95 lakh crore) in two days.
Auto component industry looks to maintain double digit sales growth this fisc
MUMBAI | TUESDAY, AUGUST 23, 2022 07www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai- I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia Commodity Price Change % Chg GOLD 51,679.00 315.00 0.60 (Per 10g) SILVER 55,416.00 635.00 1.14 (Per 1kg) COMMODITIES Currency Price Change % Chg USDINR 79.84 0.00 = 0.00 GBPINR 94.3129 0.3604 0.3804 CURRENCIES
LIC HOUSING FINANCE, BAJAJ HOUSING FINANCE HIKE LENDING RATES BY 0.50% OTHER STORIES Mumbai (PTI): The issu ance of Additional Tier-1 (AT-1) bonds by banks is likely to more than halve to `20,000 crore this fis cal compared to the alltime high amount of `42,800 crore raised in FY22. AT-1 bonds are those debt instruments without a terminal maturi ty date. In FY22, a majori ty of the funds raised through the instrument were to refinance bond is sues done in FY17. Major ity of the bonds have a call option in the fifth year, resulting in the significant jump in new issuances which are basically for re financing the earlier obli gations.
L&T WINS INDIANCONTRACTLARGEFROMOILCORP
Analysts expect RBI to increase repo rate by 50–60 bps by Dec taking it to 5.9%
New Delhi (PTI): The auto component industry ex pects to maintain doubledigit sales growth in the current fiscal after having reported its highest-ever turnover in FY22, with de mand expected to remain robust.Asper the Automotive Component portedAssociation,Manufacturersthesectorreaturnoverof ` 4.2 lakh crore last fiscal, a growth of 23% over 2020-21, as passenger and commer cial vehicle production in creased by 20% and 30% respectively due to in creased demand and fewer supply chain disruptions.
“We expect the RBI to de liver two 25 bps rate hikes at the September and De cember meetings, taking the repo rate to 5.90%,” said Rahul Bajoria, chief India economist at Bar clays.The RBI has so far in creased repo rate by a total of 140 basis points since May. In the recently re leased minutes, the MPC members pointed out that the inflation though com ing down due to modera tion in food prices still fac es risks from volatile exter nal conditions. Some ana lysts predicted that a steep 50 basis points increase in repo rate was also possible can’t be ruled out, if the (US) Fed delivers another 75 bps hike,” Gaura Sen Gupta, India economist at IDFC First Bank said in a note. “In our view, the RBI is effectively being cau tious in its policy approach, especially ahead of the winter cycle, when energy prices could be volatile,” Bajoria of Barclays said. Crude supplies could tighten again when Euro pean buyers start seeking alternative supplies to re place Russian oil ahead of European Union sanctions that take effect from De cemberNomura5. retained its ex pectations of terminal repo rate being at 6.00% with 35 bps and 25 bps hike in Sep tember and December re spectively.“Whilethe minutes con firm that more hikes are coming, the terminal policy rate is not too far away,” analysts Sonal Varma and Aurodeep Nandi said.
Driving financial inclusion & serving un-served and under-served Amar Bahl New Delhi (FIB): In last few decades, the Micro Small and Medium Enter prises (MSME) sector has evolved into one of the most vibrant sectors in the Indian economy. There are more than 63.3 million MS MEs contributing to around 6% of the manufac turing GDP and 24% of the GDP from service activi ties and employing over 110 million people across In dia. Further, MSMEs con tribute to around 45% of the country’s exports.
FORD CUTTING 3K JOBS IN BID TO LOWER COSTS Detroit (AP): Ford Motor Co. is cutting about 3,000 white-col lar jobs as it attempts to lower costs and make the transition from internal combustion to electric vehicles. Leaders of the Dearborn, Michigan, automak er made the announcement Monday in a company-wide email, saying that 2,000 fulltime salaried workers would be let go along with another 1,000 contract workers. The cuts represent about 6% of the 31,000 full-time salaried work force in the U.S. and Canada.
