On Wednesday, the AAP alleged that four of its MLAs had been offered Rs 20 crore each to defect to the BJP and another Rs 25 crore to bring other MLAs along. While the BJP denied these charges, asking the AAP to provide its proof Turn to P2 CM Arvind Kejriwal arrives at Rajghat along with 53 party MLAs. AAP MLAs coming out of the CM’s residence after their meeting.
"I do not understand the reference to third party interference. The India-US exercise is something completely different and I do not know what colour has been given that it is targeted there or it is violating any existing agreement," External Affairs Ministry spokesperson Arindam Bagchi said. His comments came when asked at a media briefing about the remarks on the exercise by a spokesperson of China's Ministry of National Defence (MND) In his remarks, Senior Colonel Tan Kefei said he hoped that India will abide by the bilateral agreements not to hold military drills near the Line of Actual Control (LAC)."The two sides should stick to the agreements (signed) in the past and obviously that did not happen," Bagchi said in retort.
GOVT RESTRICTS EXPORT OF WHEAT FLOUR New Delhi: The government on Thursday decided to put restrictions on the export of wheat or meslin flour to curb rising prices of the commodity. The decision was taken at a meeting of the Cabinet Committee on Economic Affairs (CCEA), chaired by Prime Minister Narendra Modi here.
Raids on RJD leaders is BJP’s anger: Nitish Patna: A day after the CBI raids on five leaders of the RJD in Bihar, CM Nitish Kumar just gave a smile in answer to questions of waiting mediapersons. “You would see what will happen in future,” Kumar said while hinting that the BJP top leadership ‘acted in anger’. The leaders of Mahagathbandhan are expecting more raids in the future, said sources. Nitish along with deputy CM Tejashwi went to the statue of socialist leader BP Mandal to pay gratitude on his birth anniversary.
New Delhi: The BJP on Thursday announced several top-level appointments in various states. In a significant political play, Bhupendra Singh Chaudhary, a minister in the UP govt and a member of the Legislative Council, has been made its UP President.
New Delhi (ANI): Union Home Minister Amit Shah on Thursday chaired a high-level meeting to review the security situation in Jammu and Kashmir. The meeting started around 3 pm at the Home Ministry in presence of National Security Advisor Ajit Doval, Union Home Secretary Ajay Bhalla, Jammu and Kashmir Lieutenant Governor Manoj Sinha, Army Chief Manoj Pandey, Jammu and Kashmir Manoj Sinha and Research and Analysis Wing Chief Samant Goel. Central Reserve Police Force (CRPF) Director General Kuldiep Singh, Border Security Force (BSF) chief Pankaj Singh and National Investigation Agency (NIA) Director General Dinkar Gupta also attended the meeting which was held in hybridJammumode. and Kashmir Director General of Police Dilbagh Singh was also present at theItmeeting.islearnt that Shah was apprised about the condition of cross-border infiltration, the present situation of terrorism in Jammu and Kashmir and other issues linked to it.
NEW UP BJP CHIEF New Delhi: Prime Minister Narendra Modi will inaugurate Smriti Van in Bhuj, which celebrates the spirit of resilience shown by people following the 2001 earthquake in Gujarat, during his two-day visit to the state from Saturday.
INFILTRATION BID FOILED ALONG LOC IN J&K’S URI, 3 INTRUDERS KILLED Srinagar (Agencies): An infiltration bid on the Line of Control (LoC) in the Uri sector in Kashmir was foiled by the Army on Thursday in which three intruders were killed. Official sources said that alert troops of the Army foiled the infiltration bid on the LoC in the Kamalkote area in Uri. “Intruding terrorists were challenged after which an encounter took place in which three terrorists were killed. “Arms and ammunition have been recovered from the slain terrorists. Searches are now going on in the area,” sources said.
BSE SENSEX 58774.72 310.71 | NSE NIFTY 17522.50 82.50
First India Bureau New Delhi: Accompanied by more than 50 AAP MLAs, Delhi CM Arvind Kejriwal headed to Rajghat on Thursday, to pray at the Mahatma Gandhi memorial there, after a suspenseful gathering at his residence where one question hanged on everyone’s mind – how many party MLAs had reached?Rajghat was soon witness to another drama: BJP’s Yuva Morcha activists pouring Gangajal to “purify” the Gandhi Samadhi. The BJP youth wing’s leader Abhimanyu Tyagi said, “The reason behind our pouring Ganga Jal is that AAP is earning money by perpetrating a scam in selling liquor and trying to save themselves by using Bapu’s name. They should have realised that Bapu was against alcohol.”
Panaji: The Goa Police on Thursday registered a murder case to probe the death of BJP leader Sonali Phogat. The 42-year-old actor-turnedpolitician died of a suspected heart attack in Goa on Tuesday with her family questioning the circumstances leading to her death. Goa Police DG Jaspal Singh said they will interrogate BJP leader and actor Sonali Phogat’s two associates Sudhir Sagwan and Sukhwinder Wasi after her post-mortem report mentioned that there were “multiple blunt force injuries” on her body. The Goa Police had registered a charge of murder against the two associates after the post-mortem report was issued.Section 302 (murder) of the Indian Penal Code was added to the case related to the death of the 42-year-old leader. Sagwan and Singh, who had accompanied Phogat when she arrived in Goa on August 22, were named as accused. New Delhi (PTI): The Centre has given twoyear extension to six ‘lateral entrants’ who were inducted as joint secretaries in central government ministries in 2019, sources said. The government had advertised 10 vacancies for joint secretaries, but only nine were shortlisted from more than 6,000 applicants and only eight joined. While Arun Goel, JS DPIIT, resigned after two years and returned to the private sector, Amber Dubey who joined the Civil Aviation Ministry has desired to return to the private sector after threeThoseyears.who have given extensions as joint secretaries are Sujit Kumar Bajpayee (Environment, Forest and Climate Change), Saurabh Mishra (Ministry of Finance), Rajeev Saksena (Economic Affairs), Dinesh Dayanand Jagadale (New and Renewable Energy), Suman Prasad Singh (Road Transport and Highways) and Bhushan Kumar (Ministry of Shipping).
New Delhi (PTI): India on Thursday rejected China's objection to an Indo-US military exercise in Uttarakhand in October.India's reaction came after China's defence ministry, referring to the planned exercise, said it was firmly opposed to any third party "meddling" in the border issue. The 18th edition of the exercise "Yudh Abhyas" is scheduled to take place from Oct 14 to 31 in Auli.
OUT ON SUSPENDEDBAIL,BJPLEADERTRAJAHELDAGAIN Hyderabad: Telangana BJP MLA T Raja Singh was arrested on Thursday for allegedly making derogatory remarks about Prophet Mohammed in April, said the Hyderabad police, which had issued two notices under CrPC, which allows arrest without a warrant.
High drama at Rajghat after biting suspense at CM’s residence
SESSIONSPECIAL,ASSEMBLY’SSTORMYTODAY
PM NARENDRA MODI TO VISIT GUJARAT ON CHAUDHARYBHUPENDRASATURDAYIS
INDIA AIMS TO ROLL OUT 5G BY OCTOBER 12
New Delhi (ANI): The Supreme Court on Thursday issued notice to the Gujarat government on a plea challenging the remission granted by the State to 11 convicts who had gang-raped Bilkis Bano and murdered her family members during the 2002 Godhra riots. A bench of Chief Justice of India NV Ramana and Justices Ajay Rastogi and Vikram Nath sought a response from the Gujarat government and posted it for hearing after two weeks. It also asked petitioners to make 11 convicts party in the case.
Jaipur: The ACB nabbed Govindgarh SHO in Jaipur SharmaHarinarayanfortaking`6 lakh bribe, Barmer DEO Kesardan Ratnu & 2 brokers with `50,000 bribe, and Vijay Chhabra, an RSRTC Hanumangarhoperator,Depot with `40,000 bribe.
New Delhi: The Delhi Assembly’s special session convened Friday is likely to be a stormy affair amid a slugfest over central probe agencies’ action in the tocusingpolicygovernment’sKejriwalexciseandtheAAPac-theBJPoftryinglureitsMLAs.
Home Minister Amit Shah chairing a review meeting on J&K security, in New Delhi on Thursday. Also seen are J&K LG Manoj Sinha, NSA Ajit Doval and Home Secy Ajay Bhalla.
Mumbai: Equity benchmarks ended lower on Thursday as a fag-end sell-off wiped out early gains, with IT and bank stocks playing spoilsport amid monthly derivatives expiry. The Sensex ended 310.71 points lower.
Sonali Phogat’s death: Goa Police lodges murder case 2-yr extension to ‘lateral entry’ joint secretaries Bilkis case: Notice to Guj on remission of 11 convicts US Delhideportedjournalistfromairport
India rejects China’s objection to Indo-US military drills in U’khand
—PHOTO BY ANI Amit Shah reviews
A view of Parliament House, Rashtrapati Bhavan and other buildings in New Delhi on Thursday.
‘THERE IS A SERIAL KILLER WHO HAS COMMITTED SIX MURDERS’ Amid all the drama, Kejriwal posted a cryptic tweet later in the evening, saying media is asking for evidence. “There is a serial killer who has committed six murders in similar pattern. He attempted another murder in the same patter this time. He failed with similar pattern in a murder this time.“The victim is saying he attacked him and I saw it. But the entire media is asking for evidence from the victim. There is an eyewitness, the pattern is there, at least arrest him. The police will gather the evidence,” he wrote.
J&K security at high-level meeting
“The woman came out of the station to take food for her husband, while he waited. She met five men from whom she inquired about a restaurant. On the pretext of taking her to a restaurant, the miscreants took the victim towards railway yard and gang-raped her,” police said.
POWER CENTRE
New Delhi (PTI): American journalist Angad Singh was deported to New York soon after he landed here on Wednesday night, his mother claimed in a Facebook post.Singh, who givesaid,backPutinhourscitizenGurmeetvisitAsia,NewsdocumentariesproducesforVicewithafocusonwasonapersonaltoIndia,hismotherKaursaid.Myson,anAmericanwhotravelled18toDelhitovisitusPunjab,wasdeported.inthenextflighttoNewYork,Kauraddingtheydidnotareason.
ACB NABS SHO, DEO, OTHERSTHREE
PTIBY—PHOTOS PTIBY—PHOTO www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia NEW DELHI l FRIDAY, AUGUST 26, 2022 l Pages 12 l 3.00 RNI TITLE NO. DELENG/2021/19840 l Vol 1 l Issue No. 357 OUR EDITIONS: JAIPUR, NEW DELHI & MUMBAI SETTLEMARKETSLOWERONFAG-ENDSELL-OFF
READ Crucial
New Delhi: India is gearing up for the roll out of 5G services by October 12, saidMinisterInformationElectronicsCommunications,UnionandTechnologyAshwiniVaishnawonThursday.
Woman gang-raped by 5 men at Jaipur Rly Station Satyanarayan Sharma Jaipur: A married woman was allegedly kidnapped and gangraped by five men in a railway yard at Jaipur Junction on Wednesday night. The victim and her husband had to board a train.
