Bengaluru: The Kar nataka High Court has said ‘azan’ (call to prayer) on loudspeak ers does not violate the fundamental right of people of other faiths. It therefore refused to or der mosques to stop playing azan on loud speakers. However, the court directed authori ties to implement ‘Noise Pollution Rules’ and file a compliance report. A PIL by Bengaluru resi dent Manjunath S Hala war was heard by a divi sion bench headed by Acting Chief Justice Alok Aradhe.
NOTHING WRONG WITH TOUCHING FEET OF ‘MY GURU’ AMIT SHAH: TELANGANA BJP CHIEF Hyderabad: Telangana BJP chief Bandi Sanjay on Monday said there was “nothing wrong” with touching the feet of someone he considered “guru”. Responding to the criticism from the TRS and the Congress of a viral video showing him fetching the shoes of Home Minister Amit Shah at the Mahankali temple.
RUSSIA’S ACTIVE FSB: Principal security agency works to counter-intelligence, internal and border security, counter-terrorism, and surveillance of serious crimes and law violations.
23RD MEETING OF THE CENTRAL ZONAL COUNCIL Modi has placed concept of ‘Team India’ before nation: Amit Shah Bhopal (ANI): Home Minister Amit Shah on Monday chaired a Cen tral Zonal Council meet ing in Bhopal where is sues like connectivity, power, sharing of river water and other matters were discussed. Shah said that the Central Zonal Council States are major centres of food grain production and have taken concept of ‘Team India’ of PM Modi to ground & PM has always worked to strengthen the spirit of cooperative federalism.
267.75
New Delhi: Top executives of Indian arms of Apple, Google, Amazon, Netflix and Microsoft will on Tuesday depose before a parl panel looking into anticompetitive practices in the digital space, the committee’s chairman Jayant Sinha said. Panel has been looking into few aspects of competition in the marketplace.
YOU’RE MESSING WITH WRONG PEOPLE: KCR’S DAUGHTER Hyderabad: Reacting to allegation that Telangana CM K Chandrashekar Rao’s daughter and MLC K Kavitha was the “middleman” between liquor mafia and AAP govt in Delhi excise policy case, Kavitha has called allegations “baseless”, said has nothing to do with it.
TECH GIANTS TO DEPOSE BEFORE PARL PANEL TODAY
Russia detains IS suicide bomber plotting terrorist attack
—Home Ministry
New Delhi (Agencies): Around 1,500 Hindus, who had come to India from Pakistan to escape religious atrocities, re turned to their country in last 18 months after they failed to get citizen ship here, a media re port claimed on Mon day. There are around 25,000 Pakistani Hindus in India waiting for citi zenship, but they do not have money and re sources to fulfil the re quired formalities, ac cording to Simant Lok Sangathan, an advocacy group for the rights of Pakistani migrants in India. “The renewal fee of a passport is Rs 8,000 to 10,000 at Pak embassy. There are loopholes in giving citizenship due to which Pakistani Hin dus are facing several problems,” Sodha said. From 2021 till this year around 1,500 Pakistani Hindus have gone back to Pakistan. Due to slack ness of state govt along with Centre there is a lot of disappointment among Hindus refugees from Pak. Hindu Singh Sodha, Sangathan President BSE SENSEX 58,773.87 872.28 | NIFTY 17,490.70
New Delhi: Centre on Monday launched Rashtriya Puruskar Portal to bring together awards of various ministries, depts, agencies of GoI under one platform. The last date for nominations is September 15.
www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia NEW DELHI l TUESDAY, AUGUST 23, 2022 l Pages 12 l 3.00 RNI TITLE NO. DELENG/2021/19840 l Vol 1 l Issue No. 354 OUR EDITIONS: JAIPUR, NEW DELHI & MUMBAI FUTURE OF THE SAFEWRESTLINGINDIANINHANDS:PM
First India Bureau
New Delhi: Delhi CM Arvind Kejriwal on Monday said that Sisodia should get ‘Bharat Ratna’ for reforming Delhi govt schools, but is being hounded by Centre due to political motives. “The entire country’s education system should be handed over to him,” he said.
Rajnath leaves today for SCO meet at SonowalTashkent,inIran to review Chabahar Port, bustunveilsJaishankarGandhi’sinParaguay
New Delhi (PTI): Stu dents from the Akhil Bharatiya Vidyarthi Parishad (ABVP) and members of the security staff at Jawaharlal Nehru University clashed on Monday af ternoon, after students gathered at the finance office demanding re lease of fromalsosecuritybetweenPCRmatter.wasdentcallPolicefellowships.receivedaPCRregardingtheincibutsaidthatnoFIRregisteredinthe“Wereceivedacallabouttheclashstudentsandstaff.Wehavereceivedcomplaintsthesecuritystaff and students. The mat ter was resolved before we reached the spot,” said a senior police of ficer.Videos of the incident show dozens of students and security staff alike crammed in the office, where they can be seen shoving each other. In one video, the guards ap pear to be hitting out at the students.Members of the ABVP alleged that multiple students were injured during the clash. Manoj C, DCP (Southwest), said: “Ap propriate action will be taken based on the com plaints we receive.”
ATTACK AGAINST TOP INDIAN LEADER FOILED
BJP offered to make me CM, says Sisodia; Party refutes claim Arvind Kejriwal and Manish Sisodia in Ahmedabad on Monday.
YASIN COURT’SREFUSESMALIKLEGALAIDOFFER Jammu: A special court on Monday offered legal aid to JKLF chief Yasin Malik, but he turned it down and again insisted on his physical appearance in hearing on the killing of four IAF personnel. The next date of hearing in the third week of September.
OPEN TILL SEPT 15
Moni Sharma Moscow: The Russian Federal Security Ser vice (FSB) on Monday said that its officers had detained a suicide bomber, a member of the Islamic State terror ist group, who was plot ting a terrorist attack against one of India’s leadership“Russia’selite.FSB identi fied and detained a member of the Islamic State international ter rorist organization banned in Russia, a na tive of a country in Cen tral Asian region, who planned to commit a terrorist act by blowing himself up against one of the representatives of the ruling circles of India,” authority said. Following the row stirred by former BJP spokesperson Nupur Sharma’s comments on the Islamic Prophet Mo hammed, IS has threat ened to carry out at tacks across India. The IS-KP, operating in the Indian subcontinent, released a 50-page docu ment on the issue with pictures of PM Naren dra Modi petting a cow.
‘WANTED TO TAKE REVENGE BY KILLING INDIAN LEADER’
READ Crucial
Amit Shah with Pushkar Singh Dhami, Shivraj Singh Chouhan and other dignitaries during the 23rd meeting of Central Zonal Council of MP, UP, Uttarakhand and Chhattisgarh, in Bhopal on Monday.
SISODIA SHOULD BE GIVEN RATNA:BHARATKEJRIWAL
RELIGIOUS ATROCITIES
Modi’s ministers fan across globe to secure strategic national interests
A video released by the news agency purports to show the man, who identifies himself as ‘Azamov’, confessing to the plot. The man is believed to be a citizen of a country in Central Asia. “In 2022, I flew to Russia, from where he was supposed to go to India. In India, I was supposed to be met and given all the neces sary things to commit a terrorist attack on instructions of Islamic State for insulting Prophet Muhammad,” the detainee said in the video.
FLOOD THREAT LOOMS LARGE! Subarnarekha river flows over the danger mark owing to heavy monsoon rainfall at the Rajghat near Jaleswar in Balasore district on Monday. —PHOTO BY PTI Centre urges SC to give control to AIFF from CoA, agreed FIFA term New Delhi: Centre has urged SC to end the ten ure of the CoA and di rect that the edAIFFtion,wasone23.overCoAandwillGeneral.byAIFFshallmanagementday-to-dayofAlFFbelookedafterbyadministrationledtheactingSecretaryThefinaldraftbesubmittedtodaythatthemandateofbedeclaredtobeinfullfromAugustCentretellsSCthatofconcernsofFIFAthatadministramanagementofshouldbeconductbyadulyelectedbody.
New Delhi: Three top ministers of the Modi government are on stra tegic international vis its at the same time, seeking to advance and secure India’s interests in different geo-politi cal zones. Defence Min ister Rajnath Singh will travel to the Uzbek capi tal Tashkent on Tues day to attend a defence ministerial conclave of the Shanghai Coopera tion Organisation (SCO). Chinese Defence Minister General Wei Fenghe and Russian De fence Minister Sergei Shoigu are expected to attend the SCO meet apart from their coun terparts from other member nations of the grouping.TheSCO defence ministerial meeting is taking place around three weeks ahead of the annual summit of the influential group ing. The summit is scheduled for Septem ber 15 and 16 in Samar kand.“Tomorrow, August 23, I will be in Uzbeki stan to take part in the SCO Defence Ministers Meet being held at Tashkent,” Singh said. Turn to P8 S Jaishankar at the historic Casa de la Independencia in Paraguay.
NSE
TOP COURT SEEKS GUJARAT’S REPLY ON TEESTA’S BAIL New Delhi: The Supreme Court Monday sought a response from the Gujarat government on a bail plea by activist Teesta Setalvad, arrested for allegedly fabricating evidence to frame “innocent people” in the 2002 Gujarat riots cases. A bench headed by Justice U U Lalit issued notice to the state on the plea filed by Setalvad and posted matter on Aug 25.
HC refuses to ban Azan loudspeakerson
New Delhi: PM Narendra Modi on Monday congratulated Indian wrestlers. He tweeted,”Our wrestlers make us proud again! Congratulations to our team on winning 16 medals (7 each in Men’s and Women’s freestyle and 2 in Greco-Roman) at the U20 World Championships.
New Delhi: Delhi depu ty CM Manish Sisodia, who caused a stir by claiming on Monday that the BJP offered to dismiss cases against him if he joined the party, has now claimed that the saffron party offered him the chief minister’s post if he caused a split in AAP. Meanwhile, the BJP on Monday dismissed Sisodia’s claim of re ceiving an offer from the saffron party to get all cases against him closed, BJP’s national spokesperson Gaurav Bhatia told at a press conference in Delhi.
VIGILANCE BUREAU ARRESTS FORMER PUNJAB MINISTER Chandigarh: Former Punjab minister Bharat Bhushan Ashu has been arrested by the vigilance bureau after allegations of corruption against him. Bharat Bhushan, former food and civil supplies minister, is at the centre of allegations in a transport scam in which tenders were allocated on fake registration numbers of vehicles.
RAUT’S TILLCUSTODYJUDICIALEXTENDEDSEPTEMBER5 Mumbai: A special court here on Monday extended the judicial custody of Shiv Sena MP Sanjay Raut till September 5 in a money laundering case linked to alleged irregularities in the redevelopment of a Mumbai ‘chawl’. Raut was arrested by ED on August 1 in connection with alleged financial irregularities in redevp of the Patra Chawl.
ABVP students clash with JNU security staff
‘1,500 Pak Hindus left India in 18 mths after failing to get citizenship’
AWARDS
PADMA NOMINATIONS
IS is using Cyberspaceinternet-basedvarioussocialmediaplatformstopropagateitsideology.isbeingcloselywatchedinthisregardbytheagenciesconcernedandactionistakenasperlaw.
The Court observed that Sajid was one of the main witness and also one of the accused as per the prosecution persons who had to face trial as per prosecution.
New Delhi (PTI): Among the hundreds of farmers who began their demonstration at the Jantar Mantar over a slew of issues, 64-yearold Sriaj Kodyuriv from Kerala garnered the most attention with his AdivasiKodyurivattire reached Delhi on Monday after covering a three-day train journey from Kerala. For several hours, he stood at Jantar Mantar holding placards that read Implement MSP, Save "Farmersfarmer'.areclosest to nature. If they abandon their farm equipment, we won't be getting any food. So farmers should be saved. I am here for this," KodyurivAskedsaid.why he chose the Adivasi attire, he said: "This is to send a message that the farmers and tribal people deserve their rights."
New Delhi (PTI): Amid a slew of caste-related violence in the country, JNU CivilcodingonAmbedkar’sriesAmbedkartribe.fromLordperdoanthropologicallyPanditSantishreeVice-ChancellorDhulipudionMondaysaidgodsnotbelongtotheup-casteandthatevenShivacouldbescheduledcasteorDeliveringtheDrBRLectureSe-titled‘DrBRThoughtsGenderJustice:De-theUniformCode’,shealso said the “status of shudras given to women in Manusmriti” makes it extraordinarily regressive.“Letme tell all women that all women according to Manusmriti are shudras so no woman can claim she is a brahmin or anything else and it is only by marriage that you get the husband or father’s caste on you. I think this is something which is extraordinarily regressive,” sheTakingsaid. about the recent caste violence involving a nine-year-old Dalit boy, she said that no god belonged to the upper“Mostcaste.ofyou should know the origins of our gods anthropologically. No god is a brahmin, the highest is a kshatriya.Lord Shiva must be a scheduled caste or a scheduled tribe because he sits in a cemetery with a snake and has very little clothes to wear. I don’t think Brahmins can sit in the cemetery,” she said. She also said fromannathmi,gods,“anthropologically”thatincludingLaksh-Shakti,orevenJag-donotcometheuppercaste. TO ‘KULGURU’
The students are reaching out to the NTA and the UGC forrequestinganotherchance
wore caps with the name of their farm organisations inscribed on them, and raised slogans for farmer unity and against the Centre accusing it of not coming good on its promises.Magha Nibori, a farmer from Punjab with one acre of farmland which he cultivates with seasonal crops, said he came here fully prepared to stay put, if required. Many farmers registered their protest in their own unique ways. One of them came wearing a garland of garlic, while another, a woman, wore a saree with tricolours.