Mumbai (PTI): The rupee recovered early losses to close flat at 79.84 (provisional) against the US dollar on Monday. At the interbank foreign exchange market, the local currency opened weak at 79.90 and moved in a range of 79.78 to 79.92 during the session. It finally settled flat at 79.84 against the US dollar.
Colombo (PTI): India on Monday handed over 21,000 tonnes of fertiliser to Sri Lanka under a special sup port programme which will help farmers in this country and help bolster bilateral cooperation for food security, the second such assistance in recent months.“Adding to the fragrance of friendship and coopera tion. High Commissioner (Gopal Baglay) formally handed over 21,000 tonnes of fertiliser supplied under India’s special support to the people of Sri Lanka,” the Indian High Commis sion said in a tweet. This follows 44K tonnes supplied last month under Indian support totalling about $4bn in 2022,” it said. “The fertiliser will contrib ute to food security and support the farmers of Sri Lanka. It demonstrates benefits to the people from close ties with #India and mutual trust and goodwill between #India and #lan ka,” the mission tweeted.
JIO ONLY TELCO TO GAIN RMS IN Q1 AT VODA IDEA COST
Mumbai (PTI): Mortgage lenders Bajaj Housing Finance and LIC Housing Finance on Monday announced a 0.50% hike each in their lending rates. The revisions come amid a rising interest rates scenario, which has seen the RBI hiking its key lending rate by 1.40% since May. Bajaj Housing Finance hiked its rate by 0.50%, and the lowest priced product for the salaried and profes sional applicants will be 7.70% now. LIC Housing Finance has increased its prime lending rate (LHPLR) by 0.50% and the new interest rates on home loans will now start from 8% as against 7.50% previously.














MUMBAI | TUESDAY, AUGUST 23, 2022 082ND FRONT www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia As soon as you make a decision to quit doing below average work, you will achieve excellence. — Dr Jagdeesh Chandra, CEO & Editor-in-Chief, First India
First India Bureau Mumbai: The Maha rashtra government on Monday stateseveralsiveimpactedthousandscialsionimplementedformallythedecitodisbursefinanassistancetooffarmersbytheexcesrainfallwhichhitpartsoftheinJuly.
Mumbai: BJP lead er Mohit Kamboj on Monday created a flutter in political circles when he tweeted that he was studying the busi ness of Baramati Agro Ltd, a firm headed by Rohit Pa war, the grandnephew of NCP chief Sharad Pawar. “Baramati Agro Ltd is a case study for start-ups! I have per sonally started stud ying achievements of this company! Will share brief study soon which will help youth to understand success story behind this!” Kambok said, tagging Pawar’s twit ter handle @RRP Speaks. Rohit Pawar is an MLA from Kar jat Jamkhed assem bly constituency and the firm’s CEO. The sarcasm in the tweet was not lost in political circles which saw the tweet in the context of another se ries of tweets by Kam boj a few days ago. He had said that another “big” NCP leader would join par ty colleagues Anil Deshmukh and Nawab Malik in jail, and had also demand ed an investigation into the irrigation scam in which allega tions were made against NCP leader Ajit Pawar. An AntiCorruption Bureau inquiry was ordered under the Fadnavisled BJP government in 2014. However, then-ACB DirectorGeneral Param Bir Singh had submitted a report giving Ajit Pawar a clean chit un der the MVA regime.
He is under the scanner for money laundering in Mumbai chawl redevt case
Sharad Pawar Govind Pansare
REAL ESTATE
PREDICTION?
These sales figures are even more remarkable if we consider that it is mainly end-users who are driving luxury housing sales today. Even though the typical buyers in this budget segment were not as impacted by the pandemic as the rest, high networth individuals are cost-conscious. Discounts by developers made luxury properties very attractive for these buyers and NRIs have also been snapping up luxury homes in India because of the favourable exchange rate.
Farmers from rain-fed areas will be provided input subsidy at the rate of Rs13,600 per hectare for a maximum limit of three hectares of land, those from ir rigated areas will be provided aid at the rate of Rs27,000 per hectare for a maximum of three hectares of land and, for multi-crop farm land, the financial assistance of Rs36,000 per hectare for three hectares of land.