EMA spokesperson Arindam Bagchi
OUR YOUNGEST CHILD’
An aspirant gets himself registered under the Agnipath recruitment scheme in Poonch in J&K.
PREPARATIONS DONE
Prashant Bhushan, appearing for some other petitioners, said the court may say that the appointment through the Agnipath Scheme will be subject to the outcome of the writ petitions.
—PHOTO BY ANI
New Delhi (PTI): Police have formally arrested a man who was lodged in Mandoli jail in connection with a double murder that took place earlier this week, officials said on hanhospital,broughtJoginderBakkarwala.dentsvictimsMundkathempeoplepleinjuriesamenmistakentakenmurderslagedentAnkeshthePoliceThursday.identifiedarrestedmanasLakra,aresi-ofMundkavil-andsaidthemayhaveplaceduetoidentity.OnMonday,twowerekilledandpersonsustainedafteracou-ofunidentifiedopenedfireatinwestDelhi’sarea.Thewereresi-ofJJColonyinMangal(60)and(42)weredeadtothewhileMo-Lal(62)isundergoing treatment, policeCCTVsaid. footage had showed two men aged between 25 and 28 years coming from Bakkarwala village at 9.05 pm and running back after a few minutes.Police had registered a case at Mundka station and during investigation, they interrogated a man near the crime spot and he said he had been receiving extortion calls for a month. Following this, the police had added Section 120-B (criminal conspiracy) of the Indian PenalPoliceCode. said the man they quizzed may are the killers’ target but they ended up opening fire at Mangal and Joginder. However, this is yet to be confirmed, they said.
LIFE SAVER
Twin towers to be razed on schedule: Noida Authority CEO
two arrested: Delhi Police
“Rishant was the sixth and youngest child. I was busy leaving for work on the morning of the fateful day and couldn't even hold my baby in my arms. It breaks my heart that we have lost him. But when we came to know about donation,organIfelt that if his organs can save the lives of others, then I must donate them," the father said.
New Delhi (PTI): The Delhi Police on Thursday said it has busted a gang dealing in illegal firearms with the arrest of two men allegedly sourcing weapons from Madhya Pradesh and supplying those in the Delhi-NCR, Haryana and western Uttar Pradesh.Pramod Kumar (35) and Rohtash (31), both of Uttar Pradesh, have already supplied more than 500 firearms in the Delhi-NCR in three years. They were arrested in Delhi, the police said, adding they have been booked under sections of the Arms (Amendment) Act, 2019. The police said 12 good-quality pistols and 45 live cartridges were seized from them. Deputy Commissioner of Police (Special Cell) Jasmeet Singh said, “Our team has busted an interstate gun-running racket by arresting two arms suppliers. Both of them were arrested in the evening of August 22 near the Modi mill bus stop on Captain Gaur Marg in New Delhi where they had come to supply firearms and ammunition to one of theirTheycontacts.”aremembers of an interstate arms syndicate led by a Madhya Pradesh-based illegal arms manufacturer, he “Duringsaid.interrogation, they disclosed that they received the consignment of the seized pistols and cartridges from an arms said.Rsthempiecepistols10,000automaticusedficerPradesh,”Sendhwaturer-cum-suppliermanufac-ofinMadhyatheseniorof-said.Theaccusedtoprocuresemi-pistolsforRsandsingle-shotforRs3,000afromMPandsellforRs25,000and6,000respectively,he Delhi police arrested 2 notorious firearms suppliers and recovered 12 pistols and 45 live cartridges from them, in New Delhi on Thursday.
NOIDA CEO Ritu Maheshwari speaks to the media in Noida on Thursday. —PHOTOS BY PTI Barricades used to block a road leading to the Supertech towers in Noida.
Noida: “Nobody but God can stop us now,” the project manager responsible for the demolition of Supertech’s illegal twin 40-storey towers today said as he explained how the structures, taller than the Qutub Minar, will be demolished in seconds on Sunday. All final preparations are done, Mayur Mehta, a Project Manager at Edifice Engineering which is responsible for the demolition, told reporters. Noida Authority CEO and Noida Police Commissioner also visited the site today to take stock, Mehta said, adding that all the floors have been wired with explosives today. “We have today connected the explosives on each floor to the wire and will set them off by pressing a button from 100 meters away,” he said. Such a big demolition has never happened in India before, he added, though the company has done bigger ones in Africa. Mehta said the dust will remain for 12-15 minutes after the demolition but the debris.
HC won’t stay Agnipath, asks Centre to file reply
FROM PG 1 CM Kejriwal prays at the Gandhi Memorial at Rajghat on Thursday after the meeting of party MLAs at his house.
—PHOTO BY ANI High drama at... the latter held a meeting of its nine-member Political Affairs Committee and then scheduled a meet of all party MLAs at 11 am the next day at Kejriwal’s house as a show of strength. Hours before the Thursday meeting was to start, some AAP leaders claimed that 6-7 party MLAs were not reachable by phone. As 11 am drew closer, anxiety started to spread, with over a third of the MLAs not reaching the CM’s bungalow at Civil Lines on Finallytime.atnoon, the AAP said that all its MLAs who were supposed to make it to the meeting had reached Kejriwal’s house and that the AAP government was stable.
TAKING OVER COMMAND
CAPITOL NEW DELHI | FRIDAY, AUGUST 26, 2022 02 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
New Delhi (PTI): The family of a 16-monthold boy who suffered fatal injuries due to a fall and was declared brain dead at the AIIMS in Delhi donated his organs, offering a fresh lease of life to twoAccordingpatients.to doctors, the boy was the youngest organ donor at the AIIMS.Hiskidneys and liver were transplanted in two other kids, while his heart valves and corneas have been banked at the AIIMS, theyThesaid.boy, Rishant, suffered a fall and was seriously injured on August 17. His father, Upinder, a private contractor, took him to a nearby private hospital in Jamuna Park. He was transferred to the Jai Prakash Narayan Apex Trauma Centre at the AIIMS the same afternoon.“The child was born to donate. He fought for eight days after suffering severe head injury. He had sustained severe head injury and CT scan showed irreversible severe damage to the whole brain,” Dr Deepak Gupta, Professor of Neurosurgery at AIIMS, told PTI. He was declared brain dead on August 24. The grief stricken family was counselled by the doctors and transplant coordinators of the Organ Retrieval Banking Organisation (ORBO) at AIIMS and they were informed about organ donation.After counselling, the family agreed to donate his organs and tissues, doctors said. The retrieval of organs began at 2 AM on Thursday and continued till 5 AM. Both kidneys have been transplanted in a five-year-old boy at the AIIMS and liver has been transplanted in a six-month-old girl at the Max Hospital. His heart valves and corneas have been banked at the AIIMS.
Noida (PTI): The final review of preparations for demolition of Supertech’s illegal twin towers was done on Thursday and they will be razed as per schedule on August 28 at 2.30 pm, Noida Authority CEO Ritu Maheshwari said.
New Delhi (PTI): Nearly 6,700 corruption cases probed by the CBI were pending trials in different courts, 275 of them for more than 20 years, according to the latest annual report of the Central Vigilance Commission (CVC). A total of 1,939 cases were pending trials for more than 10 years and up to 20 years, 2,273 for more than five years and up to 10 years, 811 for more than three years and up to five years and 1,399 cases for less than three years, as on December 31, 2021, it said. “The Commission, during monthly meetings with CBI, takes note of the large number of cases pending trial in different courts for long periods, said the CVC annual report 2021. As on 31.12.2021, 6,697 cases were pending trial, out of which 275 cases are more than 20 years old, it said. Besides, a total of 10,974 appeals and revisions were pending in high courts and the Supreme Court. Of the total of 9,935 appeals, 9,698 were in high courts and 237 in the Supreme Court. There are 1,039 revision pleas pending in the high courts, the report stated. Out of 10,974 appeal and revision pleas pending in high courts and in the apex court, 361 were pending for more than twenty years, 558 for more than 15 but less than 20 years, 1,749 for more than 10 but less than 15 years, 3,665 for more than five but less than 10 years, 2,818 for more than two but less than five years and 1,823 for less than two years, it said. As many as 645 corruption cases were pending investigation by the CBI, 35 for more than five years, the report said. Of the total cases, 60 were under probe for over three years but less than five years, 71 for more than two years but less than three years, 162 for more than one year but less than two years and 317 for less than a year, said the report tabled in Parliament in the recently-concluded session and made public on Wednesday.
CENTRAL VIGILANCE COMMISSION HIGHLIGHT
Mundka double murder case of ‘mistaken identity’
16-month-old boy who suffered fatal injury after fall becomes youngest organ donor
Nearly 6,700 corruption cases probed by CBI pending court trial
Lt Gen Dhiraj Seth assumed the command of Delhi Area from Lt Gen Vijay Kumar Mishra, in New Delhi on Thursday. —PHOTO BY ANI
New Delhi (PTI): The Delhi HC on Thursday refused to stay the Centre’s Agnipath Scheme for recruitment in the armed forces and asked the central government to file its reply on a batch of petitions challenging the scheme. A bench of Chief Justice Satish Chandra Sharma and Justice Subramonium Prasad granted four weeks to the Centre to file the response. The court asked the Centre to file a consolidated reply on petitions challenging the scheme and separate replies on those pleas which have challenged the recruitment processes in accordance with the previous advertisements in the Army, Navy, and Air Force before the introduction of the Agnipath Scheme. Counsel for one of the petitioners urged the court to stay the operation of the scheme till the petitions areThedecided.court, however, refused to stay the scheme saying that it was not passing any interimAdvocateorder.
Inter-state gang dealing in illegal firearms busted,
‘WAS
The Noida Authority, which functions under the Uttar Pradesh government, is overseeing the demolition of the nearly towers,”safebeandaspectspreparations,getgroupsingallmeetingEmerald93Astructures100-metre-tallinSectorofthecity.MaheshwarivisitedCourtandawasheldwithstakeholdersinclud-localresidents’concerned.“ThemeetingwastoanoverviewofthetechnicalofdemolitioncomplianceslefttocompletedforthedemolitionofthetheseniorIAS officer said. Maheshwari said, “The twin towers would be demolished at 2.30 pm on August 28 in compliance of the order of the Supreme Court.” Officials of the Central Building Research Institute, the Supreme Court-appointed technical expert, also attended the review meeting and said there will be no delay in the demolition. “We wanted the residents to be satisfied with the preparations. They said they are nontechnical people but are more than satisfied by the preparations,” CBRI’s scientist D P Kanungo said. He said the CBRI is also satisfied with the planning and preparations done by demolition firm Edifice Engineering and its expert South African partner Jet Demolitions. ‘ONLY GOD CAN STOP US’
"We donate food, clothes, money to the needy. Today our child is no longer with us, only his memories and body remains," said Upinder.
CM Kejriwal with party MLAs pays homage to Mahatma Gandhi and prays for the failure of BJP’s ‘Operation Lotus’ at Rajghat in New Delhi on Thursday. —PHOTO BY PTI
New Delhi (PTI): The Delhi High Court has granted bail to a 19-year-old rag-picker in a case concerning the communal clashes in Jahangirpuri on the eve of Hanuman Jayanti earlier this year. Justice Yogesh Khanna noted that the accused, who was in custody since April, was not identified in the CCTV footage and was not required for the purpose of investigation and thus admitted him to bail on a personal bond of Rs 20,000 with one surety of the likeTheamount.court, while releasing the accused, directed him to maintain peace in the vicinity and not leave the area of the national capital region without prior permission of the trial court. It also asked him to provide his contact number/address to the police.