MBBS student dies in road accident Gurugram (PTI): An MBBS student was killed while his classmate sustained injuries when the car in which they were travelling crashed into a stationary truck here, police said on Monday. The final year students of Shree Guru Gobind Singh Tricentenary (SGT) University in Budhera were returning to their college from Gurugram when the accident occurred on Sunday night on BudheraAccordingroad.to the complaint filed by the injured student —Ankit Dahiya — the truck was parked on the roadside and did not have any reflectors while its hazard lights were off. “The left side of my car was damaged and Su-nny was critically injured. I rushed him to SGT hospital where doctors declared him dead,” he said in the police complaint.
Chief of the Army Staff General Manoj Pande arrives to attend the Ethics Bowl competition organised by the Army Wives Welfare Association (AWWA), at the Army Public School, Delhi Cantonment, in New Delhi on Monday.
Candidates leave after appearing for the CUET at Delhi University Sports Complex in New Delhi. BY ANI —FILE PHOTO
Anthropologically, gods don’ t belong to upper caste: JNU VC CASTE CONFLICT ShivaPanditSantishreeDhulipudisaysevenLordcouldbefromScheduledCasteorTribe CASE
The begstigationinves-question as to how the prosecution has charged 6 accused under Section 307 IPC for the attempted murder of injured Sajid, who is himself an accused.”
Judge Rawat
‘By this logic, every injured person in a riots case can be made an accused’ Judge Amitabh Rawat observes that accused is himself a gunshot survivor
JANTAR MANTAR PROTEST
CUET: Aspirants claim admit cards mention past dates for exam
—PHOTO BY ANI
Heavy traffic jam at Delhi borders SKM skips MSP panel meet New Delhi (PTI): As thousands of farmers reached Jantar Mantar to attend a ‘mahapanchayat’ in national capital, massive traffic jams were witnessed on Monday at Delhi border including Ghazipur and Singhu, with some of the commuters getting stuck for more than an hour amid curbs put in place by the police, officials said. They said all vehicles entering the capital are being checked and the police personnel are on ‘alert mode’.
INSIDE SCHOOL Gurugram (PTI): An 11-year-old student died under suspicious circumstances in her school here on Monday, police said. The incident occurred at the private school in sector 64 around 8.40 am when the girl, a class four student, fell unconscious while walking towards her classroom, they said. The school staff took her to a nearby hospital where doctors declared her brought dead, they said. Police said the body has been sent for post-mortem. Speaking on condition of anonymity, a school staff member said the girl appeared to be normal and took part in the morning prayer, but fell unconscious while going to her classroom.
Jantar Mantar buzzed with voices of dissent on Monday as farmers from all over the country gathered here demanding a law ensuring minimum support price for crops, farm loan waiver, and sacking of Union minister Ajay FarmersMishra.wavedflags,
COURT DROPS ATTEMPT TO MURDER CHARGES AGAINST 6
Farmers charm with attire, emotional connect
New Delhi (PTI): The committee on MSP had a broad discussion on the mandated topics thetheterns“change”based“promotediscussedSanjayagriculturetee,absent.butmeetingparent”effectivemakingincluding“MSPmoreandtrans-initsfirstonMondaySKMremainedThecommit-headedbyformersecretaryAgrawal,onwaystozerobudgetfarming”,tocroppat-keepinginmindchangingneedsofcountry.
CAPITOL NEW DELHI | TUESDAY, AUGUST 23, 2022 02 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
Minor girl raped, accused arrested Gurugram (PTI): A 23-year-old man was arrested for allegedly molesting and having oral sex with a four-year-old girl luring her with toffees, police here said on Monday. The accused was produced in a city court Monday and was sent to judicial custody,. According to the complaint filed by the victim’s mother, the accused, identified as Sahil alias Nitu, a resident of a colony in Sohna, was repeatedly molesting her daughter. On August 15, the accused took the girl to his home enticing her with toffees and sexually molested her and forced her to have oral sex with her, she wrote in her“Allcomplaint.thishad been going on for a long time but it came to light on August 15 when I was at my maternal home and my daughter was with her grandmother, who later told me about the incident. After returning home I asked my daughter about the incident, and I was shocked when she told me that Sahil often molested her”, the mother said in her complaint.
POLICE CONSTABLE, GUARD ASSAULTED BY 2 DRUNK MEN New Delhi (PTI): A Delhi Police constable and security guard at a Delhi government-run hospital here were allegedly assaulted by two men in an inebriated state, officials said on Monday. The incident took place at the Lal Bahadur Shastri hospital in Kalyanpuri on the intervening night of Sunday and Monday, they said, adding hospital property was also damaged by the miscreants. A purported video of the incident has surfaced on social media, police said. “Both were in inebriated condition and on being told by the security guard that only one attendant at a time is allowed in the ward, they started arguing with the guard and the duty constable.
11-YEAR-OLD STUDENT DIES
New Delhi (PTI): Several Common University Entrance Test (CUET)-UG aspirants are claiming that the exam dates mentioned on their admit cards have already passed while the date intimated to them earlier was different.Thedebut edition of CUET, which has been split into six phases, has been marred by glitches so far causing exam cancellations at multiple centres and postponement of exams for several candidates. However, the rescheduling of the exam for several candidates and attempts to accommodate the choice of city for exam centre, has left students a worried lot as their admit cards and city intimation slips are mentioning different dates. The students have been reaching out to the National Testing Agency (NTA) and the University Grants Commission (UGC) requesting for another chance to appear in the examination. Yuvraj Singh Chauhan from Jodhpur in Rajasthan was intimated that his exam is scheduled on August 10. When he downloaded his admit card on August 7, he was shocked to see that his exam date was August 6 which had already passed.
—PHOTO
J ‘KULPATI’
New Delhi (Agencies): A Delhi court hearing the Delhi Riots cases has dropped attempt to murder charges against six men, on the basis of the fact that one of the accused in the case was also the gunshot survivor and could not have been made a witness and an accused at the same time. A Delhi Court had questioned the investigation where a complainant named Sajid, was himself arrayed as an accused after investigation. Sajid had claimed to have suffered a gunshot injury on February 25, 2020. Sajid was made an accused on the reason that since he got an injury, it indicates that he too was a part of the riotous mob. The Additional Session Judge Amitabh Rawat said that “By this logic, every injured person in a riots case can be made anHeaccused.”further said that “…..the investigation begs question as to how the prosecution, on the one hand, has charged 6 accused persons under sec. 307 IPC which is an at attempt to murder for the attempted murder of injured Sajid who has also been made as an accused in this case for the offence of rioting.”
DELHI RIOTS
ETHICS COMPETITIONBOWL
Shimla (PTI): Union minister Anurag Thakur on Monday called Delhi Chief Minister Arvind Kejriwal a “big liar” and his ministers “bigger liars”, reacting to AAP leader Manish Sisodia’s claim that he was offered the CM’s post by the BJP if he broke the Aam Aadmi Party.Delhi Deputy Chief Minister Sisodia has claimed that he was approached by the BJP with the offer to close all cases against him if he joined their party and broke the AAP. He is among 15 people and entities named in an FIR registered by the Central Bureau of Investigation in connection with alleged irregularities in the implementation of the Delhi excise policy. “Kejriwal is a big liar and it seems that his ministers are bigger liars,” Thakur, who is the Union information and broadcasting minister, told reporters on the sidelines of a function in Kangra district. The Kejriwal model of governance has failed as the focus of the AAP government in Delhi has shifted from “mohalla clinics to mohalla thekas (liquor vends)”, he added. The BJP leader alleged that Kejriwal is the “kingpin of the liquor scam whereas Sisodia is the main accused”
‘BJP wanted to make Sisodia its CM candidate’ New Delhi (ANI): The Aam Aadmi Party (AAP) on Monday alleged that Delhi Deputy Chief Minister Manish Sisodia had received offers from a Bharatiya Janata Party (BJP) leader to work against the Arvind Kejriwal-led outfit to escape CBI action. Senior party leader Saurabh Bharadwaj claimed that Sisodia, who is facing CBI action in Delhi liquor policy case, was approached by BJP with an offer to become the party’s chief ministerial face in Delhi. Addressing the media, Bharadwaj claimed that BJP was asking Sisodia to join it along with other legislators. However, the Aam Aadmi Party leader did not name any BJP leader. Bhardwaj said there were several opposition leaders who faced corruption charges but soon after they joined the BJP, investigations against them were stopped.
Kejriwal is a big liar and it seems that his ministers are bigger liars. Kejriwal model of governance has failed as the focus of the AAP government in Delhi has shifted from “mohalla clinics to mohalla (liquorthekasvends)
“The allegations made on me are completely baseless...I don’t have any link with what was said in the Delhi Excise scam. They have all the agencies in their hands, they can do
He also alleged that there are many discrepancies in what was recommended by the panel on Delhi excise policy and what the AAP govt implemented.Alotterysystem was to be adopted for awarding contract in retail vending. The city was divided into 32 zones, Bhatia said and showed documents of both the policy as well as the recommendations of the panel. The lottery system wasn’t followed by the Kejriwal government and zones were awarded to ‘some’ industrialists which is worrisome, he alleged. “And, the silence of Kejriwal on corruption charges in excise policy proves that he is hardcore dishonest (‘kattar beiman’),” Bhatia alleged.
CAPITOL NEW DELHI | TUESDAY, AUGUST 23, 2022 03 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia KEJRIWAL KINGPIN OF LIQUOR SCAM: THAKUR
allegations....WeickyofmalignandunioningbeenministerbecausethatKavithapletelyrequired.investigationwhateverthatisWewillcom-cooperate,”Ksaid.ShefurthersaidBJPisdoingthisourchiefKCRhasvocalincriticis-thepoliciesofthegovernment,thusitistryingtothereputationherfamily.“Wedon’tgetpan-onthesekindsofare going to fight and we are family from fighters,” she said.
—Anurag Thakur, Union minister ‘Hardcore dishonest’: Bhatia
The case registered on March 31, 2008 on source-based information pertained to large scale corruption by two officials of DSIIDC who were regularly seeking bribes and liquor from distributors in Delhi. Mukherjee had retired from the DSIIDC but was inducted as an Officer on Special Duty in its Indian Made Foreign Liquor unit between June 1, 2006 to December 31, 2007 with wide ranging duties from policy to procurement of Amrikliquor.Singh was the assistant manager (enforcement) and used to flaunt his cordial relations with Mukherjee and say he could get any work done through Mukherjee in the IMFL division.Armed with telephone call intercepts, witnesses and evidence, the had CBI filed a chargesheet against Mukherjee and Singh in 2011. Two years later, the strong case presented by the CBI resulted in their conviction. During the trial, Mahendru testified against Mukherjee as a CBI witness and identified both the accused in the court room.
CBI BEGINS GRILLING The CBI on Monday questioned Managing Director of Indospirit Sameer Mahendru along with other accused named in the FIR in connection with alleged corruption in the Delhi Excise policy case, officials said. The CBI in its FIR has mentioned two instances where Mahendru allegedly made payments totalling about Rs 4-5 crore to “close associates” of Delhi Deputy Chief Minister Manish Sisodia, who is also named in the FIR.
New Delhi (PTI): The BJP on Monday fired a fresh salvo at Delhi Chief Minister Arvind Kejriwal and his deputy Manish Sisodia, alleging that there were several discrepancies between what was recommended by the panel on excise policy and what was implemented by the AAP tacharcorruption”“breakingthehiexcisecorruptionquestionstoWewhichonetionsnothonestemandar’charges.himwenotwhosethewalgance”ment.oravailabletiondishonest’.thatruptionjriwal’sGauravnationalheadquartersconferenceAddressinggovernment.apressatthepartyhere,BJPspokespersonBhatiasaidKe-silenceoncor-chargesprovesheis“hardcoreAnimmediatereac-ontheissuewasnotfromtheAAPtheDelhigovern-Hesaidthe“arro-ofArvindKejri-willbeshatteredbypeopleofDelhiquestionsheisanswering.“Earlier,hadgiven24hourstotorespondtotheIfhe’sa‘kattar(hardcoreman)whyisheansweringtheques-beingraised.Onlytweethascomeupismeaningless.againgive24hoursKejriwaltoansweronchargesofintheDelhipolicy,”hesaid.ReferringtotheDel-excisepolicy,hesaidAAPleaderwasrecordsin(‘bhrash-kakirtiman’).
investigationUnderbytheCBIforallegedbriberytoinfluenceDelhi’sexcisepolicy,Mahendruwasoncetheagency’skeywitnessagainst2infrastructure&developmentofficials
—PTI SAMEER MAHENDRU:
K Kavitha to file defamation case against BJP for calling her mafia ‘middleman’ Ranga Reddy (Hyderabad) (ANI): Telangana Chief Minister K Chandrashekar Rao’s daughter and MLC, K Kavitha on Monday said that she will file a defamation case against Delhi BJP leaders - MP Parvesh Varma and former MLA Manjinder Singh Sirsa for their allegations that she acted as a “middleman” between the liquor mafia and the Aam Aadmi Party (AAP)Kavithagovernment.saidshe will also move court seeking an injunction order against those making the allegations.