Bombay HC clubs ‘defamatory posts’ FIRs against Chitale, Bhamre
Court extends Sena MP Raut’s judicial custody till Sep 05 Sanjay Raut gestures to supporters outside Arthur Jail Road after the court hearing on Monday.
Kamboj had recently tweeted saying that another “big” NCP leader would join party colleagues Anil Deshmukh and Nawab Malik in jail. PHOTO
Flood-hit farmers to get `13-36K per ha
Sales of luxury homes in MMR see 12% jump post pandemic
Mohit Kamboj’s tweet on Baramati Agro creates flutter
First India Bureau Mumbai:
A decision to double the financial assistance compared to existing disaster relief norms was taken at the cabinet meeting on August 08. Accordingly, the farmers from rain-fed areas will be provided input subsidy at the rate of Rs13,600 per hectare for a maximum limit of three hectares of land. The existing rate envis ages Rs6,800 per hectare for a maximum of two hectares of damaged land, according to the government resolution (GR) issued on Monday. The GR said for farm ers from irrigated areas will be provided aid at the rate of Rs27,000 per hectare for a maximum of three hectares of land. The existing rate for farmers from irri gated areas envisages Rs13,500 per hectare for a maximum of two hec tares of land. For multi-crop farm land, the financial assis tance of Rs36,000 per hectare for three hec tares of land compared to the existing Rs18,000 per hectare for a maxi mum of two hectares. The Maha Vikas Aghadi government had announced Rs10,000 per hectare for rain-fed crops, Rs15,000 per hec tare for irrigated land and Rs25,000 per hectare for multi-crop land in OctoberSpeaking2021.to reporters in Vidhan Bhavan, State Congress chief Nana Pa tole said that the aid an nounced by the state for flood-affected farmers is insufficient.“Thestate govern ment is cheating the public by saying that it has announced more compensation than the NDRF norms. NDRF norms are outdated. Now, the prices of ferti lizers, seeds, pesticides have also increased. The aid announced by the government is very less compared to this infla tion. The Union govern ment has also left farm ers in the lurch. Our demand is that Rs75,000 per hectare should be given for non-irrigated land and Rs1.5 lakh should be given for irri gated and horticulture land,” Patole said.
The Bombay High Court on Mon day clubbed all the First Information Re ports (FIRs) lodged against Marathi actor Ketaki Chitale and student Nikhil Bhamre. Both are ac cused of uploading de famatory posts against Nationalist Congress Party (NCP) President Sharad Pawar at the police station where the first case was lodged against them. There are 22 FIRs reg istered against Chitale and six against Bhamre. With the HC order, all the FIRs against Chitale have now been clubbed with the first FIR lodged against her at Kalwa po lice station in neigh bouring Thane district. All FIRs against Bhamre would now be clubbed at Naupada police station in AThane.division bench com prising Justices NM Jamdar and NR Borkar took note of a Supreme Court order which said when there are multiple FIRs, then the first case lodged can be considered as the main FIR and the remaining cases can be considered as witness statements in the first FIR.The bench also di rected the state and all complainants to file their affidavits, reply ing to other prayers made in the petitions filed by Chitale and Bhamre seeking com pensation for wrongful arrest and for it to be declared as illegal.
First India Bureau Mumbai: The Maha rashtra Crime Inves tigation Department (CID) has handed over documents on the murder of activ ist Govind Pansare to the Anti-Terror ism Squad (ATS) for further probe into the case, said an ATS official on Monday. The Bombay High Court had earlier this month transferred the investigation into the case to the ATS. Pansare was shot at on February 16, 2015 in Kolhapur and suc cumbed to his injuries on February 20. A special investiga tion team (SIT) of the CID was earlier conduct ing the investigation into the case and had ar rested a few people. Last month, the activ ist’s kin had filed an ap plication in the high court seeking for the probe to be transferred to the ATS, claiming that the SIT has not been able to make a break through in the case yet. The SIT has now handed over to the ATS documents of the inves tigation into the case so far, said the gatingwillofsaid.aPuneAccordingly,official.theATSunithasinitiatedprobeintothecase,heAsuperintendentpolice-levelofficialbethechiefinvestiofficer,headded.