Forest land allotted for Skill University without approval
New Delhi (PTI): The BJP on Thursday sprinkled ‘Ganga jal’ on Rajghat after AAP legislators had visited the memorial, and its MP Manoj Tiwari took the point further by comparing Arvind Kejriwal to Joseph Goebbels and accusing him of lying repeatedly.TheDelhi unit of the BJP also hit out at the AAP, saying its various allegations were like a “movie script” meant to mislead the public on the “scam” in Delhi’s now-scrapped excise policy 2021-22. The BJP alleged that by visiting Mahatma Gandhi’s memorial Rajghat, AAP supremo Kejriwal has desecrated the place and the BJP workers sprinkled ‘Ganga jal’ there to “purify” it. Reacting to the AAP’s claims that the BJP was trying to poach its MLAs with an offer of Rs 20 crore each to switch sides, Tiwari said that everyday the AAP was coming up with old “movie scripts” to divert the public from the real issue.
New Delhi (PTI): Delhi Chief Minister Arvind Kejriwal on Thursday questioned the source of the Rs 800 crore allegedly offered by the BJP to 40 AAP MLAs for switching sides and asserted that his government is stable. After a meeting of the Aam Aadmi Party (AAP) legislators at his residence, Kejriwal, along with his MLAs, went to Rajghat to pray for the failure of the Bharatiya Janata Party’s (BJP) “Operation Lotus”.“They (BJP) offered Rs 20 crore each to our MLAs. They have kept Rs 800 crore for toppling the Delhi government. But the citizens of the country want to know about the source of this money. Is it from GST or the PM CARES Fund? Have some of their friends given them this money?” he asked. The chief minister said his deputy Manish Sisodia, who is being probed by the CBI for alleged corruption in the Excise Policy 2021-22, has been named in a “false“EvenFIR”.mattresses and walls at Sisodia’s residence were searched by the CBI but not even a single unaccounted penny was found. No objectionable documents or jewellery were found. We were thinking why was this happening with us since they also know that Sisodia is an extremely honest man and a patriot who has worked on education in the national capital,” he said.Reiterating Sisodia’s claims, Kejriwal said a day after the CBI’s raids, the deputy chief minister was approached by the BJP with an offer of the chief minister’s post. “The next day after the raids, they sent a message to Sisodia that you leave Kejriwal, get some MLAs and come to us. We will topple the Delhi government and close the CBI, ED cases against you. I think I would have done some good deeds in my past life that I have got a companion like Sisodia. They were offering him the chief minister’s post but he refused. He rejected their offer,” Kejriwal said. He further alleged that the BJP is “offering Rs 20 crore each” to AAP MLAs with a design “to topple the Delhi government”.“Iamextremely happy that no MLA has yielded under pressure. I want to tell the people of Delhi that they have voted for a hardcore honest government,” Kejriwal said.
Delhi High Court grants bail to 19-yr-old rag-picker
BJP’s ‘Operation Lotus’ has failed in Delhi: Saurabh Bhardwaj
The CEC has asked the PCCF to ensure that the land use of the forest land be changed to “forest” in all government records, including those of DDA and the Revenue Department. It also asked the PCCF to direct the departments concerned to not allot any forest land for non-forestry purposes without the approval of the central government and the Supreme Court.
New Delhi (PTI): Aam Aadmi Party (AAP) MLA Atishi on Thursday lambasted Prime Minister Narendra Modi for not addressing “big problems” in the country like inflation and instead focusing on bringing down state governments.Addressing a press conference after the MLAs’ meeting, Atishi, who is AAP’s political affairs committee member, said, “India is going through a crisis. There are many big problems in front of India. But it is very sad that PM Narendra Modi does not have time to solve big problems. Instead, PM Modi’s entire energy and hardwork are focused on how to bring down state governments. CBI and ED raids are being conducted.”
PM Modi’s focus on govts:downbringingstateAtishi
BJP supporters hold a protest in New Delhi on Thursday against Manish Sisodia and his alleged corrupt excise policy.
“The forest land has been allotted for nonforest use by the Director, Panchayat, Government of NCT Delhi, without the prior approval of the central government in violation of the Forest (Conservation) Act, 1980 and various orders of the Supreme Court,” it said in a communication, dated August 22, to the Delhi chief secretary. “The Principal Chief Conservator of Forest, Delhi, re-confirmed that the 37.11 acres of land in Jaunapur is part of the notification issued in 1996 under Section 4 of the Indian Forest Act, 1927,” the communication read.
n Says inSisodiaManishnamed‘falseFIR’ n underMLAhappy‘Extremelythatnohasyieldedpressure’ n Stage set for stormy Assembly session today
The AAP MLAs at CM Kejriwal’s residence for the 11am meeting on Thursday. —PTI PHOTO
Kejriwal questions source of by to 40 AAP MLAs
The CEC said it had written to the Delhi chief secretary in July last year seeking clarification on the matter and that the city government was yet to provide a reply “despite repeated reminders”. It said the forest land measuring 37.11 acres in Jaunapur, since transferred to the Department of Training and Technical Education, for constructing the proposed skill centre and Delhi Skill University, has been shown as “residential” in the records of the Delhi Development Authority.
New Delhi (PTI): The Supreme Court-appointed Central Empowered Committee (CEC) has said the city government’s Panchayat Department has allotted forest land for the construction of a worldclass skill centre and Delhi Skill University in Jaunapur in south Delhi without prior approval from the central government.According to the Forest (Conservation) Act, 1980, prior permission of the central government is required for dereservation or diversion of forest land for non-forestry purposes.
CAPITOL NEW DELHI | FRIDAY, AUGUST 26, 2022 03 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
AAP MLA Saurabh Bharadwaj addresses a press conference on Thursday. —PHOTO BY PTI
New Delhi (PTI): A total of 53 AAP MLAs out of 62 attended a meeting convened by party supremo and Delhi Chief Minister Arvind Kejriwal on Thursday to discuss alleged poaching attempts by the BJP, sources said. The meeting that was scheduled to begin at 11 am was concluded within a few minutes, they said, adding that all the 62 legislators of the Aam Aadmi Party (AAP) in Delhi were contacted ahead of the meeting at Kejriwal’s residence.The sources said at least a dozen AAP MLAs had gone incommunicado ahead of the meeting.
—PTI PHOTO
“This is a total flop show of the AAP. Kejriwal ji you have to speak on the excise policy but your silence on this issue says a lot. You always come up with the same old, worn-out movie script to divert public attention. Arvind, you have become a descendant of Goebbels, who used to think that if you keep telling the public a lie, they will start believing it as a truth,” Tiwari said. Goebbels was the propaganda minister in Adolf Hitler’s Nazi government.
`800 crore ‘offered’
PARL PANEL REPORT STRICT INSTRUCTIONS
New Delhi (PTI): BJP’s “Operation Lotus” has failed in Delhi, the AAP said on Thursday, asserting that it will stay in touch with its MLAs to ensure they do not get influenced by the saffron party. The AAP also alleged that 40 of its Delhi MLAs were targeted by the BJP with an offer of Rs 20 crore each to switch sides, even as all the 62 of its legislators were accounted for during a meeting at Chief Minister Arvind Kejriwal’s residence here. AAP chief spokesperson Saurabh Bhardwaj said the country has seen BJP’s tactics of luring MLAs of other parties in states such as Maharashtra and Goa. “We are glad that ‘Operation Lotus’ failed in Delhi. We have recently seen in other states be it Maharasthra or Goa how the BJP lured MLAs and tried to topple governments, but it has not been able to do that in Delhi,” he told PTI. “We will stay in touch with our MLAs and ensure they don’t get influenced. We will keep an eye on the BJP and its future actions,” heAfteradded.the meeting at his residence, Kejriwal and all of his party’s MLAs went to Rajghat to pray for the failure of the BJP’s “Operation Lotus”.Responding to the BJP’s allegations on the Delhi scam,”aitshouldtiveneededthepolicy,now-scrappedgovernment’sexciseBhardwajsaidsaffronpartyfirsttofixitsnarra-ontheissue“TheydecidewhetherisaRs1crorescamorRs1.5lakhcrorehesaid.
‘WE HAVE SEEN’ 53 of 62 AAP MLAs attend meeting at CM’s house
BJP
BJP ‘purifies’ Rajghat with Ganga jal, hits back at AAP
n a relief to the Cen tral government a Supreme Court-ap pointed committee to probe into the Pegasus spyware scandal has concluded that it did not find the spyware in any of the 29 mobile phones it examined. Instead, the committee said in its report, that some other malware was found in five of the 29 mobiles. Headed by former Supreme Court judge, Justice RV Raveendran, the com mittee submitted its report to the court. It means that the Cen tre did not snoop on hacks. The committee’s only comment against the government was that it did not cooperate with the in quiry. A three-judge bench of the court headed by the outgoing Chief Justice of India NV Ra mana said that the report may be uploaded on the court’s website. The sophisticated spyware was alleged to have been used to spy on journalists and impor tant functionaries in India. The Guardian claimed that the Pegasus was used in at least 50 countries, many of whom de nied using it.
Nitin @nitin_gadkariGadkari It is our government’s effort to reach out to every last person in the society and develop them and we are committed to it.
JIM O’NEILL
Smriti Z @smritiiraniIrani Met the UK Minister for Women Baroness Deborah Stedman-Scott on the concluding day of G20 Ministerial Conference on Women Empowerment in Bali. She was extremely appreciative of PM @narendramodi Ji’s leadership towards enhancing women’s welfare.
as CM Hemant Soren faces disqualification as MLA for allegedly granting himself and his aides mining licences. By doing so Soren is said to have violated section 9-A of the Representation of Peoples Act, the basis on which the BJP is seeking his disqualifi cation. A letter from the Elec tion Commission of India to Governor Ramesh Bais in a sealed envelope purportedly suggests Soren’s disqualifica tion. The chief minister said he did “not know anything as of now about any order for me”. In any case he is unlike ly to accept the EC verdict without a challenge. Soren has the option of challenging the decision in a court and ap pointing someone else to run theItgovernment.isnowbeing speculated that the Bharatiya Janata Party may take advantage of the unstable situation and form a government of its own. The party is said to be counting on Congress legisla tors, some of whom crossvoted in the elections for President. Three others were caught with unaccounted cash in West Bengal. They were subsequently arrested. The Jharkhand govern ment is a coalition of JMM (30), Indian National Con gress (16), RJD (1) and NCP (1). The BJP has 26 MLAs. To form a government it has to carry out a Maharashtra-like Operation Lotus to wean away the Congress legisla tors. Given the state of disar ray the Congress is in, it may not be impossible. The charge against Soren is serious. The chief minis ter, however, said that the BJP was blatantly misusing ED and the CBI.