AKHILESH BACKS AAP Azamgarh (PTI): The BJP is foisting “false” cases on opposition leaders in the run-up to the 2024 Lok Sabha polls to divert people’s attention from real issues such as price rise and unemployment, SP chief Akhilesh Yadav alleged on Monday. He referred to “similar tactics” being used in Delhi, where he said the BJP-led Centre is not ready to acknowledge the Aamtionbroughtimprovementintheeduca-sectorbytheAadmiParty (AAP), despite The New York Times lauding“Whyit. is the BJP already in the preparation mode for the 2024 election? False cases are being lodged against opposition leaders and action is being taken against them through government agencies. “It is because they (BJP) do not have an answer to real issues such as inflation and unemployment. To divert people’s attention as also to ensure that leaders do not raise their voice,” Yadav said.
Himmatnagar (Gujarat): Delhi Chief Minister Arvind Kejriwal on Monday sought to position the contest between the BJP and the Aam Aadmi Party (AAP) in the upcoming Gujarat Assembly polls as a “Dharamyudh” like the Mahabharat where the ruling outfit has the “armies” of probe agencies CBI and the ED on its side, while his party has the “support of Lord Krishna”. Kejriwal compared the BJP with the Kauravas and his side as the Pandavas, the victorious heroes.
It’s Dharamyudh, Krishna on our side: Kejriwal Gaurav Bhatia addresses a press conference in New Delhi on Monday.
—PHOTO BY ANI Kejriwal and Sisodia in Ahmedabad on Monday.
—PHOTO BY ANI K Kavitha Saurabh Bharadwaj
I am kattar imandar: Sisodia Ahmedabad (PTI): Delhi Deputy CM Manish Sisodia, who is in Gujarat along with CM Arvind Kejriwal, said at a press conference in Ahmedabad that he was whensurprised him with a message that he has "two offers" from the BJP. "The messenger said one was that all big cases registered against you by CBI-ED will be taken back. The other offer was that I break the to them - 'Delhi Chief Minister Arvind Kejriwal is my political guru and I have learnt politics from him'. I have not come into politics to be CM or PM," Sisodia said. "I am an honest man. In fact, I am with the Arvind Kejriwal team because I am a "kattar imandar" (staunch honest) person. These fake cases are weak, and you can't threaten me with these,” Sisodia said at the press conference. The deputy CM said improving education in Delhi schools remains his top priority.
Abhishek Shukla New Delhi : Indospirit’s Managing Director Sameer Mahendru, who is being probed by the CBI for alleged bribery to influence Delhi’s excise policy, was once the agency’s key witness against two infrastructure and development officials convicted for graft in 2013, according to Asofficials.aprosecution witness (PW-34) for the CBI, Mahendru had testified against the two officials of the Delhi State Industrial and fiveweretionDevelopmentInfrastructureCorpora-Ltd.(DSIIDC)whodemandingfourtoexpensiveliquor bottles from distributors every month for granting various favours.His testimony was one of the clinching evidences that nailed the role of the two DSIIDC officials -- Sushanta Mukherjee and Amrik Singh -- and they were convicted by the special CBI court in 2013.
The BJP on Sunday had alleged that a bribe of crores of rupees was given to Delhi Deputy Chief Minister Manish Sisodia to increase the commission from 2.5 per cent to 12 per cent under the Delhi government’s revamped liquor policy and the first instalment of the same was given to him. BJP further alleged Rs 150 crore was given to Sisodia.
BJP PROTESTS NEAR CM’S RESIDENCE
The same CBI unit -the Anti Corruption Bureau, New Delhi -that probed the 2008 FIR number Sisodia.Chiefincludinghendru,eryinvestigatingCBI/ACB/ND15A/2008/isnowthebrib-chargeagainstMa-and14otherDelhiDeputyMinisterManish
“The fact that the liquor bottles were picked up/ obtained from DSIIDC vends by the accused persons despite protest by the suppliers and that the suppliers were made to pay for the same, is borne out from the testimony of PW-34 Sameer Mahendru,” Special Judge Poonam A Bamba had noted in theShejudgement.hadsaid it is also made out that such illegal gratification was obtained by the accused persons for expediting the release of payments to them. When intercepted calls were played in the court, Mahendru recalled the as2008,duringMukherjee.conversationtelephonicwith“PW-34deposedthattheperiod2007-hewasworkinganattorneyandC and F Agent for Skol Beverages Ltd. and had been supplying its brands to various outlets of DSIIDC. He knew both the accused persons and identified them in the court,” the Judge had Mahendrunoted. now stands accused of making illegal payments of Rs 4-5 crore to two “close associates” of Sisodia on different occasions. The agency has accused Mahendru as one of the businessmen who were “actively involved” in alleged irregularities in framing and implementation of the excise policy of Delhi government for the year 2021-22. FROM CBI WITNESS TO ACCUSED DELHI EXCISE POLICY CASE
MIRACULOUSTEAMWORK!
TOP TWEETS BALL IS NOW IN FIFA’S COURT TO ALLOW AIFF TO HOST WORLD TOURNEY ope is in sight for In dia to host the Un der-17 women’s soccer world championship. The FIFA ban on In dia’s football federation is expect ed to be lifted after the Supreme Court acceded to Central govern ment’s request to postpone elec tion to the All-India Football Fed eration’s executive committee. The court dissolved the threemember Committee of Adminis trators it had earlier appointed. The CoA will hand over charge to the federation’s acting generalsecretary. Former football captain Bhaichung Bhutia, who was plan ning to contest the AIFF election, however, filed an intervention ap plication, supporting the reforms which the court intended to bring in the federation following allega tions of corruption. Bhutia sub mitted that the reforms within AIFF “cannot be held to ransom because of FIFA’s suspension…” On the other hand, taking on FIFA would have come as a dampener for young women foot ball enthusiasts waiting for their moment under the sun. Women’s sports are becoming popular globally. Recall how England cel ebrated its women’s soccer team’s victory over Germany in the European Championship.
fter four months of darkness, the sun is finally out over the frigid world of Antarc tica. The European Space Agency (ESA) announced the Sun’s arrival as the 12-mem ber crew of the Concordia research station woke up to a bright morning on the south ern extreme of the world.
Like musicians in an orchestra, every organism plays its part, making the symphony of life possible and enjoyable. Sadly, such partnership and bonding is often lacking in families and organisations since many are influenced by self-interest. But how can one learn to cooperate better?
ESA released a picture of the sun rising above the ho rizon captured by medical doctor Hannes Hagson on August 5, who said, “Time here has the strange quality of both passing really quickly and very slowly at the same time, and in just two days we expect the re turn of the sun to grace us here at 75 degrees south! The returning daylight cer tainly has us all cheered up and starting to sense the be ginning of the final part of thisTheadventure.”crewliving in the frigid environment braced for extreme temperatures that fell down to 80 degrees Celsius under a pitch-black sky. The crew has been busy conducting biomedical re search, gathering data from crew urine, stool, and blood samples, as well as cogni tive and psychological measures through question naires to study the effects of isolated, confined, and ex treme environments on the human body.
Kiren @KirenRijijuRijiju Railway Projects for MANIPUR were conceived in 1990. It’s only @ narendramodi Ji, who has fulfilled it. Now, all North East States are connected and more projects are on the pipeline to link NE with rest of India. And reservation provisions are made easy for the passengers.
To limit our cooperation according to our own terms leads to loss of many benefits. Giving up one’s preferences for the sake of common good leads to mutual well-being. We may feel that the part we play is small, but the small acts that promote team spirit are like the small stitches that hold a garment together and makes it strong
l Vol 1 l Issue No. 354 l RNI TITLE NO. DELENG/2021/19840 Printed and published by Anita Hada Sangwan on behalf of First Express Publishers. Printed at Impressions Printing and Packaging Limited, C-21, 22 Sector-59, Noida-201301. Published at G-20, 3rd Floor, 309, Preet Vihar, New Delhi-110092. Phone 011-49846474. Editor-In-Chief: Dr Jagdeesh Chandra Editor: Anita Hada Sangwan responsible for selection of news under the PRB Act PERSPECTIVE NEW DELHI | TUESDAY, AUGUST 23, 2022 04 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
The writer is a personal development skills facilitator. rekhakumar@protonmail.com
he ‘web of life’ – how fitting that expression is, for life is a network of interconnected and interdependent organ isms. We are a part of that web. In our body, quietly at work, in our digestive tract, is an army of friendly bacte ria assisting us to stay healthy by aiding in diges tion. Images fall on the retina of our eye just as they do on a camera’s film. Why is the world not upside down to us? It is because the brain has developed the habit of re versing the impressions. It is miraculous team work be tween the eye and the brain. Muscles can only contract, but skeletal muscles work in pairs. When one contracts, the other muscle relaxes. On a calm ocean, suddenly bubbles appear. Here, two whales working as a team perform an underwater bal let. Another example is of ants, who are a model of co operation and order – they work together to drag objects larger than themselves. In nature, mutual support and harmony can be seen at every level. The team work needed to maintain life is awe – inspiring.Likemusicians in an or chestra, every organism plays its part, making the symphony of life possible and enjoyable. Sadly, such partnership and bonding is often lacking in families and organisations since many are influenced by self-inter est. But how can one learn to cooperate better? As never before, we see disunity all around. Personal jealousies, ambitions, rival ries, color, education and competition have divided people. Wherever one looks, one sees differences – nation al, racial, cultural, language as well as economic differ ences. There is a singular lack of oneness. It is natural for one to de sire freedom. But acting too independently is not practi cal. A ‘give and take’ action is essential because we need one another. Any person, who desires everything to be done his own way, develops the habit of making issues over small matters. By refus ing to cooperate, he/she is unable to ‘fit Differencesin’.threaten and weaken a team. Uncontrolled and offensive words create tension. A quick apology re stores cooperation and unity. Often, offences are of a small nature, solely due to thought lessness, a lack of tact and a momentary excitement with out evil intent. One can be broad minded to forgive the offence. Thus, the dark clouds will be dispersed and the sun will shine again in one’s rela tionships.Thedesire to belong is in herent in everyone. One wants to share life and interests with others and to feel accepted and recognized. A competitive spirit works against a coop erative attitude. In the long run, it is counter-productive since it produces a win-at-anycost outlook, and hampers qualityOutshiningwork. others and over taxing oneself in the quest to get ahead, results in frustra tion. So is it wise to stir up competition with others? Does one enjoy the company of highly competitive persons? The win-only psychology downgrades so many other virtues and skills like dedica tion, brilliance, effort, cour age and ethical performance. To minimize these, would be self-limiting. Competition may motivate initially but achievers find motivation in the activity itself, in being creative, in making improve ments and new discoveries. Cooperation is the course of wisdom. It is far more im portant for survival and pro gress. It is an act of working with others towards a com mon end. Implicit in coopera tion is the goal to attain. It re quires our willingness to yield for the sake of realizing the common goal. It also means the giving up of little things for the sake of bigger things. At one’s place of work, the matter of cooperating in a team can come up. At times, the way certain things are be ing done, may not make sense but that is no reason for not doing the given task. If the course pursued is not cor rect, most likely, time will prove it. In the meantime, one can do one’s best to make it aTheresucceess.isoften the tendency to take oneself too seriously and to limit one’s cooperation when things are not being done the way one sees it right or if one is not given a suffi ciently prominent role. This is a test of one’s loyalty to the cause or the organization. To limit our cooperation according to our own terms leads to loss of many benefits. Giving up one’s preferences for the sake of common good leads to mutual well-being. We may feel that the part we play is small, but the small acts that promote team spirit are like the small stitches that hold a garment together and makes it strong.
T REKHA KUMAR
IN-DEPTH
THE VIEWS EXPRESSED BY THE AUTHOR ARE PERSONAL
THE LONG NIGHT ENDS IN ANTARCTICA!
Be on your guard; stand firm in the faith; be courageous; be strong. Bible Dr Jitendra @DrJitendraSinghSingh Thanks PM Sh @NarendraModi for your focus on the infrastructural development of remote rural areas in the hill districts of #JammuAndKashmir. Thanks Rural Development Minister Sh@girirajsinghbjp for accepting our request with a special consideration and sanctioning the construction of road from Dansal to Assar via Lalhote, Bulandpur, Charote in district #Doda under Central #PMGSY scheme.
H
Antarctica woke up to a sunrise after four months of pitch black darkness as the sun remained hidden
EVERYTHING ABOUT THE PLACE IS EXTREME z THE ANTARCTIC LONG NIGHT BEGAN IN MAY THIS YEAR z WITH THE SUN, NOW OUT, A NEW BATCH OF RE SEARCHERS WILL POUR IN z THE CREW BRACED EX TREME TEMPERATURES THAT FELL DOWN TO − 80 DEGREES CELSIUS
SPIRITUAL SPEAK
A MONI SHARMA The writer is Editor, News at First India
To Receive Free Newspaper PDF Daily Whatsapp: http://bit.ly/whatsappdelhi Telegram: https://t.me/firstindianewdelhi Click the above link☝ & subscribe us on your preferred platform.