Affordable-housing segment has witnessed a 7% dip since 2019
Maha CID hands over docs on Pansare murder to ATS
NEW FIGURES
—Anuj Puri, Chairman, Anarock Group
Maha govt implements cabinet decision taken on Aug 08; Cong says compensation ‘not enough’
Thousands of farmers were affected by the excessive rainfall which hit several parts of the state last month.
—FILE PHOTO
IN THE COURTYARD
—FILE
First India Bureau Mumbai: The sales of luxury homes in the Mumbai Metropolitan Region (MMR) have shot up from 13% in 2019 to 25% in the first half of 2022, while the sales of homes of less than Rs40 lakh have witnessed a dip by 7% in top seven cities, a research report by Anarock released on Monday said. The report said ap proximately 1.85 lakh units were sold in the top seven Tier-I cities in the first half of 2022, and about 14% or 25,700 units were luxury homes in the post-pan demic scenario. Com paratively, 2.61 lakh units were sold in calen dar 2019, but just 7% or approximately 17,740 units were in the luxury category.Interms of overall sales share, MMR’s lux ury housing sales share increased from 13% in 2019 to 25% in the first half of 2022, which re mains the highest among the top seven cit ies. Approximately 13,670 luxury homes were sold in the first half of 2022. In the Na tional Capital Region, the sales share rose from 4% in 2019 to 12% in the first half of 2022, selling approximately 4,160 units in this seg ment.Encouraged by the rise in demand for luxu ry offerings, developers have stepped up new supply in the luxury segment, launching over 28,000 units priced more than Rs1.5 crore across all seven cities in the first half of 2022. Ap proximately 28,960 luxu ry homes were launched in calendar 2019. The affordable-hous ing segment, involving units priced Rs40 lakh or less, has witnessed a dip from 38% in 2019 to 31% in the first half of 2022. said.half2019byinsalesinsawofeconomicencebecausesignificantlyaffordable“Post-pandemic,housingwasimpacteditstargetauditookthebiggesthit.Intermscities,Hyderabadthemaximumdipaffordablehousingshare—from23%2019to6%,followedChennaifrom52%into36%inthefirstof2022,”thereport
—PHOTO BY BHUSHAN KOYANDE First India Bureau Mumbai: A special court in Mumbai on Monday extended the judicial custody of Shiv Sena MP Sanjay Raut till September 05 in a money laun dering case linked to alleged irregularities in the redevelopment of a Mumbai ‘chawl’. Raut, 60, was arrest ed by the forsenttheED’sGoregaon.ment)PatradevelopmentirregularitieswithgustDirectorateEnforcement(ED)onAu01inconnectionallegedfinancialinthereoftheChawl(rowteneinsuburbanAfterbeinginthecustodyinitially,Senaleaderwastojudicialcustody14daysonAugust08.OnMonday,Special Judge MG Deshpande, hearing cases related to the Prevention of Mon ey Laundering Act (PMLA), extended Raut’s custody till Sep tember 05. The ED told the court that its probe into the case was still on. The agency’s investi gation pertains to al leged financial irregu larities in the redevel opment of the Patra ‘chawl’ and related fi nancial transactions involving Raut’s wife andRautassociates.hasdenied any wrongdoing.
“What is the state gov ernment’s stand on these prayers made in the peti tion? Both the govern ment and the complain ants shall file their affi davits,” said the court while posting the matter for further hearing on September 06. Chitale and Bhamre were arrested in May this year and released on bail in June. Chitale had been ar rested for sharing a Marathi verse on Face book, while an alleged ly objectionable tweet against teh NCP chief.








DISTRESSED DENIM JACKET
FLARED JEAN SHORTS
SKINNY JEANS
By applying several tech niques directly at the manu facturing facility, the process of distressing jeans or any other denim aims to give the garment a vintage and dam aged look. However, there are some simple DIY methods available today to use if you want to give your worn-out denim item a distressed effect.