ANNE O. KRUEGER When the COVID-19 pandem ic began, people cut their spending. Although unem ployment rose and supplies fell sharply due to pandemic containment measures, much of the potential income loss was offset by government policies. In the United States, it even paid to be unemployed. The result was that per sonal savings shot up. When COVID-related restrictions were later relaxed, demand increased rapidly. Supplychain disruptions, the time needed to restart production, and continuing worker short ages resulted in significantly slower supply responses. The Fed’s balancing act is difficult: Some, but not too much, dampening of de mand is warranted. At the same time, inventories (in creases in which partly re flected stockpiling during supply shortages and will inevitably be run down) are beginning to accumulate and retail sales are losing some momentum. Whether the Fed’s policy tightening will check demand growth just enough as supply increases will determine whether in flationary or recessionary pressures dominate in the US. If policymakers’ judg ment is correct, the US could re-attain the Fed’s target in flation rate and satisfactory growth without falling into recession.
l Vol 1 l Issue No. 357 l RNI TITLE NO. DELENG/2021/19840 Printed and published by Anita Hada Sangwan on behalf of First Express Publishers. Printed at Impressions Printing and Packaging Limited, C-21, 22 Sector-59, Noida-201301. Published at G-20, 3rd Floor, 309, Preet Vihar, New Delhi-110092. Phone 011-49846474. Editor-In-Chief: Dr Jagdeesh Chandra Editor: Anita Hada Sangwan responsible for selection of news under the PRB Act PERSPECTIVE NEW DELHI | FRIDAY, AUGUST 26, 2022 04 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
STEPHEN S. ROACH
he Big Question is a regular feature in which Project Syn dicate commentators con cisely address a timely topic. In this Big Question, we ask Jeffrey Frankel, Anne O. Krueger, Jim O’Neill, and Stephen S. Roach how steep the world economic down turn is likely to be.
Notwithstanding the pitfalls of forecasting anything these days, my cracked and worn crystal ball sees a global re cession occurring in the next year.For me, recession risk as sessment has always been a two-step process: the stallspeed alert and the impacts of inevitable shocks. Econo mies – whether of single countries or the world as a whole – approaching the stall speed lack the resilience to withstand the blow of shocks. For the global economy, the last five recessions have all occurred when world GDP growth fell below the 2.5% threshold. That represents a one-percentage-point short fall from the post-1980 aver age of 3.5%. As such, when global growth falls into the 2.5% to 3.5% range, my rule is to sound a stall-speed alert. The lower half of that range, 2.5% to 3%, is especially omi nous – a perfect predictor of global recession.
Just as the world economy appeared to be recovering from the impact of the COVID-19 pandemic, headline GDP growth has decelerated sharply or turned negative in several leading economies in 2022. And with annual inflation in many countries fast approaching double digits, it is not easy to see where global growth will come from.
Source: project-syndicate.org
JEFFREY FRANKEL No. A global recession is en tirelyTrue,avoidable.theodds of a down turn are much higher than usual in Europe, which has been hit hard by reduced sup plies of Russian natural gas; China, where COVID-19 lock downs already turned growth negative in the second quar ter; and other countries, in cluding emerging-market economies with debt troubles. Even the US economy is ex periencing a slowdown. I still maintain that the two con secutive quarters of negative GDP growth reported by the Bureau of Economic Analy sis do not signify that a US recession started in the first part of 2022. There are three reasons for this. First-quarter GDP will be revised on Sep tember 29, and second-quar ter GDP on August25; other indicators like gross domestic income (GDI) and employ ment were positive; and the recession ruling is up to the National Bureau of Econom ic Research. But rising inter est rates and the gloomy out look among America’s trad ing partners do mean that a US recession is more likely than usual at some point over the next two years. But a “global recession”? The Unit ed States is not the only place where a negative growth rule is not an agreed criterion for definingConsiderrecession.globalGDP. It has been rare in the postwar pe riod for global growth to fall below zero even for a single quarter, let alone two. Not even the severe downturns of 1974 and 1981 qualified. Even in times of apparent reces sion, negative growth in ad vanced economies is usually outweighed by still-positive growth among emergingmarket and developing econ omies. (Two exceptions were the 2008 global financial cri sis and the 2020 pandemicinduced recession.)
T
In contrast to the common practice in Western econo mies, a global recession is not really defined as two consecu tive quarters of negative GDP growth, because in many large emerging economies, such as India, such conditions rarely arise. Even if many Western economies are expe riencing back-to-back quar ters of negative growth, we can end up with a “global” recession in which world GDP growth averages around 2%. Over the past 25 years, the US and China between them often have accounted for more than 80% of annual global GDP growth. So, if these two economies are both in their respective versions of recession, then that will virtually guarantee a global downturn. Given their cur rent weaknesses and chal lenges, such a scenario is quiteButpossible.Iamless convinced of this than I probably was a few months ago. That is be cause there is creeping evi dence that the inflationary surge has – at least so far –been transitory, with com modity prices easing and measures of long-term infla tion expectations quite sta ble. If this continues, central banks will become less hawk ish and will not have to weak en their economies further to stabilize prices.
SPIRITUAL SPEAK
TOP he Jharkhand Mukti istion(JMM)-ledMorchacoaligovernmentinthedoldrums
The projectsMonetaryInternationalFundnowthat global GDP growth will slow from 6.1% in 2021 to 3.2% in 2022 and 2.9% in 2023. That is a momentous deceleration. But it still leaves world growth unlikely to meet a two-negative-quartersthreshold.
JHARKHAND CM FACES TOUGH TIMES SA letter from the Election Commission of India to Governor Ramesh Bais in a sealed didTheSoren’spurportedlyenvelopesuggestsdisqualification.chiefministersaidhe “not know anything as of now about any order for me”.
IS A GLOBAL INEVITABLE?RECESSION
TWEETS I
Death is as sure for that which is born, as birth is for that which is dead. Therefore grieve not for what is inevitable. Bhagavad Gita
IN-DEPTH SPYWARE:PEGASUS
MUCH
ADO APEXNOTHING,ABOUTSAYSCOURTPANEL
T
To Receive Free Newspaper PDF Daily Whatsapp: http://bit.ly/whatsappdelhi Telegram: https://t.me/firstindianewdelhi Click the above link☝ & subscribe us on your preferred platform.
AIMIM MLA Ahmed bin Abdullah Balala and our corpora tors have been working all night to de-escalate the situation. I have been in touch with them and the police too.”
The Supreme Court had earlier set up a five-member Commit tee headed by a retired top court judge, Jus tice Indu Malhotra to probe into the security lapse during Prime Minister Narendra Modi’s Punjab visit.
New Delhi (PTI): The Supreme Court on Thursday agreed to have a relook at its ver dict upholding the Pre vention of Money Laun dering Act (PMLA) and said “prima facie” the two aspects of not pro viding an Enforcement Case Information Re port (ECIR) and rever sal of the presumption of innocence rest,powersmenthadofathisreconsideration.requireTheapexcourtsaidasitagreedtohearpleaseekingareviewthejudgmentthatupheldtheEnforceDirectorate’s(ED)relatingtoarattachmentof property involved in money laundering, search, and seizure un der the PMLA. It also issued notice to the Centre.Atthe same time, a bench headed by Chief Justice N V Ramana said the object of the PMLA is noble and the offence of money laun dering is serious, add ing the court is com pletely in support of prevention of black money and money laun dering and that the country cannot afford such types of offences.
Sources also said that the new decision to de fer has been taken since the party leaders will be busy in ‘Bharat Jodo Yatra’, which will commence on Septem ber 7 and the Gandhis, including Sonia Gan dhi are abroad. The Congress has called a meeting of its Working Committee on August 28 to decide the poll schedule for the party president’s post.
Sources said that it was likely that instead of the election process to get completed by September 21, the whole process may now be completed in October or November. The decision on the new schedule will be taken by the Congress Working Committee (CWC) on Sunday.
PM Security breach: SC panel
Hyderabad (ANI): De manding arrest of sus pended BJP MLA T Raja Singh, AIMIM chief Asaduddin Owaisi on Thursday said protests in some parts of the city were a direct result of the alleged hate speech by the BJP party leader. He said AIMIM MLA Ahmed bin Abdullah Balala and the party’s corporators of Greater Hyderabad Municipal Corporation have been working all night to deescalate the situation. Some of the sensitive areas of the city have witnessed sporadic Owaisi tweeted that after his intervention into the matter, 90 pro testers were detained by police on Wednesday night at Shalibanda of Old City, Hyderabad. The series of tweets read, “On my represen tation to DCP South, 90 protesting youth from Shah Ali Banda and Asha Talkies have been released.
SC APPOINTED TECH PANEL COULDN’T FIND PEGASUS SPYWARE ON SUBMITTED PHONES
New Delhi: The Delhi High Court on Thursday granted custody parole to Gurupada Maji, accused in a money laundering case linked to an alleged coal mining scam in West Bengal. Maji is one of the partners of Anup Majee, the kingpin of illegal coal mining business activities in West Bengal The court granted parole to Maji till September 3. Maji has approached the Delhi HC for interim bail stating his mother was expired a few days ago and his presence is neces sary for rituals in his town.
Ranchi: Jharkhand Raj Bhavan has re ceived the opinion of the Election Commis sion of India (ECI) on CM Hemant Soren’s of fice of profit matter. The letter in this re gard was received by Jharkhand Raj Bhavan on Wednesday. The hearing in the Hemant Soren mine leasing case, in which the BJP has accused him of ex tending himself a min ing lease and sought his disqualification as an MLA, was conclud ed in the ECI on Mon day.The ECI on Tuesday sent its opinion to Jharkhand Governor which was received by Raj Bhavan on Wednes day. Sources said that the letter by ECI was received by Jharkhand Governor Ramesh Bais office, but details of the ECI opinion can’t be re vealed as it is sent in a sealed cover. On August 12, the legal team of Soren concluded its ar guments before the Election Commission following which the BJP — the petitioner in the case — gave a re joinder. On August 18, the two sides submitted their written submis sions to the poll panel. On Thursday Nishikant Dubey, BJP Member of Parliament from God da, Jharkhand, tweeted that the letter from the ECI has reached the Raj Bhavan.
Rajasthan CM Ashok Gehlot has emerged as the top choice for the Congress president’s post. Sources have said that Sonia Gandhi had request ed him to contest during a meeting which she held before heading abroad for medical checkup and treatment. The Gehlot camp has not confirmed the development, but sources have confirmed that the Congress is look ing beyond the Gandhis for the top post. Gehlot himself has said that these things were coming up in the media and he had no knowledge of it.