The BJP has alleged the assault took place on orders of TMC MLA Paresh Paul.
Islamabad: The Islama bad High Court granted pre-arrest bail to Pakistan former PM Imran Khan till August 25 after he was booked under Anti-Terror ism Act (ATA) for threaten ing an addl sessions judge and senior cops of the Islamabad Police at a rally in the federal capital’s F-9 Park. During the hearing, the HC ordered Imran Khan to appear before the concerned anti-terrorism court on August 25.
IS PRASHANT KISHOR SETTING HIS PERSONAL GOAL OF FLOATING A POL PARTY, ASIDE?
ANTI-TERRORTOPRE-ARRESTHUSSAINBAILIMRANKHANINCASE
Srinagar (PTI): Sever al civilians were injured in a grenade blast by ter rorists in Srinagar on Sunday.According to Srina gar Police, the incident occurred at Nishat area where terrorists hurled grenade causing a lowintensity blast. Police have registered a case and hunt is underway to nab the Meanwhile,terrorists.J&K Po lice on Sunday said they averted a major terror incident by recovering an improvised explosive device (IED) weighing about 10-12 kilograms in Pulwama district. Firozabad (PTI): The police have lodged an FIR against a man for making indecent re marks on UP Chief Min ister Yogi Adityanath, officials said on Monday. SP (Rural) Akhilesh Narain said a plaint was lodged by a person named Rajesh Ali who alleged that Suresh Ya dav, chief of Hathwant block in Firozabad, made indecent remarks and used abusive lan guage against UP CM. New Delhi: The Supreme Court has agreed to list a plea seeking review of its order upholding the Enforcement Directorate’s powers related to arrest, attachment of property involved in money laun dering, search and seizure under the Prevention of Money Laundering Act. “Okay, we will list it,” a Bench headed by Chief Justice NV Ramana said after the plea was men tioned before it.
New Delhi: The Su preme Court on Monday stayed the Delhi High Court’s order directing the police to register an FIR against BJP leader Shahnawaz Hussain over a rape complaint. A bench presided by Justice UU Lalit also stayed all fur ther proceedings against Hussain in connection with the complaint and said it is “prima facie convinced that this matter requires consideration”.
New Delhi: Chief Justice NV Ramana on Mon day said he has set up a 5-judge Constitution bench to hear the legal issue concerning the scope of legislative and executive powers of the Centre and National Capi tal Territory government over control of services in Delhi. The CJI said a bench headed by Justice DY Chandrachud will hear dispute between the Cen tre and Delhi government.
Jagan Reddy met PM Narendra Modi and urged early nod to revised cost estimate of the irrigation project AP CM Jagan Reddy meets PM Modi in New Delhi on Monday.
AVERT ‘MAN-MADE DISASTERS’ ON ROADS: JUSTICE RAMACHANDRAN CAUTIONS ADMN SOCIAL MEDIA POSTS ON PAWAR: BOMBAY HC CLUBS FIRS AGAINST KETAKI, NIKHIL SC EXTENDS STATUS QUO, ASKS PARTIES TO FILE REPLY ON IOA PLEA AGAINST HC SC BENCH TO HEAR PLEA RELATED TO DELHI-CENTRE ROW ‘WHEN SOMEONE CALLS ME A THIEF, I FEEL LIKE PUNCHING...’, MINISTER’S SHOCKING REMARK PEOPLE BEING FORCED TO LINK VOTER ID WITH AADHAAR: TMC MAMATA THANKS UNESCO FOR HERITAGE TAG TO DURGA PUJA Civilians hurt as terrorists Casegrenadeslow-intensityhurlagainst UP man for Adityanath:remarks’‘indecentonYogiPolice
Kolkata: After Saugata Ray, this time Mamata Banerjee’s minister Sovan deb Chatterjee makes explosive remark. He said, “When someone calls me a thief, I feel like punching and breaking his face. No one has the power to smear Mamata Banerjee. There is no use in challenging Mamata Banerjee.” Earlier,Trinamool MP Saugata Roy said that Trinamool is get ting a bad name because of the bad deeds of some people in the party. The veteran leader publicly admitted in a public meeting on Monday that the party is going through tough times.
New Delhi: The Supreme Court asked the parties con cerned including the central government and others to file a response to a petition moved by the Indian Olympic Asso ciation challenging an order which appointed Committee of Administrators (CoA) for IOA for preparing its Constitution and conducting fresh elections. A bench of Justices S Ab dul Nazeer and JK Maheshwari asked the parties concerned to file their responses in the matter. The court listed the matter for hearing after four weeks. The court also said the interim order to maintain the status quo on the order of the Delhi HC will continue till further hearing.
PM to inaugurate hospitals in Haryana, Punjab on Wednesday
IN THE COURTYARD Patna (Agencies): Vid eo was shared by the BJP to target the onblind,jobs.wasbaton-charged.sitevideoMahagathbandhan.loyaltiestheleaderweeksKumar-governmentNitishaftertheJD(U)snappedtieswithpartyandswitchedtowardstheThe-shotataprotest-showsamanbeingThestircalledforseeking“IsthisgovernmentwhichuseslathisTiranga(tricolour)?”theBiharBJPwroteinitspost.“Isthisgovernmentdeafthatthosecarryinghavebeengivenpens.”Thestrongly-wordedpostfurtherread:“Theyaresick..Wanttokeepholdingseatofpower.Whenthe power is attained, they use support to walk.” Apparently referring to Nitish Kumar and his deputy Tejashwi, the party further said: “For one, it’s leisure. For the other, it’s just enjoy ment. But for people, it’s all about helplessness.” As the video was widely shared on social media, the Bihar deputy CM said probe had been ordered into the inci dent. “The lathi charge was done to control stu dents taking out a pro test march in Patna wherein the ADM was thrashing a STET candi date. Enquiry commit tee made; strict actions will be taken against him, if found guilty,” he was quoted as saying.
SC STAYS DELHI HC ORDER ON FIR AGAINST
One of these experi ments was done by Prashant Kishor him self. After the separa tion of Lalu Prasad and Nitish Kumar, it was Prashant Kishor who used to bring the two to gether. If it was right for the two to come together seven years ago, why would it be wrong now? However, Prashant Kishor, after initially raising the question, said that if the current government of Nitish Kumar gives five to 10 lakh jobs in two years, then he will stop his Suraj campaign. The question is whether Prashant Kishor plans to continue running the Suraj campaign for the next two years? If the Suraj campaign is to be run for two years, then what will happen to forming the political party which he is pre paring for? Is he prepar ing to announce a new party on January 26? If he keeps an eye on the functioning of the JDU-RJD government for two years, it means he will not form the par ty!It looks like he is pre paring to postpone their current campaign. For this, he will not wait till five lakh people get jobs or not. Nitish Kumar had announced to give 10 lakh jobs from Gan dhi Maidan on 15th Au gust and if he takes any initiative in this direc tion then its results will be visible in next few days and then Prashant Kishor will stop his campaign on this pre text. Informed sources say that before that he can talk to Nitish Ku mar and he can start work for opposition uni ty under the leadership of Nitish. If Nitish be comes the common face of the opposition and PK handles their elec tion management, then the picture of 2024 would change.
Chandigarh: Prime Minister Narendra Modi will visit Haryana and Punjab on Wednes day and inaugurate two state-of-the-art health facilities. He will first inau gurate Amrita Hospital in Haryana’s Faridabad at 11 am followed by Homi Bhabha Cancer Hospital and Research Centre at New Chandigarh (Mul lanpur), Mohali at around 2.15 pm. Haryana CM ML Khattar, who will be present at the event in Faridabad, said the state government is taking several steps to ensure the availability of adequate doctors in the state. He said Amrita Hospital, founded by Mata Amritan andamayi ‘Amma’ Math in Sec 88, Faridabad, will increase the health facili ties available to the people of Haryana. “People from neighbouring states, including Delhi NCR will also benefit,” he added. “The process of opening medical colleges in each district is in progress. At present, there are 13 medical colleges in the state and eight medical colleges are under pro cess and there are about 13,000 doctors. The gov ernment aims to increase their number to 28,000, which means 2,650 doc tors will be ready every year,” Khattar said.
Rahul Gandhi addressing a conclave in New Delhi on Monday
The BJP staged a pro test in front of Narkel danga Police Station demanding the arrest of a Trinamool Con gress (TMC) worker who allegedly assaulted an eight-month preg nant woman in Kolkata. Though TMC has de nied the allegations, both parties have filed policeAccordingcomplaints.tothe al legations, two TMC members barged inside the house of Shivs hankar Das, a BJP worker in Beleghata on Sunday and assaulted his eight-month preg nant hankarputepute.saultedditionpercriticalmittedThedaughter-in-law.womanwasadtoahospitalincondition.Asthedoctors,herconisstablenow.ThewomanwasasoveralanddisItisafamilydisbetweenShivsDasandhis mother-in-law Shanti Devi Singh, who is a TMC worker. Shivs hankar Das and his son were arrested by police over the dispute a few days back and were re leased on bail.
BJP workers staged a protest in Kolkata demanding arrest of a TMC worker for assaulting an eight-month pregnant woman. A candidate lies on the road after being hit by ADM (Law & Order) KK Singh (R) during a protest by CTET & BTET qualified candidates in Patna, Monday. —PHOTO BY PTI Election strategist Prashant Kishor.
‘Ease of doing...’: RaGa’s jibe to PM over drug hauls
OKAYS PLEA SEEKING REVIEW OF PMLA JUDGMENT
ANDHRA CM SEEKS APPROVAL OF POLAVARAM COST ESTIMATE
New Delhi (PTI): Andhra Pradesh Chief Minister Y S Jagan Mo han Reddy on Monday called on Prime Minis ter Narendra Modi and sought early approval of the revised cost esti mate of the Polavaram irrigation project on Godavari river. Later, the chief min ister paid a courtesy visit to President Drou padi Murmu. In his 40-minute long meeting with Modi, the chief minister dis cussed the Polavaram project and also de manded approval of the proposed Bhogapuram airport in Vizianagar am district, setting up of medical colleges and release of funds under different central schemes to the state government, official sources said. The chief minister has been demanding approval of the revised cost estimate of Rs 55,548 crore of the ir rigation project as the state government is unable to take the reha bilitation and resettle ment works forward as it involves a huge cost.
SC
Mahesh Sharma New Delhi: Election strategist Prashant Kishor is currently run ning the Suraj campaign in Bihar. But it looks like he wants to post pone this campaign and return to his old work. He has started showing signs that he is making a comeback. After com ing together of JDU and RJD in Bihar, he first raised many questions on this and said for Nit ish Kumar that this is his sixth experiment.
Kolkata: West Bengal CM Mamata Banerjee announced on Monday that a mega rally will be organised in Kolkata on September 1 to thank UNESCO for the in clusion of Kolkata’s Durga Puja on the List of Intangible Cultural Heritage of Humanity. Kolkata’s Durga Puja is the first festival in Asia to have received this recognition. The CM also said her government shall in crease the grant to Durga Puja organising committees from ₹ 50,000 to ₹ 60,000. The concession on electricity charges incurred by puja committees shall also be raised to 60 per cent from the current 50 per cent.
New Delhi: TMC spokesperson Saket Gokhale on Monday claimed poll officials were forcing people to link their Aadhaar numbers with voter ID, but the Elec tion Commission reiterated the seeding process was voluntary. Citing tweets by the Internet Freedom Foundation, Gokhale said there have been “many cases” of election officials calling up people forc ing them to link voter ID with Aadhaar numbers. “We’ve written to the Election Commission today asking to issue a clarification & immediately cease & desist from doing this,” he wrote on Twitter.
New Delhi (PTI): Congress leader Rahul Gandhi on Monday at tacked PM Narendra Modi over multiple drug hauls from Guja rat and asked for how long he would be silent on the matter. His attack came days after the Anti Narcotics Cell of Mumbai Police busted a mephedrone manu facturing unit in Guja rat and seized drugs worth 1,026 crore. “‘Ease of doing drug business’ in Gu jarat? Mr Prime Min ister, answer these questions. Drugs worth thousands of crores are reaching Gujarat. Who is spreading this poison in the holy land of Gandhi-Patel,” the for mer Congress chief said in a Posingtweet.aseries of questions, he asked why the port owner had not been ques tioned despite drugs being recovered time and again. “Why are NCB and other gov ernment agencies still not able to nab ‘Nar cos’ running drug car tels in Gujarat? Gan dhi said.
Mumbai: The Bombay High Court on August 22 clubbed all the FIRs lodged against Marathi actor Ketaki Chi tale and student Nikhil Bhamre, accused of uploading defama tory posts against NCP president Sharad Pawar, at the police station where the first case was lodged against them. There are 22 FIRs against Chitale and six against Mr. Bhamre, a resident of Nashik. With the HC Order, all the FIRs against Chitale have now been clubbed with the first FIR lodged against her at Kalwa police station.