City First offers you timeless styles of denim that are ap propriate for all occasions.
ur lives must revolve around denim if there is only one type of fabric. This is a universal truth that is true regard less of time and place, society, or socioeconom ic standing. Because there are so many options available, we can’t help but indulge in a new type of denim whenever we go on a shopping spree. It makes little difference that the tags will continue to pro trude from them in our cup boards for months because we won’t be wearing them any time soon. Life is too short to spend time wearing only one style of denim, and buying them is where the pleasure is.
We all have a favourite pair of black skinny jeans that es sentially match everything we own, and we all swear by them. As the name implies, skinny jeans are skin-hug ging and just hug you. These are the best option available for showcasing the ideal traditional denim jacket, of ten known as the trucker jacket. The fabric used in this style of denim jacket is strong and durable.
The A-line form of these shorts allows your thighs City
appropriateoffersFirstyoutimelessstylesofdenimthatareforalloccasions O SHUBHANSHI PATHAK cityfirst@firstindia.co.in MUMBAI, TUESDAY, AUGUST 23, 2022
www.firstindia.co.in I https://firstindia.co.in/epapers/mumbai I twitter.com/ thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia 09














OCTOBER 23 - NOVEMBER 22
perimentedwith.In2022,Spain’sgovernmenthasbeenap plauded globally for its new policy of providing paid menstrual leaves. Beating the obsession with hustle culture will require a joint effort of employees and employers. It starts with small changes in your daily routine like prioritising 8 hours of sleep, proper nutrition, and exercise and setting reasona ble targets at work to curb pro fessional cynicism and en hance efficacy. This may be complemented with regular mental health checkups per formed by a registered mental healthLivingexpert.ina world of uncer tainty intensified by economic recessions and unforeseen pandemics, productivity will continue to remain the cur rency of careerist success. However, the silver lining lies in the hope that more young professionals will gradually break the social conditioning of glorifying overworking and start living life as a whole.
AUGUST 24 - SEPTEMBER 23 Time is favourable as your real investmentsestatestart giving handsome returns. An official trip is likely to keep you tied up. Your help and support to a youngster will help boost his or her self-confidence. Those trying to achieve their professional targets will succeed. An earning opportunity may come.
DECEMBER 23 - JANUARY 20
SCENARIO:CURRENT THE POST RAMIFICATIONSPANDEMIC
Cancer
Virgo
Meeting someone new is likely to enlarge your social circle. Something you had wanted for the home may be gifted to you. Your ideas will work on the professional front and speed up the progress. Your financial condition is not bad, but you do possess the potential to earn much more.
You will be able to get the study stream you desire on the academic front. Going is likely to get better on the professional front. Purchasing a new car or an expensive appliance is indicated. Children can keep you entertained. The day is favourable to get a project underway.
Change of diet will improve health. A difference of opinion may pit you against a family elder. Those compelled to travel are likely to find interesting company. Some of you will be able to add to your wealth and even plan to buy property. You are set to enjoy the exclusive company of people.
Those in the financial sector can hope to start making profits. You may think up ways of improving your health. A major renovation work may be undertaken at home. A journey is likely to take you down the memory lane. Travel stars look bright for some, especially for overseas travel.
Libra SEPTEMBER 24 - OCTOBER 22
Sagittarius
Things move positively on the academic front and encourage you to give your best. Good man management will help you in completing a project or assignment in time. Travelling with your near and dear ones to the countryside will prove immensely fulfilling. DAY Horoscope by Saurabbh Sachdeva CULTURE
YOUR
Whatsapp Subscription Subscribe “First India” Daily E-News Paper For Free On Whatsapp To Receive the Most Exclusive News from the Power Corridors of MAHARASHTRA. MILLENNIALS & GEN Z CAUGHT UP IN BURNOUT BLACKHOLE HUSTLE
JUNE 22 - JULY 23
Switching to healthy foods will be the key to remaining fit and active. A family issue may need to be deliberated upon, so that it does not disturb domestic harmony. An out of town invitation will tempt some to undertake the journey. Spirituality may bring a special meaning to your life.