Sharat K Verma Patna: Bihar Chief Minister Nitish Ku mar’s national cam paign will start next month as there is a meeting of the national executive of his party, Janata Dal-United (JDU). This meeting will be held in Patna on September 3 and 4, in which Nitish Kumar will be positioned as PM material on behalf of the party. Although a similar positioning has been done in the past as well, but it is being said that a ‘proposal’ can also come in this meet ing. Informed leaders of the party say that the proposal can be accept ed in the meeting of the National Executive that if the opposition par ties agree, then Nitish Kumar will be an nounced as the prime ministerial candidate. Keep in mind that JD(U) is not taking any initiative from its side nor is it giving the mes sage that Nitish Kumar is anxious to become the prime ministerial candidate. Unlike Delhi Chief Minister Arvind Kejriwal, Nitish and his party are being very careful. The party’s na tional president Rajiv Ranjan Singh alias La lan Singh said that Nit ish Kumar has no ambi tion to become the prime ministerial can didate but if the opposi tion parties ask, he will be ready forit. Party Parliamentary Board President Upendra Kushwaha said the same thing in a differ ent style. He said JD(U) would not create any hurdle in opposition unity. That is, if the op position parties say then Nitish will be the contender and if the op position parties decide the name of any other leader, then JDU will support the united op position.It’savery smart trick and suits Nitish’s na ture perfectly. He never prefers to take the first step and thus exposing himself, rather he cre ates such situations that others take the ini tiative. However, Nitish Kumar will come to Delhi after the party’s national executive meeting. After break ing rapport with BJP and forming govern ment with RJD and Congress, he has not come to Delhi yet. Tejashwi Yadav and La lan Singh had definitely visited Delhi and said that after the formation of the cabinet, Nitish will come to Delhi and meet Sonia and Rahul Gandhi.Itispossible that Nit ish will come to Delhi only after the party’s executive meeting and meet both the top Con gress leaders. Apart from the courtesy meet ing, the common politi cal strategy of the op position will also be discussed then. It is be ing told that Nitish Ku mar and Arvind Kejri wal can also meet at that time and K Chan drashekhar Rao can also meet Nitish in Del hi. He is also likely to meet Sharad Pawar.
New Delhi (Agencies): The election for Con gress president is likely to be postponed for a few weeks, sources said on Thursday, and the final schedule will be decided in the Congress Working Committee (CWC) meeting sched uled on August 28.
Owaisi demands T Raja’s arrest
RAJ CM GEHLOT TOP CHOICE
DELHI HC WHATSAPP,DISMISSESFBPLEASAGAINSTCCIPROBE TEESTA’S BAIL: GUJ GOVT GETS MORE TIME TO REPLY
New Delhi: The Delhi high court dismissed the appeals of WhatsApp and Facebook on Wednesday, August 25 against an order rejecting their challenge to a probe ordered by the Competition Commission of India (CCI) into the instant messaging platform’s updated privacy policy of 2021. A bench of Chief Justices Satish Chan dra Sharma and Subramo nium Prasad said the single judge’s order was wellreasoned and the appeals are devoid of merits.
New Delhi: The Supreme Court has listed the hearing of activist Teesta Setalvad’s bail plea in connection with the Gujarat 2002 riots case to August 30. The hearing was postponed after solicitor gen eral Tushar Mehta, appearing on behalf of the Gujarat gov ernment, sought additional time to make some correc tions in the government’s response to the case. Initially, a three-judge bench led by Justice UU Lalit had asked Mehta to submit the response at 2 pm on Thursday.
JHARKHAND CHIEF MINISTER HEMANT SOREN’S OFFICE OF PROFIT
SOREN DISMISSES RECEIVING ECI REPORTS Ranchi (ANI): CM Hemant Soren on Thursday dis missed reports of receiving any communication from the ECI or Governor with regards to his disqualifica tion as an MLA on the office of profit matter. The CMO released a statement after several media reports made the rounds that ECI has sent a report to the governor about Soren’s disqualifica tion. “The Chief Minister is apprised of several media reports about ECI send ing a report to Honorable Governor -Jharkhand ‘ap parently recommending his disqualification as an MLA’. No communication in this regard has been received by CMO from either ECI or Governor,” read statement.
Will Nitish begin his Prime Ministerial ‘campaign’ from next month?
holds Ferozepur SSP responsible New Delhi (ANI): The Supreme Court on Thurs day said that the fivemember committee ap pointed by it has said that Ferozepur SSP failed to discharge his duty though the sufficient forces were available dur ing Prime Minister Nar endra Modi’s Punjab visit on January 5. A bench of Chief Jus tice NV Ramana and Justices Surya Kant and Hima Kohli said while reading from the committee’s report that the committee headed by a former top court judge, Justice Indu Mal hotra, said there should be an oversight commit tee for periodic revision of ‘Blue Book’. “The Ferozepur SSP failed to discharge his duty to maintain law and order. He failed to do this even though suf ficient force was avail able and even though he was informed two hours in advance that Prime Minister will enter that route,” it said. The apex court said it will send the report of the five-member com mittee to the Centre for appropriate action. There are remedial measures and safe guards needed for the Prime Minister’s secu rity, said the bench while reading the com mittee’s report.
CEC recommends Hemant Soren’s disqualification as MLA
Cong presidential poll likely to be deferred by few weeks
Bihar CM Nitish Kumar with Lalu Prasad Yadav. —FILE PHOTO
Phogat death: ‘CBI probe if family wants’ Chandigarh: Haryana Chief Minister Mano har Lal Khattar on Thursday said the state is open to ordering a probe by the Central Bureau of Investiga tion (CBI) in the mur der case of Sonali Pho gat, an actor and BJP leader, in Goa. “If that’s what the family wants, we will do it,” he told reporters in Chandigarh.Healsosaid that as per the family’s wishes, a part of her viscera will be examined at a government lab in Chandigarh, besides Goa. “The most impor tant thing is to heed by the family’s wishes.”
SC agrees to take relook at its PMLA verdict
INDIA NEW DELHI | FRIDAY, AUGUST 26, 2022 05 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
IN THE COURTYARD
New Delhi: The Supreme Court appointed committee to probe into the allegations regarding use of Pegasus spy ware by the Govt of India has concluded that the spyware was not found in the 29 mobile phones examined by it. A bench after examining a voluminous report submitted by the threemember expert committee, noted that while some malware was found in 5 of the 29 devices, the same was not Pegasus.“We are concerned about technical committee 29 phones were given... in 5 phones some malware was found but the tech nical committee says it cannot be said to be Pegasus. They say it cannot be said to be Pegasus,” the bench remarked.
JHARKHAND GOVERNOR RECEIVES ECI RESPONSE
The bench was hear ing a plea filed by Karti Chidambaram.
Jharkhand Chief Minister Hemant Soren
New Delhi: The Supreme Court on Thursday said that prima facie two issues relating to the provisions of the Prevention of Money Laundering Act (PMLA) need to be reconsidered. A bench issued notice to the Centre on the two issues. The two issues which the court prima facie finds to reconsider is judgement upholding various provisions of the PMLA including non-providing of Enforcement Case Investiga tion Repor and reversal of presumption of innocence.
WB COAL MINING: CUSTODY PAROLE TO GURUPADA MAJI SC AGREES TO RELOOK SWEEPING PMLA JUDGMENT
Ranchi : The Chief Election Commission has sent a letter to Jharkhand Governor Ramesh Bais recom mending cancellation of the Assembly mem bership of CM He mant Soren. He will then have to resign from the post of chief minister. Former Jharkhand CM Raghubar Das and the BJP have been de manding disqualifica tion of Soren as MLA in an office of profit matter. They accused Soren of extending a mining lease to him self. Terming it as vio lation of the office of profit and Representa tion of the People’s Act, the BJP and Raghubar Das have written a letter to the governor. With the is suance of the Gover nor’s order on the in structions of the Elec tion Commission, Soren’s membership will end. In such a situation, Soren may have to resign as the CM. However, the JMM-Congress alli ance which is led by Soren has a majority in the Assembly. So, after the resignation he can again stake claim to form the gov ernment. An an nouncement in re gard to the EC’s rec ommendation is ex pected after that. It is not clear whether Soren has also been disqualified from con testing elections. The lease of a stone quar ry in Angada block in Ranchi was issued in the name of Soren which he had surren dered later.
EYES ON 2024
There was security lapse during PM’s Punjab visit on January 5.
Indore: Two brothers, one five years old and another two years old, died due to a myste rious fever in Indore district while another sibling was in critical condition, a health official said on Thurs day. Civic officials have sealed an illegal clinic run by a quack who had treated them initially. Shivansh (5) and Yuvraj (2), of Baigram village, 50 km from here, died on Wednesday. Both had fever but it was not clear if the cause was viral infection or bacteria and experts were exam ining the case, said BMO Dr Faizal Ali. Yuvraj’s twin brother was under treatment at a govern ment hospital here.
New Delhi: Raju Srivas tava is on ventilator and continues to recover “slowly”, the ing(ICU)theafterconsciousnesstava,reportedmedialiermoment,”ontostablevastavaissaidInstagramSrivastava’sasaidShikhacomedian-actor’srenownedwifeSrivastavaonThursday.Instatementissuedonofficialpage,Shikhathestand-upartist“stable”.“RajuSriJi’sconditionisandhecontinuesrecoverslowly.Heistheventilatorattheshesaid.Earintheday,severalpublicationshadthatSrivas58,hadgained15dayshewasadmittedtoIntensiveCareUnitofAIIMSfollowaheartattackhere.
New Delhi: Presi dent Droupadi Mur mu said civil servants should try to istrativeofstratathoseiftrulytiativesthemple,underprivilegedreachpeoandremindedthatwelfareinicanberatedsuccessfulonlytheirbenefitsreachinthelowestofsociety.Addressingagroup175IndianAdminServiceoffic ers of the 2020 batch, President Murmu said it was expected from civil servants to reach the last person or the most deprived person in their area of responsibility and improve their living condition.
4 held after gang-rape victim kills self in UP
Rakesh Ranjan Bhubaneswar: For the first time in its 22 years rule, the Naveen Pat naik Government in Odisha has extended a Chief Secretary’s term not once but twice. With the Centre approv ing the request to ex tend the services of CS Suresh Chandra Ma hapatra, 1986 batch IAS officer, for another six months the uniqueness prevails.This is the second time that Mahapatra’s tenure has been extend ed. He got six months extension beyond his retirement due on Feb ruary 28, 2022, and now his tenure endd on Feb ruary 28, PradeepnottookthatwasOdisha2023.bureaucracyabuzzwithtalksthegovernmentthisstepasitdidwanttoconsiderKumarJena, Development Commis sioner, for the CS post. For the first time in its 22 years rule, the Naveen Patnaik Gov ernment in Odisha has extended a Chief Secre tary’s term not once but twice. With the Centre approving the request to extend the services of CSSuresh Chandra Mahapatra, 1986 batch IAS officer, for another six months the unique nessThisprevails.isthe second time that Mahapatra’s tenure has been extend ed. He got six months extension beyond his retirement due on Feb ruary 28, 2022, and now his tenure endd on Feb ruary 28,
WORK WITH PASSION TO ENSURE INDIA 2047 IS MORE PROSPEROUS ’
Srinagar: Former Jammu and Kashmir Chief Minister and National Conference (NC) president, Farooq Abdullah denied of differences which could lead to the breaking up of the People’s Alliance for Gupkar Declaration (PAGD). Replying to a question about Wednes day’s resolution passed by the provincial committee of the NC that said the party would on its own contest all the 90 Assembly seats during the J&K polls, Abdullah said, “Many would want an end to PAGD, but the alliance will not be affected.”