RAHUL MEETS CIVIL SOCIETY MEMBERS AT ‘BHARAT JODO YATRA’ CONCLAVE New Delhi: Congress leader Rahul Gandhi held a meet ing with civil society members where the plans for the party’s upcoming “Bharat Jodo Yatra” from Kanyakumari to Kashmir were shared and deliberated upon.The Con gress had last week announced that on September 7, it will launch the Yatra, in which party workers and leaders, including Gandhi, will participate. Prominent civil society members and political leaders, including Yogendra Ya dav, Jairam Ramesh and Digvijaya Singh, were present.
INDIA NEW DELHI | TUESDAY, AUGUST 23, 2022 05 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia Kolkata (Agencies):
BJP slams NitishTejashwi govt with lathicharge video BJP protests after TMC worker assaults pregnant woman
New Delhi: Potholes, on average, claimed 2,300 lives an nually from 2016 till 2020, according to government data. To curb such deaths, Justice De van Ramachandran of Kerala HC said, “I hereby direct the district collectors to act proactively to avert ‘man-made disasters’ on the roads; and I caution them that every further accident will have to be explained by them in future.” The HC also said the Centre, particularly the road transport and highways ministry, has a specific role.
BJP National President JP Nadda SKM leaders claimed at some locations, farmers were being stopped from reaching the protest site on Monday Farmers flock to Del to take part ‘Mahapanchayat’in New Delhi (Agencies): Hundreds of farmers from different states started reaching Delhi amid heavy security arrangements to participate in a ‘mahapanchayat’ called by the Samyukta Kisan Morcha (nonpolitical) at Jantar Mantar on Monday.
Jammu: National Conference president Farooq Abdullah on Monday said all opposition parties are against the new law (inclusion of non-locals as voters in Jammu and Kashmir) and they are thinking of moving the court on the“Wematter.will invite the leaders of all national parties to Jammu & Kashmir in September and keep our issues before them,” Abdullah told reporters during an all-party meeting at hisAbdullahresidence.also said he had requested L-G Manoj Sinha to call an all-party meeting to discuss the bly,”lefttomorrowtogetherpresentferencesceptsidered.However,developments.itwasnotcon-“Wedonotac-this.Wehavedif-butallpartiesherehavecomerealisingthatwecouldbeoutofourassem-Abdullahadded.
Tomorrow, we could be left out: Farooq
FARMERS STOPPED FROM ENTERING DELHI, CLAIMS BKU LEADER New Delhi: BKU leader Jagjeet Singh Dallewal Monday claimed that farmers, who were coming to Delhi to protest at the Jantar Mantar in support of various demands raised by farm unions, were stopped from entering the Union Territory. “Vehicles were stopped at the Karnal bypass. We are doing this peacefully and our programme is only for a day,” he said, requesting the administration to allow the vehicles to move. 4 SUB-GROUPS
INDIA NEW DELHI | TUESDAY, AUGUST 23, 2022 06 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia New Delhi (Agencies): Union education minister Dharmendra Pradhan on Monday invited Australian universities and skilling institutions to explore possibilities of setting up campuses in India and areas of collaboration with their Indian counterparts.“Wehadfruitful discussions on further strengthening our cooperation in education, skill development, research collaborations, innovation and entrepreneurship… I am glad that both Australia and India recognise the value of education and innovation in the growth, development and prosperity of our societies,” tweeted Pradhan, who is on a four-day visit to Australia and co-chaired Australia India Education Council’s sixth meeting with his counterpart, Jason Clare. Clare and Pradhan agreed to establish a working group on transnational education to strengthen institutional partnerships and open new opportunities for collaborations between universities of the two countries.Pradhan said the two countries agreed to expand their cooperation in learning, skilling, and research. In a statement, the education ministry said Pradhan stressed the research collaboration between the two countries in the areas of Ayurveda, Yoga, Agriculture, etc.
CMPuducherrypresents `11K cr tax-free budget; laptops for students
MIN INBUSTUNVEILSOFBAPUPARAGUAY
BJP to strategise against NC meet OF NON-LOCALS IN VOTER LIST
BILL TO TRIM GUV’S POWER FOR VC APPOINTMENT
The Minister said, DBT-BIRAC 75 Amrit Team Grant Initiative will give a big boost to Prime Minister Narendra Modi’s call for “Jai Anusandhan” . Jitendra Singh said, 75 milestones-drivenbitiousportedgrantsmulti-institutionalinter-disciplinary,wouldbesup-forhigh-risk,am-researchideas,col- laborative research in all domain specific areas of the biotech sector. Jitendra Singh said, Startups, Industries, Academia and Research Bodies can form Team Science Grant in a Public-Private Partnership mode to avail grant of Rs 10-15 Crore over a period of two to three years for inter-disciplinary, highquality research. The Minister said, in order to address national priorities to propel India as a global leader in biotechnology, the grants would be broadly provided in the areas of health, agribiotech, climate change, synthetic biology and sustainable bioresource management.
Singh announces 75 ‘Amrit’ Grants for Biotech initiatives
Bengaluru: Notices have been issued to 577 private hospitals by the Karnataka health department after it received complaints that they collected money – amounting to Rs 18 crore – from the SudhakarMinisterofduringtientschargingwhilegovernmentsimultaneouslyCovid-19pa-fortreatmentallthreewavesthepandemic,stateforHealthKsaid.
UT's Chief Electoral Officer Hirdesh Kumar raised hackles of the regional parties. The government on Saturday had issued a clarification, saying the reports of a likely addition of over 25 lakh voters after the summary revision of electoral rolls is a "misrepresentation of facts by vested interests".TheKashmiri migrants "will continue to be given the option of voting at their place of enrolment or through postal ballot or through specially set up polling stations at Jammu, Udhampur, Delhi, etc," it said. Kumar had recently announced that the UT was likely to get around 25 lakh additional voters, including outsiders, after the special summary revision of electoral rolls being held for the first time after the abrogation of Article 370.
Pradhan calls Aussie varsities to set up campuses
National Conference president Farooq Abdullah speaking to the reporters after the all-party meet in Srinagar on Monday.
New Delhi: BJP president J P Nadda on Saturday spoke to seven heads of missions, including the Russian envoy, his third such interaction as part of the party’s outreach initiative. The BJP’s foreign affairs wing chief Vijay Chauthaiwale said Nadda conveyed his party’s thanks to the countries which helped in the rescue of Indian students from Ukraine during the Russian invasion. He said some members of the Commonwealth of Independent States were among those who attended the meeting. The Russian envoy also spoke in Hindi, Chauthaiwale sad. Nadda elaborated on the structure, departments and growth of the party and also took questions from the envoys. With this, Nadda has so far interacted with 33 foreign envoys as part of the ‘Know BJP’Afterinitiative.themeeting, Nadda tweeted, “It was an honour to meet with delegates from different countries today at our party HQ under the ‘Know BJP’ initiative. This is in continuation of our party’s outreach to the diplomatic community to have an indepth discussion regarding the BJP’s ideology and initiatives.”
“The mahapanchayat is a one daylong peaceful event where we will reiterate our demands such as a legal guarantee on MSP and cancellation of Electricity Amendment Bill 2022 among others,” said Abhimanyu Singh Kohar, SKM ‘mahapanchayat’.isermember(non-political)andorgan-ofthe
Minister Dharmendra Pradhan with Indian community members in Sydney on Monday. Bhind: The MP police have registered an FIR against three journalists claiming that they ran false and misleading news of an incident in Bhind. Police registered a case against local journalists Kunjbihari Kaurav, Anil Sharma and NK Bhatele after a complaint by Rajeev Kaurav, Medical Officer. It was alleged that on 15 August, the journalists shared a false video of 76-yearold Gya Prasad Vishwakarma who was being taken to the hospital on a handcart.
Nadda interacts with 7 envoys as part of ‘Know BJP’ initiative
EXPLORING POSSIBILITIES EXPERTS TO BE HIRED AS FACULTY POLLS:MUNICIPALLDF WINS 21 SEATS, UDF 14 C-19 K’TAKANOTICESTREATMENT:TO577HOSPS
PHOTO—FILE ANIBY—PHOTO CRUCIAL READ
Chief Electoral Officer Hirdesh Kumar had said the UT was likely to get around 25L additional voters
New Delhi: Union Minister of State (Independent Charge) Science & Technology; Minister of State (Independent Charge) Earth Sciences; MoS PMO, Personnel, Public Grievances, Pensions, Atomic Energy and Space, Dr Jitendra Singh today announced 75 “Amrit” Grants for Biotech initiatives involving StartUps, industry, academia and research bodies in integrated collaboration.
Mattannur: The Left Democratic Front (LDF) proved its worth again for the sixth consecutive time in Mattannur municipal elections in Kerala. The LDF won 21 of 35 seats in the Mattannur municipality after the counting results of the elections were declared on Monday. The Congress-led UDF, managed to double the seats in the region by winning 14 seats.
FIGHT FOR MSP
The Jammu and Kashmir People’s Conference (JKPC) chairman Sajad Gani Lone, however, did not participate in the meeting. “We as a party neither accept the clarification given by the government in totality nor do we reject it. We know the current administration here or in Delhi doesn’t hold political parties in Jammu and Kashmir in high esteem,” Lone said Lone also said that they will sit on a hunger strike in front of Parliament in Delhi if the rights of the people of Jammu and Kashmir are compromised. He further said that the decision to add non-locals to the voter list is not part of the law.
Thiruvanthapuram: A bill that seeks to give the Kerala government an upper hand in selecting VCs of 13 state varsities will be taken up by the assembly amid a widening rift between Kerala governor Arif Mohammad Khan and CM Pinarayi Vijayan. An official said the proposed bill may be passed during the assembly’s 10-day session after the governor didn’t sign off on requests from the state to re-promulgate 11 ordinances, or executive orders.
Puducherry (PTI): Puducherry Chief Minister N Rangasamy on Monday presented a Rs 10,696.61 crore tax-free budget for the fiscal 2022-’23 which contained aidedmentstandardschemementproposedther,agovernmentstandardscostbeCMannouncements,theirpendence,ofofmarkpattasedministrationsembly,etedinoffreeterritoryfighterssiteincludingannouncementsfreehousepattasforfreedomintheunionandlaptopsofcostforstudentsstandardsXIandXIIgovernmentandaid-schools.Presentingthebudg-intheterritorialAs-hesaidthead-haddecid-toprovidefreehouseto260tyagistothecelebrationsthe75thanniversarythecountry`sInde-concedingplea.Amongotherthesaid,"laptopswoulddistributedfreeoftostudentsofXIandXIIinschoolsinphasedmanner".Fur-hesaiditwasalsotore-imple-thefreebicycleforstudentsofIXingovern-andgovernment-schools.
SKM leaders claimed at some locations, farmers were being stopped from reaching Jantar Mantar, a claim denied by the Delhi Police.
FIR AGAINST 3 JOURNOS FOR RUNNING FALSE, MISLEADING REPORT IN BHIND
Union Minister Dr Jitendra Singh launching DBT-BIRAC 75 Amrit Team Grant Initiative to give a big boost to the Prime Minister’s call for “Jai Anusandhan” at DBT office, at CGO Complex, New Delhi on Monday.
INCLUSION
‘WILL SIT ON HUNGER STRIKE IN DELHI IF…’: SAJAD LONE
Asuncion: External Affairs Minister S Jaishankar has unveiled a bust of Mahatma Gandhi in Paraguay and visited the historic Casa de la Independencia from where the South American country’s Independence movement started more than two centuries ago. Jaishankar arrived in Brazil on the first leg of his 6-day visit to South America aimed at boosting bilateral ties with the region. Jaishankar, who is on his official visit to SA, is also visiting Paraguay and Argentina.
The government has said the Kashmiri migrants will continue to be given the option of voting at their place of enrolment.
Jammu (PTI): The BJP has convened a meeting of its leaders here on Monday to chalk out thetheafterhadelectoralvotersinclusiongarrooqferencecalled"all-party"strategy"chalkingsaid.partypartyseniorcalledRavinderinrevisednon-localsueConferencecalledagainst"counter-strategy"athemeetingbytheNationalovertheis-of"inclusionofvoters"intheelectoralrollsJammuandKashmir.J-KBJPpresidentRainahasthemeetingofleadersattheheadquarters,aspokespersonHesaidthemeet-isbeingheldtoouta"counter-againstthemeetingbyNationalCon-presidentFa-AbdullahinSrina-overtheissueofofnon-localintherevisedrollsintheUT.TheNCpresidentcalledthemeetingremarksrelatedtoadditionofvotersinrevisedrollsbythe
MSME LENDING RISE IN MSME INCLUSION z As of July 29, 2022, around 9.8 million MSMEs were registered on the govt’s Udyam Portal. z With policies favoring this sector and awareness programs, the govt is making attempts to formalize this unstructured sector so that they can avail of credit & other facilities.
LUXURY HOME DEMAND SURGES POST COVID-19 PANDEMIC New Delhi (PTI): Sales of luxury flats, priced above `1.5 crore, stood at 2022January-Junecitiessevenunits25,680acrossmajorduringandhave surpassed sales in each of the last three years, accord ing to Anarock. The Mumbai Metropolitan Region (MMR) contributed more than 50% of the total luxury housing sales in the first half (January to June) of this year.