T GARGI ROY (She is a Neuroscience Postgraduate student at King’s College, London.)
Aquarius
Gemini MAY 21 - JUNE 21
However, the tables have some what turned after the gruesome Covid-19 episode. Gripped by the fear of losing loved ones and our own lives, job lay offs, made many of us question our sense of self-worth beyond our net worth. Centre for Monitoring Indian Econ omy (CMIE) produced data stating that the num ber of employees, both salaried and non-salaried, fell from 398.14 million in March to 390.79 million during the second wave. This has low ered the morale of many who aligned their identity solely with work. Though this has not marginalised the hustle mania, it has given rise to a greater de mand for job flexibility and work-life balance prioritising mental and physical health. Psychologist, Dr Nikitha Harish, advocating this idea of work-life balance, said, “Perseverance without selfpreservation is detrimental. Self-care and mental health are instrumental for one to re alise their true potential.” Re search held at the City Univer sity of New York (CUNY) states that the immediate af termath of negative hustle culture is much more than employee burnout. Employees often hesitate to communicate their exhaustion in fear of be ing deemed as replaceable, therefore compromising their job security, if access to an equal or better opportunity is unavailable.Theideaof a 40-hour work week or a 4-day work week is gaining traction in many countries like Iceland and Bel gium and is being widely ex
NOVEMBER 23 - DECEMBER 22
FEBRUARY 20 - MARCH 20
TRACING THE ROOTS
The world’s most coveted busi ness magnate and investor once tweeted, “Nobody ever changed the world in 40 hours a week.” While this ignited a zeal in many, it also malevo lently influenced profession als to keep going the extra mile often undermining the appall ingThisconsequences.cultdates back to the Industrial Revolution of the 18th century. However, it cur rently rose to fame due to the Great Recession of 2008 when the younger workforce lost its faith in the stability of 9 to 5 jobs. This led to normalising working harder, quicker, and longer, and also marked the rise of the “gig economy” on social media where the idea of multiple side hustles seemed to be the most lucrative way to gain financial independence sooner. The gig economy has been known for its perks for a long time but owing to the growing obsession with achieving more, there was a surge in the number of work freak free lancers who were working overtime leaving no crumbs. A CNBC report dated February 2020 stated that the number of gig workers hiked by 15% since 2010. That is about six million more work ers involved in the gig econo my than in 2010. Professionals who had not gotten involved with freelancing started aim ing for more work hours and faster promotions in their companies leading to a tight rat race.
Leo JULY 24 - AUGUST 23
Pisces
Scorpio
APRIL 21 - MAY 20
Capricorn
A trip with friends will be both enjoyable and therapeutic. Family life will remain stable and provide you a firm foundation from where to venture forth. This is the best time for launching your ideas at work. Money multiplies through excellent financial planning.
cianaaspiresgreepursuingPushpawenty-year-oldBhargav,adeinNutrition,toworkasclinicaldietisoon.The day is not far when she will be formulating diet charts and improving the lives of countless patients. She believes she has to hustle her way to the top, from sleepless nights pre paring for competitive ex ams and caffeinated extra hours to focus on her culi nary side gig, she leaves no stone unturned. Amid the grind, she almost for got how she suspended her basic needs and began contradicting what she preaches i.e. a healthy bal anced lifestyle. Being a workaholic, popu larly called a hustler in 2022, is gaining worldwide prominence among Mil lenials and Gen Z. We have redefined success as an endless journey of achieving more and more. Thanks to the Internet gu rus, promising to teach productivity hacks and celebrity-preneurs flaunt ing their luxuriant life ornamented with fancy cars, picture-perfect holi days, expensive vegan di ets, etc. A 100% is too less of a count, this culture de mands 1,000% and more of your devotion to work and shows you a promis ing future of a six-plusfigure salary, corporate status and passive income due to around-the-clock grind. There’s no denying that these dreams become a reality but at a grave ex pense to you.