Technology revolution has empowered India’s democracy: Lok Sabha Speaker
President Droupadi Murmu with the IAS officers at Rashtrapati Bhavan in New Delhi on Thursday.
Uniqueness prevails: Odisha CS gets another extension
‘RAJU ONCONTINUESSRIVASTAVATOBEVENTILATOR’
BJP GENERAL SECRETARY SUNIL BANSAL TO VISIT BENGAL FROM AUGUST 28
‘
Sambhal (PTI): Four persons were arrested after a 16-year-old gangrape victim hanged her self to death here, po lice said on Thursday. While one of the ac cused was arrested on Wednesday, three oth ers were nabbed on Thursday, they said. The girl took the ex treme step after alleged ly being pressured by the families of the accused for a settlement, accord ing to police Superintendentofficials. of Police Chakresh Mishra on Thursday suspended the investigating officer in the Policecase.said the postmortem report con firmed hanging to be the cause of the girl’s death. Police had lodged an FIR and initiated in vestigation after the girl’s family members lodged a complaint on August 15 alleging she wasAftergang-raped.shekilled her self, the family mem bers told the police that families of the accused were forcing her to en ter into a settlement which pained her.
Halifax: Lok Sabha Speaker Om Birla on Thursday said that the IT revolution has played a significant role in em powering democracy in a vast country like India. He made this remark while addressing the workshop on “A People’s Parliament: Accessibili ty through Innovation”. Om Birla is leading the Indian Canada.ingmentaryCommonwealthdelegationParliamentarytothe65thParliaConferencebeheldinHalifaxinObservingthatthe hopes and aspirations of people in a parliamen tary democracy are ex pressed through the Par liament, Mr Birla opined that people see the Par liament as a medium of transformation in their socio-economic status.
New Delhi: Given the task of its organisational affairs in West Bengal & Telangana, BJP general secretary Sunil Bansal will be on a 3-day visit to the eastern state from August 28. Sources said he will attend a training pro gramme in Bengal where BJP leaders from different parts of the state will participate, giving Bansal a chance to interact with the start party’s functionaries at one place.
2 CHILDREN DIE OF FEVERMYSTERIOUSININDORE
India on‘horrificcondemnsattack’Rushdie
Tells Prez Droupadi Murmu to 175 IAS officers of 2020 batch in an interaction New Delhi (ANI): 175 IAS officers of 2020 batch, currently deput ed to various ministries and departments as As sistant Secretaries, called on President Droupadi Murmu at Rashtrapati Bhavan on Thursday.Addressing the offic ers, the President said as civil servants, they have an important role to play in the emergence of India as a global hub of knowledge, supplychain, innovation, muchIndiatheywithsaidmakers,senior-mostbatchbyPointingtainableenvironmentallysociallyhasleadershiphasAtandnology-developmenttechvariousotherfields.thesametime,Indiatostrengthenthepositionittakenintheareasofinclusiveandsusdevelopment.tothefactthat2047,officersof2020willbeamongthedecisionthePresidentthatbyworkingpassionandpride,canensurethattheof2047willbemoreprosperous, strong and happy. She said for shaping that In dia of 2047, they have to work with a modern and service-oriented mindset. She noted that Mis sion Karmayogi is a ma jor initiative to make civil servants more modern, dynamic and sensitive in Presidentapproach.Murmu said with tremendous growth in infrastruc ture, it has become easi er to reach remote parts of the country. She said it is expected from civil servants to reach the last person or the most deprived person in their area of responsibility and improve her living condition. They can open up opportunities for those who are not aware of the welfare schemes or develop ment programmes. She reminded them that any welfare initiative can be rated truly successful only if its benefits reach the poor, the downtrod den and such other peo ple at the lowest strata of society. She said civil servants should try to reach such underprivi leged people. Under privileged should not be put into the difficulty of reaching them for help.
Rameshwar Thakur is HPPSC chairman
Mahesh Sharma New Delhi: Nanda muri Taraka Rama Rao ie NTR was the most wondrous leader of Andhra Pradesh and a super star of Telugu films. When he formed the party, he formed the government with a big majority in the very first election. Later his son-in-law Chandraba bu Naidu took over his party during his life time. Then some of NTR’s children also helped Naidu as NTR had married a woman much younger than him and decided to hand over the leader ship of the party to her. Despite this, it is a fact that Chandrababu Naidu’s capture of the party was not liked by many in NTR’s family. Only when Jr NTR has become active, it is be ing said that history can repeat itself. Jr NTR is a super star of Telugu films and is the grandson of NTR. His father andBJPNTRMemberHarikrishnaNandamuriwasaofParliament.JuniormetformerNationalPresidentUnionHomeMinis ter Amit Shah in Hy derabad recently. It is being told that Shah has asked him to become ac tive in politics again. If he comes back into ac tive politics, BJP can make him the party face. Keep in mind that there is no place for Junior NTR in his grandfather’s party TDP.There, Chandrababu Naidu’s son Nara Loke sh has taken over. Only then is it possible that NTR Jr. joins the BJP and becomes a pivot of Telugu politics. In Andhra, the direct con test is between Jagan Mohan Reddy’s YSR Congress and TDP.
UnionwantedtheulationsBacksioner,DevelopmentPradeepnottookthatwasOdisha2023.bureaucracyabuzzwithtalksthegovernmentthisstepasitdidwanttoconsiderKumarJena,CommisfortheCSpost.inFebruaryspecwererifethatChiefMinistertobringbackSecretaryfor Corporate Affairs Rajesh Verma, a 1987 IAS officer of Odisha Cadre, as the state’s next CS instead of con sidering PK Jena. Re portedly, back then ei ther Centre or Verma himself wanted more time to get relieved from Central deputa tion and this con strained Patnaik to ac cord the first-ever ex tension in Odisha to a CS in January 2022.
New Delhi: India wished author Salman Rushdie a speedy recov ery and condemned the ‘horrific attack’ on the writer. “India has al ways stood against vio lence and extremism. We condemn the hor rific attack on Salman Rushdie and we wish him a speedy recovery,” external affairs minis try spokesperson Arin dam Bagchi said Thurs day afternoon. Rushdie suffered three stab wounds to his neck and four to his stomach.
It is expect ed from civ il servants to reach the last person or the most deprived person in their area of responsi bility.
—Droupadi Murmu, President Suresh Chandra Mahapatra FAMOUS SCIENTIST SAMIR V KAMAT APPOINTED DRDO SECY
Shimla (PTI): IPS of ficer Rameshwar Sin gh Thakur was on Thursday appointed as the chairman of the Himachal Pradesh Public Service Com mission, days after the state government can celled HPPSC member Rachna Gupta’s ap pointment to the post without any clarifica tion.“In exercise of the powers vested in him under Article-316 of the Constitution of In dia, the Governor, Himachal Pradesh, is pleased to appoint Shri Rameshwar Sin gh Thakur, IPS, as Chairman, Himachal Pradesh Public Ser vice Commission for a term of six years from the date on which he enters upon his office or until he attains the age of 62 years, which ever is earlier,” the notification issued by state’s Chief Secre tary R D Dhiman read. In a notification on August 17, the state government had ap pointed Rachna Gupta as its chairperson, and the oath-taking ceremony was sched uled next morning. The ceremony was, however, called off at the eleventh hour. This move drew criticism from the Op position with LoP in assembly Mukesh Ag nihotri demanding an explanation from CM Jai Ram Thakur.
“Therefore, as the su preme representative body, it is the responsi bility of the Parliament to act according to the expectations and aspira tions of the people,” he said. Mr Birla urged del egates to build a prosper ous, inclusive and en lightened society so that the benefits of develop ment could reach the last person in the queue. Speaking on the success ful democratic system in India, Birla said, “The people in India have con sistently reposed their faith in democratic insti tutions through free and fair elections in the 75 years since independ ence. The increasing voter turnout in the elec tions has proved that the people consider democ racy as the best form of governance.”
Lok Sabha Speaker Om Birla addresses the Indian diaspora in Toronto.
—PHOTO BY ANI
Will Junior NTR repeat NTR’s history?
NEW KID IN THE BLOCK
NO DIFFERENCES, GUPKAR ALLIANCE IS INTACT, SAYS FAROOQ ABDULLAH CRUCIAL READ
BE SENSITIVE TO PEOPLE: PRESIDENT’S ADVICE
INDIA NEW DELHI | FRIDAY, AUGUST 26, 2022 06 www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
New Delhi: Distin guished scientist Samir V Kamat was on Thursday appointed as Secretary of the Department of Defence Research and Develop ment and Chairman of the Defence Research and developmentisRajnathtoaswhoGDRDO&General,Kamat,nelaccordingOrganisationDevelopment(DRDO),toaPersonMinistryorder.whoisDirectorNavalSystemsMaterials,atthewillsucceedSatheeshReddyhasbeennamedscientificadviserDefenceMinisterSingh.DRDOtheresearchandwingof the Defence Ministry. The CabinetCommitteeAppointmentsofthe(ACC)has ap proved the appointment of Kamat as Secretary of the Department of Defence Research and Development and Chairman of DRDO from the date of his assumption of charge till he attains age of 60 years, it said.
New Delhi: India Post is working on projects and technologies to provide governmentservicesatthedoorstepandadd10,000postofficesthisyearto enhance its reach. Department of Posts Secretary Aman Sharma at a CII conference said that the government has provided the department with `5,200 crore for the modernisation of the post offices using technology.
—PTI HERO ELECTRIC PARTNERS WITH JIO-BP FOR CHARGING, BATTERY SWAPPING FOR EVs New Delhi: Hero Electric on Thursday said it has partnered with Jio-bp for charging electric two-wheelers. As per the collaboration, the customers of Hero Electric will get access to the widespread charging and swapping network of Jio-bp, which is also open to other vehicles, the electric two-wheeler maker said in a statement. The companies will bring the best of their global learning in electrification and apply them to the Indian market, the statement added.
NEW DELHI | FRIDAY, AUGUST 26, 2022 07www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia Commodity Price Change % Chg GOLD 52,297.00 402.00 0.76 (Per 10g) SILVER 56,191.00 711.00 1.26 (Per 1kg) COMMODITIES Currency Price Change % Chg USDINR 79.93 0.07 0.08 GBPINR 94.61 0.38 0.40 CURRENCIES
Hiring increases by 29% in April-June 2022
BRIEFS New Delhi: Hyundai Motor India on Thursday said it has commenced bookings for Venue N Line, its second product under the performance-oriented N Line range, as it looks to cater to the customers looking for sporty vehicles. The compact SUV comes with various exterior and interior changes to give it a sporty styling, inspired by motorsport. In September last year, the automaker introduced the i20 N Line in the country. The model comes with a 1-litre turbo petrol engine mated with seven-speed DCT (automatic) transmission.