ADANI SHARESPOWERCLIMB 5
“If the growth trend con tinues, we have no reason to believe it won’t,” ACMA President Sunjay Kapur said when asked if the sec tor could see double-digit growth in the current fiscal as well. “Everything we see is pointing in the right di rection. Demand is good, manufacturing is looking strong. Unless something happens that we are not in control of, like a pandemic, lockouts or a global reces sion, it is in the right direc tion,” he added. PER CENT DOLLAR
Inflation expected to drop below 6% by March 2023
L&T WINS INDIANCONTRACTLARGEFROMOILCORP
New Delhi (PTI): The auto component industry ex pects to maintain doubledigit sales growth in the current fiscal after having reported its highest-ever turnover in FY22, with de mand expected to remain robust.Asper the Automotive Component portedAssociation,Manufacturersthesectorreaturnoverof ` 4.2 lakh crore last fiscal, a growth of 23% over 2020-21, as passenger and commer cial vehicle production in creased by 20% and 30% respectively due to in creased demand and fewer supply chain disruptions.
LIC HOUSING FINANCE, BAJAJ HOUSING FINANCE HIKE LENDING RATES BY 0.50% OTHER STORIES
McLAREN TO FORAY INTO INDIAN MARKET THIS YEAR New Delhi (PTI): British luxury carmaker McLaren Automotive on Monday said it is set to enter Indian market this year with the opening of its first dealer ship in Mumbai in October. The Indian market would be the automaker’s 41st global territory. The opening of the first retail outlet in Oct is a part of company’s global expansion plans and growing presence in the Asia Pacific region.
JIO ONLY TELCO TO GAIN RMS IN Q1 AT VODA IDEA COST New Delhi (Agencies): Reli ance Jio is the sole telco to have gained revenueexpenselargelyfirstinsharemarket(RMS)thefiscalquarter,attheof loss-making Vodafone Idea (Vi) which ceded further ground to its stronger rivals, analysts said. Jio gained 30 basis points sequentially, tak ing its RMS in the fiscal first quarter to 43.3% while Bharti Airtel’s was flattish at 36%.
Driving financial inclusion & serving un-served and under-served Amar Bahl New Delhi (FIB): In last few decades, the Micro Small and Medium Enter prises (MSME) sector has evolved into one of the most vibrant sectors in the Indian economy. There are more than 63.3 million MS MEs contributing to around 6% of the manufacturing GDP and 24% of the GDP from service activities and employing over 110 million people across India. Fur ther, MSMEs contribute to around 45% of the coun try’s exports. While Rural India has taken the lead in the growth of MSMEs with several women entrepre neurs, the journey has been riddled with a series of challenges and problems. One of the biggest issues afflicting the MSME sector is the Lack of Formal Cred it. In India, access to formal credit is one of the biggest challenges faced by MSMEs with the credit gap pegged at around INR 25 trillion. Hence, these organizations opt for informal credit sources that charge high rates of interest. Hence, the cost of borrowing increas es which acts as a deterrent for MSMEs to access credit and hampers their growth. While the reasons can be numerous, one of the big gest roadblocks faced by fi nancial institutions in ex tending loans to MSMEs is their (MSMEs) informal structure. Most banks and lending institutions offer loans to businesses by ana lyzing their credit score, income-tax returns, bal ance sheet, and banking history. MSMEs find them selves lacking here since most of them are unstruc tured and lack formal docu mentation and/or good banking habits. As of July 29, 2022, around 9.8 million MSMEs were registered on the gov ernment’s Udyam Registra tion Portal. With policies favoring this sector and awareness programs, the government is making at tempts to formalize this unstructured sector so that they can avail of credit and various other facilities. The role of Small Finance Banks In 2015, when the RBI is sued licenses to 10 entities for setting up Small Finance Banks in the country, it also mandated them to work with the un-served and the under-served population of the country. The government also defined Agriculture and MSMEs as priority sectors and made it mandatory for SFBs to extend at least 75% of loans to these sectors.
New Delhi (PTI): The pro posed high-speed railway corridor between Delhi and Varanasi has hit a roadblock with the Rail way Board rejecting the feasibility report on the project citing multiple curves along the route which will not be suitable for a bullet train to run at 350 kmph. The decision was taken at a meeting held by Railway Board Secretar last week to re view the bullet train pro ject. The feasibility study report was presented by the NHSRCL.
` ENDS FLAT AT 79.84/US
Amar Bahl, Head of Secured Business Loan (SBL), AU Small Finance Bank.
BANKS ISSUE MORE CDs TO SECURE CHEAP FUNDING New Delhi (Agencies): Revenue secretary Tarun Bajaj received additional charge of the post of Sec retary, MCA with immedi ate effect on Monday. This comes a few days af ter the appointment of Rajesh Verma as Secre tary at BhavanRashtrapatitoPresident Mur mu. Earlier this year he was given the additional charge of Economic Af fairs Secretary till August 12. It was the second time in this calendar year that Bajaj was given the additional charge of eco nomic affairs secretary.
Colombo (PTI): India on Monday handed over 21,000 tonnes of fertiliser to Sri Lanka under a special sup port programme which will help farmers in this country and help bolster bilateral cooperation for food security, the second such assistance in recent months.“Adding to the fragrance of friendship and coopera tion. High Commissioner (Gopal Baglay) formally handed over 21,000 tonnes of fertiliser supplied under India’s special support to the people of Sri Lanka,” the Indian High Commis sion said in a tweet. This follows 44K tonnes supplied last month under Indian support totalling about $4bn in 2022,” it said. “The fertiliser will contrib ute to food security and support the farmers of Sri Lanka. It demonstrates benefits to the people from close ties with #India and mutual trust and goodwill between #India and #lan ka,” the mission tweeted.
TARUN BAJAJ GETS ADDITIONAL CHARGE AS SECY IN MCA
New Delhi (PTI): Indian banks have increased their fundraising activity through the issuance of certificates of deposits, as funding in the banking system continues to con tract, analysts said. “Banks are not raising de posit rates, as they are able to get funds easily from money market by is suing CDs, and that too cheaply, and they may continue to opt for this route of fundraising for next few weeks,” IDBI Bank said in a note.
MARKETS DAY; SENSEX, DOWN OVER Mumbai (PTI): Equity benchmarks continued to remain weak on Monday with the Sensex and Nifty falling over 1% each, dragged down by bank stocks and negative global market trends. The 30-share BSE Sensex, which had started the trade on a weak note, tumbled 872.28 points or 1.46% to settle at 58,773.87. The broader NSE Nifty declined 267.75 points or 1.51% to finish at 17,490.70. From the Sensex pack, Tata Steel, Asian Paints, Larsen & Toubro, Wipro, UltraTech Cement, Bajaj Finance, Bajaj Finserv, Tech Mahindra, Kotak Ma hindra Bank and Axis Bank were the major lag gards. On the other hand, ITC and Nestle India ended higher. Equity investors poorer by over `6.57 lakh crore in two days New Delhi (PTI): A de cline in equities for two sessions has eroded inves tors’ wealth by more than ` 6.57 lakh crore. In two straight sessions, the benchmark index has tanked 1,524.13 points or 2.52%. The weak trend in the broader market have pulled down the market capitalisation of BSE-list ed firms by ` 6,57,758.04 crore to ` 2,73,95,002.87 crore (over ` 273.95 lakh crore) in two days.
Auto component industry looks to maintain double digit sales growth this fisc
1%
India hands over 21K tonnes of urea to Sri Lanka
NIFTY
New Delhi (Agencies): The hydrocarbon-onshore division of L&T’s energy business has secured a large contract from Indian IOCLCorporation.Oilisimple menting the Panipat refinery expansion (P-25) project to enhance refining capacity from 15 to 25 MMTPA to meet the growth in demand of petro leum products and to increase their profitability and competi tiveness in the long run.
Analysts expect RBI to increase repo rate by 50–60 bps by Dec taking it to 5.9% New Delhi (Agencies): By the end of this fiscal, In dia’s headline retail infla tion is predicted to decline below 6%, ending the cur rent cycle of rate increases, analystsAnalystspredicted.expect the RBI to increase repo rate by 50–60 basis points by De cember taking it to 5.9%.
TOISSUANCESBANKS’ROADBLOCKBULLETDELHI-VARANASITRAINHITSAT-1BONDLIKELYDECLINE
“We expect the RBI to de liver two 25 bps rate hikes at the September and De cember meetings, taking the repo rate to 5.90%,” said Rahul Bajoria, chief India economist at Bar clays.The RBI has so far in creased repo rate by a total of 140 basis points since May. In the recently re leased minutes, the MPC members pointed out that the inflation though com ing down due to modera tion in food prices still fac es risks from volatile exter nal conditions. Some ana lysts predicted that a steep 50 basis points increase in repo rate was also possible can’t be ruled out, if the (US) Fed delivers another 75 bps hike,” Gaura Sen Gupta, India economist at IDFC First Bank said in a note. “In our view, the RBI is effectively being cau tious in its policy approach, especially ahead of the winter cycle, when energy prices could be volatile,” Bajoria of Barclays said. Crude supplies could tighten again when Euro pean buyers start seeking alternative supplies to re place Russian oil ahead of European Union sanctions that take effect from De cemberNomura5. retained its ex pectations of terminal repo rate being at 6.00% with 35 bps and 25 bps hike in Sep tember and December re spectively.“Whilethe minutes con firm that more hikes are coming, the terminal policy rate is not too far away,” analysts Sonal Varma and Aurodeep Nandi said.
Mumbai (PTI): The rupee recovered early losses to close flat at 79.84 (pro visional) against the US dollar on Monday. At the interbank foreign exchange market, the local currency opened weak at 79.90 and moved in a range of 79.78 to 79.92 during the session. It finally settled flat at 79.84 against the US dollar.
NEW DELHI | TUESDAY, AUGUST 23, 2022 07www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia Commodity Price Change % Chg GOLD 51,679.00 315.00 0.60 (Per 10g) SILVER 55,416.00 635.00 1.14 (Per 1kg) COMMODITIES Currency Price Change % Chg USDINR 79.84 0.00 = 0.00 GBPINR 94.3129 0.3604 0.3804 CURRENCIES
New Delhi (PTI): Shares of Adani Power on Monday jumped 5% after the firm said last week that it will acquire DB Power at an enterprise value of `7,017 crore. The stock climbed 5% to settle at `432.80 -- its highest permissible limit for the day -- on the BSE. At the NSE, it jumped 4.98% to `432.50. In traded volume terms, 50.59 lakh shares were traded at the BSE and over 2.45 crore shares at the NSE during the day.
Mumbai (PTI): Mortgage lenders Bajaj Housing Finance and LIC Housing Finance on Monday announced a 0.50% hike each in their lending rates. The revisions come amid a rising interest rates scenario, which has seen the RBI hiking its key lending rate by 1.40% since May. Bajaj Housing Finance hiked its rate by 0.50%, and the lowest priced product for the salaried and profes sional applicants will be 7.70% now. LIC Housing Finance has increased its prime lending rate (LHPLR) by 0.50% and the new interest rates on home loans will now start from 8% as against 7.50% previously.
*Rates till the edition went to print.
business
FALL FOR 2nd
BRIEFS Mumbai (PTI): The issu ance of Additional Tier-1 (AT-1) bonds by banks is likely to more than halve to `20,000 crore this fis cal compared to the alltime high amount of `42,800 crore raised in FY22. AT-1 bonds are those debt instruments without a terminal maturi ty date. In FY22, a majori ty of the funds raised through the instrument were to refinance bond is sues done in FY17. Major ity of the bonds have a call option in the fifth year, resulting in the significant jump in new issuances which are basically for re financing the earlier obli gations.
Naga flag and constitution as part of the solution. Thus, the NSCN(IM) affirmed that under no circumstances it can forego these core issues that symbolised the Naga national identity, the organisation said in a statement on Sunday. The NSCN(IM) and the Centre signed a framework agreement in 2015 to find a solution to the political issue. The framework agreement came after over 80 rounds of negotiations . IN RAGE
Rahul Gandhi interacts with civil society organisations at the Bharat Jodo Yatra Conclave, at the Constitution Club of India in New Delhi on Monday. —PHOTO BY ANI
The feasibility report was rejected on technical grounds that the route had curved sections
NSCN(IM) sticks to separate flag demand
New Delhi (ANI): The election for the post of president has now become a challenge for the Congress with the reluctance of party leader Rahul Gandhi to contest the polls.The Congress has completed the internal election process till August 20. The party had announced that the election for the post of president will be held between August 21 and September 20 but despite several attempts, Rahul Gandhi has not cleared the stance till now. According to sources, the Central Election Authority has made full preparations to complete the election process on time. The chairman of the authority is waiting for a meeting of the CWGwhich will announce the election dates for the post of chairman and then the authority will notify the same. Sources said the process seems to remain stuck since Rahul is not willing to contest the election for the post of Congress president. At the same time, Sonia Gandhi does not want to hold the post due to health reasons and Rahul wants a non-Gandhi should hold the post in place of CongressSonia.tried to persuade Rahul and considers Priyanka as the second option. If not, Sonia Gandhi will be asked to stay till 2024 for the sake of party unity, said sources. If the logjam continues, there may be an attempt to agree on one of the names of the leaders like Ashok Gehlot, Mallikarjun Kharge, KC Venugopal, Kumari Shailaja and Mukul Wasnik. The next few days are going to be very important for the Gandhi family keeping the time frame for Congress president election in mind which has technically started on Sunday itself.