10ETC MUMBAI | TUESDAY, AUGUST 23, 2022www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia facebook.com/thefirstindia I instagram.com/thefirstindia RIYA, Model DAY!THEOFFACE
JANUARY 21 - FEBRUARY 19
Businesspersons are likely to do good business today and earn well. The day proves excellent for you, both personally and profession ally. Appease someone in the family to have your way.You may have to put your foot down against a trip you are reluctant to go on.
Some additional perks can be expected by those in the private sector. An enjoyable outing is on the cards for some. Family life will cruise along smoothly and give you time for rest and recoup. A promotion or a prestigious appointment is in store for those in a government job.
Taurus
Your professionalism is likely to be praised at work. unexpectedSomeone’sarrival at home threatens to upset your personal plans. Seeing new places, meeting new people is in store for some. There is nothing that can go wrong today, except things involving property.
Aries MARCH 21 - APRIL 20
You are likely to experience a positive phase in your existence. Favourable decision can be expected regarding a piece of property under dispute. Those in tourism and hospitality sectors will find new opportunities knocking at their door. You may take the initiative of organising a family gathering.









Anu Ranjan with models and showstopper Kapil Sharma Shashi Ranjan, Shabana Azmi, Kapil Sharma, Ramesh Taurani and Anu Ranjan Vishal Kotian and Ashish Tiwari Payal Rohatgi
ETC www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia facebook.com/thefirstindia I instagram.com/thefirstindia MUMBAI | TUESDAY, AUGUST 23, 2022 11
Kapil Sharma, Pooja Batra and Roshni Walia Aditya Seal and Anushka Ranjan Kapoor Akshara Haasan Sudhanshu Pandey
he toteryanothercreatedmovementbleunstoppa‘Beti’yetglitoccasionputacross the message of girl child education. The Beti Fashion Show, a movement, an initia tive by Anu Ranjan, Founder of NGO Beti, was held on, Sunday, 21st August 2022 at JW Marriott Hotel, Juhu, Mumbai.Likeevery year, this mega event saw the who’s who of the en tertainment industry walking the ramp as well as cheering their best as an audience. The show was attend ed by many TV, film and social media per sonalities.Theshow was at tended by Shabana Azmi, Poonam Dhill on, Akshara Hassan, Payal Rohatgi, Pooja Batra, Akansha Ran jan, Suzzane Khan, along with Gulshan Grover, Satish Shah, producer Ramesh Taurani, Nikhil Dwivedi, Vishal Koti an, Arsalan Goni, Ni kita Rawal, Lisa Mishra, Zaeden, Mo hit Rai, Isha Bhansali, Rahul Gangwani and many celebrities graced this event with their presence. Whereas Aditya Seal with wife Anush ka Ranjan, Kapil Sharma, Harsh Ra jput, Mohd. Nazim, Amit Dolawat, Sud hanshu Pandey, Abhi jeet Sawant, Gautam Rode, Karanvir Shar ma, Mahir Pandhi, Usaamah Siddiqui and the super models dazzled in the andwithandalsolargertivewordsHisenblackmallowprenewearingramp.hispilcomedyBhatia.byandShiegraphedwasthasignercollectionsplendidbydeSiddarTytler.TheshowchoreobyLoboanchoredKashyataActorandkingKaSharmamarkeddebutontheHewasseenablackneomeshMarshjacketwithvelvetandgoldembroideredpants.presenceandkindfortheinitiamadetheeventthanever.ThegirlsofBetigracedtherampwerehonouredimmenseloveappreciation.
WithFCELEBRATINGASHIONACause!
ASHISH TIWARI cityfirst@firstindia.co.in T













Highly anticipated album: Man Of The Moon E very episode of Koffee With Karan somethingbrings new to the couch; everything is a treat for Bollywood lovers from the pairings to the goss to the equa tions. Now, after some videolightvoustioushidepisode.couchKapoorAdvaniSinghvitedKaranlatestepisodesblockbusterintheseason,hasinhisKabirstars,KiaraandShahidtogracetheinthelatestWhileShaisbeinghisflirtaandmischieself,thehighofthepromowasKiara’s confession about her relationship with her Shershaah costar, Sidharth Mal hotra. During friendsMorenitelyplied,looseThisingfriends?”“Sothing.”ingwhetheraskedsession,question-and-answerthewhenKarantheactresssheisdenyherrelationshipwithKiaraAdvani,theactresscoylyreplied,“IamnotdenyingoracceptinganyKaranasked,you’llareclosewhilemakthequotessign.timeKiaraletandshylyre“Wearedeficlosefriends.thancloseactually.”