New Delhi (PTI): The government on Thursday decided to put restrictions on the export of wheat flour to curb rising prices of the commodity.Thedecision was taken at a meeting of the Cabinet Committee on Economic Affairs (CCEA), chaired by Prime Minister Narendra Modi.The decision of the Cabinet “will now allow to put a restriction on the export of Wheat Flour which will ensure a curb on rising prices of wheat flour and ensure food security of the most vulnerable sections of the society,” an official statement released on Thursday said.The Directorate General of Foreign Trade (DGFT) will issue a notification to thisWheateffect. flour exports from India have registered a growth of 200% during April-July 2022 compared to the corresponding period in The2021.increased demand for wheat flour in the international market led to significant price rise of the commodity in the domestic market.
INDIA’S STRONG ECONOMY MEANS RBI CAN
business
—PTI LIC DILUTES STAKE IN NAGPUR POWER & FOROPENSHYUNDAIINDUSTRIESMOTORSBOOKINGSVENUENLINE
New Delhi : Around 15.47 lakh new members joined the ESICrun social security scheme in June Thursday.releasedoffiaccording2022,tocialdataonIt showed that the gross new enrolments with ESIC rose to 1.49 crore in 2021-22, from 1.15 crore in 2020-21. According to the report, net new enrolments with retirement fund body EPFO stood at 18.36 lakh in June 2022.
—PTI
—PTI IOC EYES NET ZERO CARBON EMISSIONS BY 2046
New Delhi: Bharti Airtel promoter Bharti Telecom will buy a 3.33% Airtel stake from Singtel for about `12,895 crore in 90 days’ time. Bharti Group chairman Sunil Bharti Mittal’s family and Singtel are co-investors in Bharti Telecom (BTL). Singtel in a statement said that after the transaction, Singtel Group is expected to own an effective stake of 29.7% in Bharti Airtel.
New Delhi: Sebi on Thursday came out with the disclosure framework for asset companies,managementmandating a scheme-wise disclosure of investments in securities of entities that are excluded from the definition of “associate”. This came after Sebi, earlier this month, amended mutual fund rules to remove the applicability of the definition of “associate” to sponsors that invest in various companies on behalf of the beneficiaries of insurance policies or such other schemes.
5G in India by October 12, says Vaishnaw New Delhi (Agencies): Union IT minister Ashwini Vaishnaw on Thursday said that 5G services will be launched in India by October 12 after which it will be scaled further in cities & towns. “Our expectations are that 5G should reach in every part of the country in the next two to three years. We’ll ensure that it remains affordable. The industry is focusing on both urban as well as rural areas,” he said. “We are planning to roll out 5G services rapidly, telecom operators are working in that regard & installations are being done. Hopefully, we should be launching 5G services by October 12 & then would further scale up in cities & towns,” he added. The DoT has received payment of around `17,876 crore from service providers -- Bharti Airtel, Reliance Jio, Adani Data Networks and Vi for spectrum. HIKE RATES
“The country has built up buffers against cyclical difficulties like those, which we are experiencing right now,” Wood said. He said the rating agency does not expect the nearterm pressures to have a serious impact on India’s credit“Weworthiness.areexpecting a strong level of GDP growth of 7.3% this fiscal,” he said, adding the rupee exchange rate movement against the US dollar has been moderate. Wood said India has “ample buffer” in its foreign exchange reserves and the forex kitty is expected to recover to $600 billion by the end of this year. Forex reserve stood at $570.74 billion as of August 12. The US-based agency has a ‘BBB-’ rating on India with a stable outlook.
Mumbai (PTI): Equity benchmarks ended lower on Thursday as a fag-end sell-off wiped out early gains, with IT & bank stocks playing spoilsport. After remaining in the positive territory for most part of the trade, the BSE Sensex suddenly came under selling pressure during the last half-hour of the session, declining 310.71 points or 0.53% to settle at 58,774.72. Similarly, the broader NSE Nifty dropped 82.50 points or 0.47% to end at From17,522.45.the Sensex pack, Bajaj Finance, IndusInd Bank, Infosys, Tata Consultancy Services, Axis Bank, Power Grid, NTPC, Larsen & Toubro and HDFC were the major laggards. Maruti Suzuki India, State Bank of India, Dr Reddy’s and Titan were the gainers.
No threat to creditworthiness:India’sS&P
IT/ITeS continued to lead all sectors, with 91% of the employers in the sector hiring during the quarter (83% in the previous quarter). Tech roles found favour as the most in-demand for the quarter.
—PTI
—PTI New Delhi: LIC has diluted its stake in Nagpur Power & Industries by over 2% through open market sales, bringing down its stake to 8.33%. LIC said its shareholding in Nagpur Power & Industries has diluted from 10.56% (13,82,743 shares) to (10,90,7478.33%shares) of the paid-up capital of the company. There is a decrease of 2% in holding during the period from Sept 30, 2021, to Aug 24, 2022, at an average cost of `58.94, LIC said.
`
Sensex falls 311 pts on Thursday
India restricts export of wheat flour
New Delhi (Agencies): Employers increased hiring by 29% in April to June 2022, as compared to a 20% increase in the previous quarter, findings from the quarterly hiring tracker released by job site, Indeed, haveTherevealed.tracker also found that 37% of all jobseekers looked for a job or a job change during the quarter, as compared to 46% during the previous quarter. “Sectors such as IT, healthcare, E-commerce will continue to grow and with the advent of 5G, we will see a sharp rise in telecom jobs as well in the next few quarters,” said Sashi Kumar, Head of Sales, Indeed India.
New Delhi: The country’s sugar exports are likely to decline by 28.57% at around 8 million tonne in the lowerexpectedseason2022-23onopening balance stock and higher diversion for ethanol. However, whether to permit export under an open general licence or prevailing quota system will be decided after assessing price situation once the sugarcane crushing ops begin.
SUGAR EXPORT MAY DECLINE 28.57% TO 8 MN TONNES
New Delhi: Indian Oil Corporation, the nation’s largest oil firm, on Thursday committed `2 lakh crore to achieve net zero carbon emission target by 2046, chairman S M Vaidya said. The firm’s oil refining and placement,electrifithroughchemicalsboniseThetonnessionbusinesspetrochemicalshasatotalemis-of21.5millionofCO2,hesaid.firmplanstodecar-refiningandpetro-operationsenergyefficiency,cationandfuelre-hesaid.
New Delhi (PTI): India has built up buffers against cyclical difficulties and has ample foreign exchange reserves to withstand pressure on credit worthiness, S&P Global Ratings said. S&P Sovereign & International Public Finance Ratings Director Andrew Wood said the country has a strong external balance sheet and limited external debt, making debt servicing not so expensive.
IT/ITeS continued to lead all sectors, with 91% of the employers in the sector hiring during the quarter.
No telecomneededapprovalforlayinginfra
wrote.growthcertaintyputslowticipationcyclebeforRBI’srateIndia’sencouraging.”retailinflationhasremainedaboveuppertolerancelimitsevenstraightmonths.“Publiccapexislikelytoabiggersupportinthisasprivatesectorpar-mightbeinthelane,duetorisingin-pricesandrenewedun-overtheglobaloutlook,”Rao
BHARTI STAKEACQUIRESTELECOM3.33%INAIRTEL
New Delhi (Agencies): India’s strong economic growth offers room for the Reserve Bank of India to raise rates by another 60 basis points as the central bank seeks to stamp out high inflation, DBS Group Research said in a note on Thursday.India’s gross domestic product (GDP) in the first quarter of current fiscal year likely surged 16% year-on-year based on most leading indicators, the research house estimated. Favourable base effect after the onset of Delta coronavirus variant last year will additionally lift the yearon-year GDP numbers, Radhika Rao, senior economist at DBS Group Research, wrote in the note. It expects India’s first quarter (April-June) growth to be at 16%. The official GDP is expected to be issued on August 31. It maintains an overall FY23 growth forecast at 7%, which will see India emerge as the fastest-growing economy in Asia this year. “Resumption in service sector activity added to the momentum, besides manufacturing,” Rao said. Broad-based improvement in vaccination rates and relaxation of lockdowns benefited urban consumption, while unemployment rates returned to pre-pandemic levels, Rao said. On the investment side, “lead indicators have been
WHAT DOES THE REPORT SAY... India’s gross domestic product (GDP) in the first quarter of current fiscal year likely surged 16% year-onyear based on most leading indicators, the research house estimated. Favourable base effect after the onset of Delta coronavirus variant last year will additionally lift the year-on-year GDP numbers.
—PTI OTHER STORIES
INDEED TRACKER
It expects India’s first quarter growth to be at 16%. The official GDP is expected to be issued on August 31.
ONCE AGAIN
STRONG EXT BALANCE SHEET
S&P Sovereign & International Public Finance Ratings Director Andrew Wood said the country has a strong external balance sheet and limited external debt, making debt servicing not so expensive.
RBI MPC Member Goyal lauds govt’s reforms push
ESIC SCHEME ADDS 15.47 LAKH NEW MEMBERS IN JUNE
FINDINGS FROM THE REPORT The tracker found that 37% of all jobseekers looked for a job or a job change during the quarter, as compared to 46% in previous quarter.
INDIA POST GEARING UP TO SERVICESPROVIDEATDOORSTEP
—PTI SEBI COMES OUT WITH DISCLOSURE REQ FOR AMCs till the edition went to print.
New Delhi (PTI): Eight years of systemic economic reforms under the Modi govt have increased India’s macroeconomic stability and its capacity to withstand any external shocks, RBI Monetary Policy Committee (MPC) Member Ashima Goyal has said. “Just before the Modi govt came in, the country was facing serious macroeconomic instability after the global financial crisis.” “After 8 years of systemic reforms, the economy has been able to ride out more severe global shocks with macroeconomic stability, a healthy financial sector, food security and a govt and industry that have learnt to work together,” she said.
*Rates
—PTI
New Delhi (PTI): Telecom companies will not require any approval from authorities for laying cables or installing mobile towers or poles over private properties, according to new Right of Way Rules notified by the government recently. The govt also notified rules for using electric poles, foot over bridges etc for installation of small mobile radio antennas or laying overhead telecom cables along with charges to ease roll out of telecom networks specially 5G service.
GOES DOWN 7 PAISE TO CLOSE AT 79.93 AGAINST US DOLLAR
Mumbai (PTI): The rupee declined by 7 paise to close at 79.93 (provisional) after moving in a narrow range against the US dollar on Thursday. At the interbank foreign exchange market, the domestic currency opened at 79.80 per dollar. It hovered in a range of 79.80 to 79.93 during the session. The domestic unit finally settled at 79.93, down 7 paise over its previous close of 79.86.
RAHUL DENOUNCES ‘HOLLOW SLOGANS’ LIKE 'BETI BACHAO' New Delhi (PTI): Congress leader Rahul Gandhi on Thursday demanded justice for Gujarat riots survivor Bilkis Bano and alleged that those giving hollow slogans like ‘Beti Bachao’ are “saving rapists”. “Those giving hollow slogans like ‘Beti Bachao’ are saving rapists,” Gandhi said in a tweet in Hindi. “Today, the question is about the respect and rights of the women of the country. Give justice to Bilkis Bano,” the former Congress chief said.