New Delhi: (PTI) The proposed high-speed railway corridor between Delhi and Varanasi has hit a roadblock with the Railway Board rejecting the feasibility report on the project citing multiple curves along the route which will not be suitable for a bullet train to run at 350 kmph, sources said. The sources indicated that the decision was taken at a meeting held by Railway Board Secretary R N Singh last week to review the bullet train project. The feasibility study report was presented by the National High Speed Rail Corporation Limited (NHSRCL). The feasibility report proposed the corridor be built along the National Highway-2. It said this will help in the acquisition of land at cheaper rates and reducing the cost of ofthecalHowever,construction.thetechni-issuewhichledtooutrightrejectiontheproposalwasthat NH-2 had curved sections at many places between Delhi and Varanasi, which would make it highly dangerous for a train to run at 350 kilometre per hour, a source present in the meeting said. “To run a bullet train at a speed of 350 kmph, the track of high-speed corridor should be straight,” the sourceWhilesaid.NHSRCL is keen on beginning the work on the project, the Railway Board is wary, especially considering the delays and roadblocks in the ongoing bullet train project between Mumbai and Ahmedabad.Duetothe delays, sources said, the estimated cost of the Mumbai-Ahmedabad project is set to reach Rs 1.50 lakh crore . Officials said around Rs 200 crore is being spent per kilometer to build the high-speed corridor. The Railway Board has suggested that for now, the focus should be on running only semi-high speed Vade Bharat trains at a speed of 160- 200 kmph. Officials said around 400 such trains will be available over the next three years and can be used on different routes.
NARMADA
Home Minister Amit Shah in Bhopal on Monday. Modi’s ministers... The defence minister is expected to return in the evening of August 24 or first half of August 25. The SCO meeting is expected to deliberate on regional security challenges including the situation in Ukraine andExternalAfghanistan.Affairs Minister S Jaishankar is on his first official visit to South America/ He unveiled a bust of Mahatma Gandhi in Paraguay on Sunday and appreciated the Asuncion Municipality’s decision to locate it at a prominent waterfront of the city. Taking to Twitter, the EAM said, “Visited the historic Casa de la Independencia, from where Paraguay’s Independence movement started more than two centuries ago. A fitting testament to our common struggle and our growing relationship,” as he hailed the ties between the two countries.
BJP uprooted SIMI from MP: Amit Shah Bhopal (PTI): Union Home Minister Amit Shah on Monday said the BJP govt in Madhya Pradesh has uprooted “terror activities” of the banned outfit Students Islamic Movement of India (SIMI) that were centred in the Malwa region of the state. Shah said policemen have outnumbered soldiers in laying down their lives in the line of duty.He was addressing a function at Bhopal’s Ravindra Bhawan after virtually laying the foundation stone for a forensic science university, to be constructed on 27 acres of land at Barkheda Bondar near the state capital.
New Delhi (PTI): The government has developed a common portal to bring together all the awards of various central ministries, departments and agencies under one platform to “ensure transparency and public partnership”.TheUnion Home Ministry said the Rashtriya Puruskar lasthanBosethedatePuraskartheWaterdatewhichalsoRatnaforestryforfor15,Awardstionslastkindsdationsnationsrentlybyousorganisationsinateorfacilitates(https://awards.gov.inPortal)everycitizenorganisationtonom-individualsandforvari-awardsinstitutedthegovernment.Theportaliscur-receivingnomi-andrecommen-forvariousofawards.Thedatefornomina-forthePadmaisSeptemberandSeptember30theNationalAwardExcellenceinFor-2022.ThelastdatetheNationalGopalAward2022isSeptember15isalsothelastfortheNationalAwards2022.ForNariShakti2023,thelastisOctober31.ForSubhashChandraAapdaPraband-Puraskar2023,thedateisAugust31.
“If Rahul Gandhi does not become the president, it will be a disappointment for the Congress in the country. Many people will sit at home and we will suffer. He (Rahul Gandhi) should accept this post by himself, understanding the sentiments of the common Congress people of the whole country,” Gehlot told reporters.Hefurther said, “In the last 32 years, no person from Gandhi family became Prime Minister, Union Minister or Chief Minister, then why Modi is afraid of this family. Why does Delhi Chief Minister Arvind Kejriwal have to say that nothing happened in 75 years in the country. Why is everyone attacking the Congress? It is because the DNA of the Congress party and the country is the same. Congress is the party that takes all religions and classes along.” Gehlot said that Congress has kept democracy alive in the country in the last 75 years, due to which today Narendra Modi is the Prime Minister of the country and Kejriwal is the CM.
NEW DELHI | TUESDAY, AUGUST 23, 2022 082ND FRONT www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia As soon as you make a decision to quit doing below average work, you will achieve excellence. —Dr Jagdeesh Chandra, CEO & Editor-in-Chief, First India
PM does not want to tell the true history to the country, he is taking the country in wrong direction, Gehlot says
STUBBORN RAGA
FROM PG
Govt forcommondevelopsplatformallitsawards
Narmada river in spate following heavy rains at Bhedaghat in Jabalpur on Monday. —PHOTO BY PTI
Election for new president becomes challenge for Congress
Delhi-Varanasi bullet train project hits roadblock, Rly rejects feasibility report
Ports, shipping and waterways minister Sarbananda Sonowal on Monday called on Iran’s Vice President Mohammad Mokhber in Tehran. —PHOTO BY PTI CM Ashok Gehlot addressing audience at hotel Clarks, Jaipur on Monday.
Shah also inaugurated and laid the foundation stones for various projects related to housing and administrative buildings of the police department.Madhya Pradesh’s Malwa region had once become a centre of terror activities from where members of the SIMI were used to be sent to other parts of the country to carry out unlawful and nefarious acts, the home minister said. These SIMI people from Malwa were involved in “terror activities” in the entire country, he said. representational purpose only.
LEADERSHIP CRISIS
‘Why is Modi afraid of Gandhi family?’
Yogesh Sharma Jaipur: Amid speculations over Congress’s new president, senior party leader and Rajasthan Chief Minister Ashok Gehlot on Monday said that the party is unanimously in favour of its leader Rahul Gandhi for the post. Gehlot said that considering the sentiments of Congress workers across the country, Rahul Gandhi should accept the role.
Jaishankar is on an official visit to Brazil, Paraguay, and Argentina on August 22-27. During his visit, in addition to bilateral engagements with his counterparts, External Affairs Minister will call on the top leadership in all three countries. In Paraguay, EAM will also inaugurate the premises of the newly opened Indian Embassy which started functioning in January 2022. Ports, shipping and waterways minister Sarbananda Sonowal on Monday called on Iran’s Vice President Mohammad Mokhber in Tehran and reiterated commitment to strengthen Indo-Iran bilateral relations, according to an official statement. It said that India Ports & Global Company (IPGL) will open offices in Tehran and Chabahar in order to promote trade and transit via Chabahar port. 1
HIGHLY DANGEROUS NEW IG NSG Image for
Dimapur (PTI): The NSCN(IM) has said that it would not forego the demand for a separate flag and greatades,menttalkswhichgalimcialisttionliticaltoachievecircumstance(constitution)Yehzabo’inanytoafinalsolutionthevexedNagapo-issue.TheIsak-Muivahfac-oftheNationalSo-CouncilofNa-(NSCN-IM),isholdingpeacewiththegovern-forovertwodec-saiditattachesimportancetothe
Police refer to Sharjeel to oppose bail for Umar New Delhi: The Delhi Police while opposing the bail plea of Umar Khalid before the Delhi High Court referred to speeches delivered by Sharjeel Imam at Asansol, Aligarh and Gaya against CAA-NRC. The division bench of justices Sidharth Mridul and Rajnish Bhatnagar heard the arguments advanced by Special Public Prosecutor (SPP) Amit Prasad. The bench will hear further arguments on Tuesday. SPP Amit Prasad summed up his arguments on the line that the message of the speeches of Sharjeel Imam was for the mobilisation of Muslims with themes like “Muslims are in danger”, Babri Masjid, Triple Talaq, suppression of Muslims, CAA-NRC and the Kashmir issue. Amit Prasad referred to speeches given by Sharjeel Imam in Asansol Assam, Aligarh in UP and Chakand in Gaya. At the outset of the arguments, Amit Prasad said the riots were in two phases. First one was connected with the violence of December 2029 and the second phase was of February 2020 riots.
We all have a favourite pair of black skinny jeans that essentially match everything we own, and we all swear by them. As the name implies, skinny jeans are skin-hugging and just hug you. These are the best option available for showcasing the ideal traditional denim jacket, often known as the trucker jacket. The fabric used in this style of denim jacket is strong and durable.
City First offers you timeless styles of denim that are appropriate for all occasions.
The A-line form of these shorts allows your thighs City
SKINNY JEANS
FLARED JEAN SHORTS
ur lives must revolve around denim if there is only one type of fabric. This is a universal truth that is true regardless of time and place, society, or socioeconomic standing. Because there are so many options available, we can’t help but indulge in a new type of denim whenever we go on a shopping spree. It makes little difference that the tags will continue to protrude from them in our cupboards for months because we won’t be wearing them anytime soon. Life is too short to spend time wearing only one style of denim, and buying them is where the pleasure is.
www.firstindia.co.in I https://firstindia.co.in/epapers/delhi I twitter.com/ thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia 09
By applying several techniques directly at the manufacturing facility, the process of distressing jeans or any other denim aims to give the garment a vintage and damaged look. However, there are some simple DIY methods available today to use if you want to give your worn-out denim item a distressed effect.
appropriateoffersFirstyoutimelessstylesofdenimthatareforalloccasions O SHUBHANSHI PATHAK cityfirst@firstindia.co.in NEW DELHI, TUESDAY, AUGUST 23, 2022
DISTRESSED DENIM JACKET
Some additional perks can be expected by those in the private sector. An enjoyable outing is on the cards for some. Family life will cruise along smoothly and give you time for rest and recoup. A promotion or a prestigious appointment is in store for those in a government job.
cianaaspiresgreepursuingPushpawenty-year-oldBhargav,ade-inNutrition,toworkasclinicaldieti-soon.The day is not far when she will be formulating diet charts and improving the lives of countless patients. She believes she has to hustle her way to the top, from sleepless nights preparing for competitive exams and caffeinated extra hours to focus on her culinary side gig, she leaves no stone unturned. Amid the grind, she almost forgot how she suspended her basic needs and began contradicting what she preaches i.e. a healthy balanced lifestyle. Being a workaholic, popularly called a hustler in 2022, is gaining worldwide prominence among Millenials and Gen Z. We have redefined success as an endless journey of achieving more and more. Thanks to the Internet gurus, promising to teach productivity hacks and celebrity-preneurs flaunting their luxuriant life ornamented with fancy cars, picture-perfect holidays, expensive vegan diets, etc. A 100% is too less of a count, this culture demands 1,000% and more of your devotion to work and shows you a promising future of a six-plusfigure salary, corporate status and passive income due to around-the-clock grind. There’s no denying that these dreams become a reality but at a grave expense to you.
Things move positively on the academic front and encourage you to give your best. Good man management will help you in completing a project or assignment in time. Travelling with your near and dear ones to the countryside will prove immensely fulfilling. DAY Horoscope by Saurabbh Sachdeva
DECEMBER 23 - JANUARY 20 A trip with friends will be both enjoyable and therapeutic. Family life will remain stable and provide you a firm foundation from where to venture forth. This is the best time for launching your ideas at work. Money multiplies through excellent financial planning.
T GARGI ROY (She is a Neuroscience Postgraduate student at King’s College, London.)
perimentedwith.In2022,Spain’sgov-ernmenthasbeenapplauded globally for its new policy of providing paid menstrual leaves. Beating the obsession with hustle culture will require a joint effort of employees and employers. It starts with small changes in your daily routine like prioritising 8 hours of sleep, proper nutrition, and exercise and setting reasonable targets at work to curb professional cynicism and enhance efficacy. This may be complemented with regular mental health checkups performed by a registered mental healthLivingexpert.ina world of uncertainty intensified by economic recessions and unforeseen pandemics, productivity will continue to remain the currency of careerist success. However, the silver lining lies in the hope that more young professionals will gradually break the social conditioning of glorifying overworking and start living life as a whole.
Libra SEPTEMBER 24 - OCTOBER 22
Change of diet will improve health. A difference of opinion may pit you against a family elder. Those compelled to travel are likely to find interesting company. Some of you will be able to add to your wealth and even plan to buy property. You are set to enjoy the exclusive company of people.
Switching to healthy foods will be the key to remaining fit and active. A family issue may need to be deliberated upon, so that it does not disturb domestic harmony. An out of town invitation will tempt some to undertake the journey. Spirituality may bring a special meaning to your life.