S hama Sikander is one of the latest entrants to parade the street of the stunning island city of Mykonos and you have been warned, the tempera tures only go higher from here. The actress was recently in Bangkok for a holiday and kept her Insta family updated. Keeping up with the tra jectory, she spammed her fans with pictures from her trip. Amid the azure-coloured coastline, Shama Sikander’s vibrant touch is all one needs to get a holiday rolling. In one of the photos, Sha ma is seen seated on a beach chair on a sunny afternoon. She is pictured wearing a rust-coloured swimsuit which has narrow straps and a deep neckline. Shama accessorized the outfit with multiple neck laces, stacks of bracelets and a pair of earrings. While her hair was worn in tousled waves, she held a glass in her hand and captioned the photo, “The tans will fade but the memories will last forever. This was indeed a day worth living for”. fect fit for all moods. Guru Randhawa says “Man of the Moon is spe cial because I have dedi cated not only a year to this album but also a lot of hard work, and re search and I have given it my all. When Bhushanji and I discussed this al bum, the way the two of us reverberated off each other with concepts, compositions and ideas, it was decided then and there that this will surely be a hit. This is my big gest project yet and we have catered to the glob al audience with Man Of The Moon. The audio of all 7 tracks of the al bum has been released today and it’s surely go ing to be a dhamaka!” Man Of The Moon is definitely a treat for the audience with its global soundscape and effer vescent tunes. The only question now is when will we get to see our fa vourite singer in the videos of these songs? he young ac tor is an avid reader of hasbookslogicalmythoandalso read, many differ ent andcomespletesharesmythologyherandMahabharatationsinterpretaofTheRamayana.TalkingaboutfascinationwithSharvari“Iamacomgeekwhenittomythologyitwouldbean in a mythological film. She further shares “My father used to narrate the Mahab harata to me every night when I was a child and I used to be fascinated with the tale. Growing up then, I voraciously started reading different books on the mytholo gies of India. I have read varied renditions of our Indian folklores and different charac ter books which has helped me under stand the many layers, situations and emo tions which they un derwent.”Shealso adds “Women in my thology are femi nine yet fierce and I would love to play a character that has such a powerful yet complex personality. I am manifestingmythologya FILM T ADITI CHAVAN cityfirst@firstindia.co.in
Netizens
12 MUMBAI | TUESDAY, AUGUST 23, 2022www.firstindia.co.in I www.firstindia.co.in/epapers/mumbai I twitter.com/thefirstindia facebook.com/thefirstindia I instagram.com/thefirstindia CITY BUZZGETSTAYVACCINATEDMASKED
G lobal sensation Kylie Jenner is fashion’s favourite child. Sridevi has an avant-garde vibe and she set new fashion goals over the years and from the looks of it, celebrities in the west are taking notes from her. Well, the world’s most popular and snazzy family - the Kardashians and Jenners - are taking inspiration from our own late superstar who set benchmarks with her chic looks and sassy ensembles. Sridevi fans took to social media to share old photos of the late actor in a silver out fit to show how Kylie Jenner’s recent look was inspired by the legendary Indian ac tor. Fashion-based Instagram page, Diet Sabya, was one of the first ones to point out that Kylie’s look bore similarities to an out fit worn by Sridevi. It shared a post with a collage of Kylie and Sridevi’s looks, which said, “When Bollywood was way ahead of its
MORE FRIENDSTHAN
accuse KYLIE JENNER Sharvari Kylie Jenner Her post... Shama Sikander Poster of the album Kiara Advani
MANIFESTINGMYTHOLOGY
OOMPHOOZESSHAMA

