Aries MARCH 21 - APRIL 20
Those in the financial sector can hope to start making profits. You may think up ways of improving your health. A major renovation work may be undertaken at home. A journey is likely to take you down the memory lane. Travel stars look bright for some, especially for overseas travel.
Your professionalism is likely to be praised at work. unexpectedSomeone’sarrival at home threatens to upset your personal plans. Seeing new places, meeting new people is in store for some. There is nothing that can go wrong today, except things involving property.
Taurus APRIL 21 - MAY 20
Leo JULY 24 - AUGUST 23
Whatsapp Subscription Subscribe “First India” Daily E-News Paper For Free On Whatsapp To Receive the Most Exclusive News from the Power Corridors of Rajasthan & Delhi. MILLENNIALS & GEN Z CAUGHT UP IN BURNOUT BLACKHOLE HUSTLE CULTURE
10ETC NEW DELHI | TUESDAY, AUGUST 23, 2022www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia facebook.com/thefirstindia I instagram.com/thefirstindia RIYA, Model DAY!THEOFFACE
FEBRUARY 20 - MARCH 20
TRACING THE ROOTS
You are likely to experience a positive phase in your existence. Favourable decision can be expected regarding a piece of property under dispute. Those in tourism and hospitality sectors will find new opportunities knocking at their door. You may take the initiative of organising a family gathering.
Meeting someone new is likely to enlarge your social circle. Something you had wanted for the home may be gifted to you. Your ideas will work on the professional front and speed up the progress. Your financial condition is not bad, but you do possess the potential to earn much more.
YOUR
Sagittarius
Scorpio
Aquarius
SCENARIO:CURRENT THE POST RAMIFICATIONSPANDEMIC
However, the tables have somewhat turned after the gruesome Covid-19 episode. Gripped by the fear of losing loved ones and our own lives, job layoffs, made many of us question our sense of self-worth beyond our net worth. Centre for Monitoring Indian Economy (CMIE) produced data stating that the number of employees, both salaried and non-salaried, fell from 398.14 million in March to 390.79 million during the second wave. This has lowered the morale of many who aligned their identity solely with work. Though this has not marginalised the hustle mania, it has given rise to a greater demand for job flexibility and work-life balance prioritising mental and physical health. Psychologist, Dr Nikitha Harish, advocating this idea of work-life balance, said, “Perseverance without selfpreservation is detrimental. Self-care and mental health are instrumental for one to realise their true potential.” Research held at the City University of New York (CUNY) states that the immediate aftermath of negative hustle culture is much more than employee burnout. Employees often hesitate to communicate their exhaustion in fear of being deemed as replaceable, therefore compromising their job security, if access to an equal or better opportunity is unavailable.Theideaof a 40-hour work week or a 4-day work week is gaining traction in many countries like Iceland and Belgium and is being widely ex-
A CNBC report dated February 2020 stated that the number of gig workers hiked by 15% since 2010. That is about six million more workers involved in the gig economy than in 2010. Professionals who had not gotten involved with freelancing started aiming for more work hours and faster promotions in their companies leading to a tight rat race.
Capricorn
Gemini MAY 21 - JUNE 21
Cancer JUNE 22 - JULY 23
Virgo AUGUST 24 - SEPTEMBER 23 Time is favourable as your real investmentsestatestart giving handsome returns. An official trip is likely to keep you tied up. Your help and support to a youngster will help boost his or her self-confidence. Those trying to achieve their professional targets will succeed. An earning opportunity may come.
NOVEMBER 23 - DECEMBER 22
Pisces
The world’s most coveted business magnate and investor once tweeted, “Nobody ever changed the world in 40 hours a week.” While this ignited a zeal in many, it also malevolently influenced professionals to keep going the extra mile often undermining the appallingThisconsequences.cultdates back to the Industrial Revolution of the 18th century. However, it currently rose to fame due to the Great Recession of 2008 when the younger workforce lost its faith in the stability of 9 to 5 jobs. This led to normalising working harder, quicker, and longer, and also marked the rise of the “gig economy” on social media where the idea of multiple side hustles seemed to be the most lucrative way to gain financial independence sooner. The gig economy has been known for its perks for a long time but owing to the growing obsession with achieving more, there was a surge in the number of work freak free lancers who were working overtime leaving no crumbs.
Businesspersons are likely to do good business today and earn well. The day proves excellent for you, both personally and professionally. Appease someone in the family to have your way.You may have to put your foot down against a trip you are reluctant to go on.
OCTOBER 23 - NOVEMBER 22
JANUARY 21 - FEBRUARY 19
You will be able to get the study stream you desire on the academic front. Going is likely to get better on the professional front. Purchasing a new car or an expensive appliance is indicated. Children can keep you entertained. The day is favourable to get a project underway.
ETC www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia facebook.com/thefirstindia I instagram.com/thefirstindia NEW DELHI | TUESDAY, AUGUST 23, 2022 11
ASHISH TIWARI cityfirst@firstindia.co.in T
Whereas Aditya Seal with wife Anushka Ranjan, Kapil Sharma, Harsh Rajput, Mohd. Nazim, Amit Dolawat, Sudhanshu Pandey, Abhijeet Sawant, Gautam Rode, Karanvir Sharma, Mahir Pandhi, Usaamah Siddiqui and the supermodels dazzled in the andwithandalsolargertivewordsHisenblackmallowprenewearingramp.hispilcomedyBhatia.byandShiegraphedwasthasignercollectionsplendidbyde-Siddar-Tytler.Theshowchoreo-byLoboanchoredKashyataActorandkingKa-SharmamarkeddebutontheHewasseenablackneo-meshMarsh-jacketwithvelvetandgold-embroideredpants.presenceandkindfortheinitia-madetheeventthanever.ThegirlsofBetigracedtherampwerehonouredimmenseloveappreciation.
WithFCELEBRATINGASHIONACause!
Anu Ranjan with models and showstopper Kapil Sharma
Shashi Ranjan, Shabana Azmi, Kapil Sharma, Ramesh Taurani and Anu Ranjan
he toteryanothercreatedmovementbleunstoppa-‘Beti’yetglit-occasionputacross the message of girl child education. The Beti Fashion Show, a movement, an initiative by Anu Ranjan, Founder of NGO Beti, was held on, Sunday, 21st August 2022 at JW Marriott Hotel, Juhu, Mumbai.Likeevery year, this mega event saw the who’s who of the entertainment industry walking the ramp as well as cheering their best as an audience. The show was attended by many TV, film and social media personalities.Theshow was attended by Shabana Azmi, Poonam Dhillon, Akshara Hassan, Payal Rohatgi, Pooja Batra, Akansha Ranjan, Suzzane Khan, along with Gulshan Grover, Satish Shah, producer Ramesh Taurani, Nikhil Dwivedi, Vishal Kotian, Arsalan Goni, Nikita Rawal, Lisa Mishra, Zaeden, Mohit Rai, Isha Bhansali, Rahul Gangwani and many celebrities graced this event with their presence.
Vishal Kotian and Ashish Tiwari
Payal Rohatgi Kapil Sharma, Pooja Batra and Roshni Walia Aditya Seal and Anushka Ranjan Kapoor Akshara Haasan Sudhanshu Pandey
CITY FIRST S hahnaz Husain, a pert,skin-careprominentexwhohas helped put India on the world beauty map, shares her journey in an exclusive interview with City First In what way do you feel has the beauty in dustry evolved since the time you launched your brand? When I started my ca reer, 50 years ago, I re jected the existing con cept of beauty and adopted my own. At that time beauty treat ments were mainly “colour and cover.” Only superficial beauty treatments and hairstyling were available, without the awareness that beauty is the outcome of longterm care. The “back to nature” trend had not yet begun. I became known as the pioneer of herbal beauty care. It is herbal beauty care, which has driven the growth of the beauty in dustry in India over the last few decades. Over the years, awareness of beau ty products and treat ments has increased. This is attributed to ex posure to global trends and lifestyle changes, higher disposable in comes and the trend to wards fitness and youth. How has the online space changed the game in the industry? The internet has changed the way we do business. Online shopping gradu ally became the trend. During and post the pan demic, the aspect that has seen a surge in growth is e-commerce and the on line beauty business, as compared to brick and mortal retail shops. What are your thoughts on the influence of social media on the beauty in dustry? Have you tried influencer marketing too? As already mentioned, the internet plays an im portant role in market ing products and using social media platforms, like Facebook, Insta gram, as well as using one’s Website and other online platforms for brand building, publish ing content to market.
SHAZID
12 NEW DELHI | TUESDAY, AUGUST 23, 2022www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia facebook.com/thefirstindia I instagram.com/thefirstindia CITY BUZZGETSTAYVACCINATEDMASKED
STARS IN THE CITY!
An organisation that will contribute to im provements in the wellbeing of children and victims of domestic vi olence. Ashoka Founda tion aims to support those going through difficult circumstanc es, neglect and abuse. The foundation pro motes mental well-be ing through awareness and workshops on counselling, Holistic healing and recreation al therapies. The Launch was attended by dignitaries such as Neelam Pratap Rudy, Bhavana Minocha, Alka Kapur, Dr Sho vana Narayan and Dr Navnit Haror. This was followed by a Panel dis cussion by experts Alka Kapur (Educa tionist), Anandmai Ku mar (Holistic Healer), Yutikha Kapoor (Psy chologist) and Devna Mehra (Mental Health Therapist) on the emo tional and mental wellbeing of children and how it is crucial to be mindful when it comes to a child’s emotional experience.ShamaSoni, Founder of the Ashhwika Foun dation said, “Being a mother, I know how a parent feels when their child is emo tionally distressed and is unable to get out of that mindset on their own. This foun dation is created with the thought of tak ing care of as many people as we can in overcoming emo tional and psycho logical trauma.”
The theme highlights that physical activity as a component of a healthy lifestyle can preventThereCancer.isstrong evi dence to show that higher levels of physi cal activity are closely linked to the preven tion of chronic diseas es including cancers, over 200 women cy clists participated in a cyclotron to create awareness about leading a physi cally active lifestyle. En route the cyclists took a halt at Delhi Government Primary School, Madangir and Saidham, Hauzkhas where free health check-up camps were organised for a free screening of Breast, Cervix and Oral can cer, the three most common cancers in women in our country which can be prevent ed or detected early through screening.
“The rise in the inci dence of cancer has a lot to do with tobacco & alcohol consumption and poor lifestyle choic es especially sedentary way of life. Studies have shown a direct correlation between higher levels of physi cal activity and lower risk of several types of cancer. The cyclotron was organised to spread this message of leading an active lifestyle, espe cially amongst wom en”, said Dr Gauri Ka poor, Medical director of RGCIRC Niti Bagh. The drive was titled “Hope on the Wheels”. Wheels are a meta phor for an active life style that has gener ated the hope for re ducing the morbidity caused by major noncommunicable diseas es including cardio vascular diseases and several types of can cer, Dr Kapoor added.
EVOLUTION IN SKIN CARE WITH SHAHNAZ!
THE GREAT LAUNCH! S
CITY FIRST hama Soni Foundation’.‘AshhwikalaunchannouncedSoniAshhwikaandrecentlytheofthe
Famous Bollywood stars including Ananya Panday and Vijay Devarakonda were spotted in Delhi for the promotion of their upcoming blockbuster Liger on Monday. —PHOTO BY SHAZID CHAUHAN Estee Lauder, a global leader in skincare, makeup and fragrance; and renowned for highquality, innovative and ofmanyeventoninNightfacepageant,MisswinnerChhillar,celebrateancelebratedadvancedtechnologicallyproductseveningtoManushitheoftheWorld2017astheirforAdvancedRepairDelhiMonday.Thewitnessedwho’swhothecity. BY CHAUHAN
HOPE ON WHEELS!
CITY FIRST C yclothon (a Cy cle Rally by Women organisedcyclists)by Rajiv Gandhi Cancer Institute & Research Centre (RGCIRC), Niti bagh (South Delhi) in association with Rota ry International Dis trict 3011 to spread awareness about can cer in women and the importance of screen ing and early detection.
CHAUHANSHAZIDBY—PHOTOS
Sayali Bhagat and Dr Gauri Kapoor During the event Shahnaz Husain
SHINE OF HER SOUL! (L-R) Manager Zaid Faizee, Deep Nagpal and Rajesh Kaira Yutikha Kapoor (L-R) Gauri Minocha and Bhavana Minocha (L-R) Poorvi Badhwar and Nargis Badhwar (L-R) Shailija Sachdeva and Poonam Puri (L-R) Anandmai Kumar and Devna Mehra (L-R) Neelam Pratap Rudy and Alka KapurDeepti Goswami Guests during the event Dimple FouzdarManushi Chhillar Pooja and Nitya Gouri, Ambika and Nitya Manish Mishra and Vikram Seth (L-R) Shama Soni and Ashhwika Soni
—PHOTOS
CHAUHANSHAZIDBY—PHOTOS
A bit about the Founder: Shama Soni is a Delhi-based Entrepre neur, a true philanthro pist with a disruptive mindset and innovative thinking driven by en trepreneurial insight. In her entire career of 16 years, she has come a long way and excelled in every position, dog ging all the challenges life has thrown at her.