RAHUL’S REFUSAL
FOR FIRST TIME, INDIA VOTES AGAINST RUSSIA
New Delhi (ANI): Election for the Congress President is likely to be postponed a few weeks and the final schedule will be decided in the Congress Working Committee (CWC) meeting scheduled on August 28, party sources said on Thursday. The Congress party had completed the internal election process till August 20. The party had announced that the election for the post of president will be held between August 21 and September 20 but despite several attempts, Rahul Gandhi has not cleared his stance. Sources said the process seems to remain stuck since Rahul is not willing to contest the election for the post of Congress president, although all the efforts to convince him are still going on. If the logjam continues, there may be an attempt to agree on one of the names of the leaders like Ashok Gehlot, Mallikarjun Kharge, KC Venugopal, Kumari Shailja and Mukul Wasnik.
Washington: India for the first time on Wednesday voted against Russia during a procedural vote at the United Nations Security Council on Ukraine, as the 15-member powerful UN body invited Ukrainian President Volodymyr Zelenskyy to address a meeting through a video tele-conference. This is for the first time that India has voted against Russia on the issue of Ukraine, after the Russian military action began in February. So far, New Delhi has abstained at the UN Security Council on Ukraine, much to the annoyance of the Western powers led by the United States. Western nations, including the US, have imposed major economic and other sanctions on Russia following the countries.conflictmaticsupportandplomacyturnUkrainianuponhasUkraine.gressioncisedIndiaaggression.hasnotcriti-Russiaforitsag-againstNewDelhirepeatedlycalledtheRussianandsidestore-tothepathofdi-anddialogue,alsoexpresseditsforalldiplo-effortstoendthebetweenthe
First India Bureau New Delhi: Road Transport and Highways Minister Nitin Gadkari on Thursday hit out at its detractors for “concocting” his statements for a “nefarious and fabricated” campaign for political mileage. The BJP veteran’s tweets came amid reports that both the BJP leadership and leaders of the Sangh were upset with him for his “repeated” public statements, which were seen as having embarrassed the government and the party. The reports also suggested that Gadkari was dropped earlier this month from the BJP parliamentary board, the party’s apex decision-making body, because his repeated jibes at the party and government at the Centre had ended up annoying the RSS leadership.OnThursday, Gadkari posted the series of tweets expressing his annoyance at what he called a nefariousmadeeffortshim.campaign”“fabricatedagainst“Today,onceagain,werebeingtocontinuethe&fabsome section of mainstream media, social media and some persons in particular by concocting my statements…I will not hesitate to take them to the law in the larger interest of our Government, Party and millions of our hardworking Karyakartas,” the minister posted, along with a video of his IAS OFFICERS OF 2021 BATCH
Monsoon clouds gather over the Bikaner Fort on Thursday. —PHOTO BY PTI
GADKARI OUTRAGED AT ‘NEFARIOUS CAMPAIGN’
DIPLOMATIC DARE
United Nations (PTI): Calling for an immediate cessation of hostilities in Ukraine, India reaffirmed that it advocates dialogue and diplomacy to end the Russia-Ukraine war. India’s structivelyterestitCouncilduringraRepresentativePermanentRuchi-Kamboj,speakingaSecuritymeeting,saidisincollectivein-toworkcon-towards seeking an early resolution to the war. “We continue to reiterate that the global order is anchored on international law, the UN Charter and respect for territorial integrity and sovereignty of states,” she said. “India continues to advocate for an immediate cessation of hostilities and an end to violence. We encourage talks between Ukraine and Russia. Prime Minister Narendra Modi has himself, more than once, spoken to them in this regard,” she“Indiasaid. remains deeply concerned over the situation in Ukraine,” she said.
Chief Minister Ashok Gehlot conducting aerial survey of the flood-hit areas following heavy rainfall.
IN THE PAST India calls for immediate cessation of hostilities
CANAL CLOUDED DESERT
Bhanwar S Charan, Gul Mohd and VijayvargiyaAyushi
Cong presidential poll likely to be postponed a few weeks
Give justice to Bilkis Bano, says Priyanka Gandhi New Delhi (PTI): Congress leader Priyanka Gandhi Vadra on Thursday demanded justice for Gujarat riots survivor Bilkis Bano and said the government has made its stand clear with its silence on the release of 11 people convicted in the 2002 case of her gangrape and murder of her seven family terremissionjaratgustwereThemembers.11convictsreleasedonAu-15undertheGu-government’spolicyaf-serving15years ment has made its stand clear (‘sarkar ne lakeer kheench li hai’) by keeping silent on on the release of 11 people convicted of rape, tweetGandhicamera,”supportexpressingcommentswelcome-forthemonPriyankasaidinainHindi.
NEW DELHI | FRIDAY, AUGUST 26, 2022 082ND FRONT www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia
Ukrainian President Volodymyr Zelenskyy addresses the Security Council on Wednesday.
CONTENDERS
Kota/Baran: Chief Minister Ashok Gehlot on Thursday conducted an aerial survey of the flood-hit areas following heavy rainfall and met affected people. Gehlot took stock of the situation in Bundi, Kota and Baran districts. His tour to Jhalawar was called off later in the afternoon due to bad weather conditions. Gehlot is proposed to visit Mandrayal town in Karauli on Friday to take stock of the villages submerged in flood waters of Chambal river. Speaking to the media after the aerial survey in Baran, Gehlot lashed out at the Centre and demanded that the Eastern Rajasthan Canal Project (ERCP) be declared a national initiative. He said had it been constructed, the flood water from the Kota barrage could have been used in 13 districts and flooding avoided.
Gehlot praises Dhariwal for Chambal river front; assures all help to affected people
India currently is a non-permanent member of the UNSC for a two-year term, which ends in December. On Wednesday, the UNSC held a meeting to take stock of the now six-month-old conflict. As the meeting began, Russian Ambassador Vassily A Nebenzia requested a procedural vote concerning Ukrainian ednia,Feritstatementsmeeting.FollowingparticipationPresident’sinthebyhimandHoxhaofAlba-theCouncilinvit-Zelenskytopartici- pate in the meeting via video tele-conference by a vote of 13 in favour to one against. Russia voted against such an invitation, while China abstained. —PTI
CHAMPION
Life is a series of tests, we decide that does it show our weakness or discovers our strength! —Dr Jagdeesh Chandra, CEO & Editor-in-Chief, First India Russian bombardment of residential area in Nikopol on Monday.
Ahtesham Siddiqui Lucknow: The Uttar Pradesh government has issued a posting order for field training of 16 IAS officers of 2021 batch who are undergoing training at Lal Bahadur Shastri National Academy of Administration, Mussoorie. After the completion of their Professional Courses Phase 1, the officers have to join as Assistant Magistrates for training.Among these trainee IAS officers, Jagriti Awasthi has been posted as Assistant Magistrate at Meerut, Ankita Jain at Rae Bareli, Sarthak Agarwal at Prayagraj, Shashwat Tripurari at Gorakhpur, Krishna Kumar Singh at Ayodhya, Divya Mishra at Hardoi, Prakhar Kumar Singh at Azamgarh, Jagat Sai Rolpally at Banda, Marunali Avinath Joshi at Aligarh, Pooja Gupta at Agra, Dhruv Khadia at Mathura, Kanti Raj at Saharanpur, Shahid Ahmed at Jhansi, Kandarkar Kamal Kishor at Varanasi, Hashikha Singh at Moradabad and Himanshu Gupta at Kanpur.
Lalit K Jha
“What are the hurdles in declaring the ERCP a national project, the Centre must answer,” Gehlot said. He appreciated rescue efforts by the administration, Army, NDRF, and AppreciatingSDRF. UDH minister Shanti Dhariwal for the Chambal river front project, Gehlot said that the project has saved some areas.
DPR of bullet train project ‘not rejected’ New Delhi (PTI): The Ministry of Railways on Thursday denied reports that the feasibility report of DelhiVaranasi bullet train project has been rejected, asserting that its DPR is still thehasRailwayHighofbeenconsideration.under“NodecisionhastakenonDPRDelhi-VaranasiSpeedRail.MinistrynoissuewithDPR,”itsaid.
FIELD TRAINING FOR 16
Raj CM visits flood-hit Hadoti, says ERCP is solution
Good vibes happen on the tides and best of fashion happen on vacation,
City First brings to you the adorable fashion from vacation!
TIDES!TWINING
www.firstindia.co.in I https://firstindia.co.in/epapers/delhi I twitter.com/ thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia 09 NEW DELHI, FRIDAY, AUGUST 26, 2022
UTTKARSHA SHEKHAR uttkarsha.shekhar@firstindia.co.in A
s summer is slipping away very fast with the pleasant and balmy rain and I still can’t believe that August is almost gone. It is true when we say ‘Summer means happy times and good sunshine, perfect weather to heal and relax, but ever wonder what we can wear to make ourselves shine in the scorching heat in the day during the vacation time. Because Vacation has no fixed time, when all else fails, take a vacation. The season is the same. We’re the ones who are changing. Packing for a warmweather trip means smashing the right balance between cosy and trendy, and creating cute over what to wear to the beach and beyond during your next trip, take style inspiration from some of the best-dressed ladies under the butsoOffacetedsers,WhiteCroppedsun.orTraditionalTee,CroppedTrou-BucketHat,Multi-MiniSkirt,PairBlueJeanstherearemuchtochoosefromrememberwhenon
Virgo AUGUST 24 - SEPTEMBER 23
Those in the financial sector can hope to start making profits. You may think up ways of improving your health. A major renovation work may be undertaken at home. A journey is likely to take you down the memory lane. Travel stars look bright for some, especially for overseas travel.
YOUR DAY Horoscope by Saurabbh Sachdeva Whatsapp Subscription “First India” Free To from the Power Corridors of Rajasthan & Delhi.
A trip with friends will be both enjoyable and therapeutic. Family life will remain stable and provide you a firm foundation from where to venture forth. This is the best time for launching your ideas at work. Money multiplies through excellent financial planning.
Aries MARCH 21 - APRIL 20 Time is favourable as your real returns.givinginvestmentsestatestarthandsomeAnofficial trip is likely to keep you tied up. Your help and support to a youngster will help boost his or her self-confidence. Those trying to achieve their professional targets will succeed.
Daily E-News Paper For
DAY!THEOFFACE
Change of diet will improve health. A difference of opinion may pit you against a family elder. Those compelled to travel are likely to find interesting company. Some of you will be able to add to your wealth and even plan to buy property. You are set to enjoy the exclusive company of people.
FEBRUARY 20 - MARCH 20
10ETC NEW DELHI | FRIDAY, AUGUST 26, 2022www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia facebook.com/thefirstindia I instagram.com/thefirstindia
WHEN TO EAT SALAD Salads should always be consumed before meals, it reduces appetite while eating and takes fewer carbohydrates (roti/rice). Along with this, your weight control and the lack of nutrients in the body are also removed.
Sagittarius
Cancer JUNE 22 - JULY 23
Subscribe
Libra SEPTEMBER 24 - OCTOBER 22
TYPES OF SALAD Nowadays food fusion has happened, due to which variety is found in salads. We mix many nutrients to make them colourful and tasty. Vegetable, fruit and sprout salad is mostly preferred in India. which is like this:-
SPROUT SALAD It is made of protein, vitamin C, B like Moong Sprout Salad: Add sprouted moong dal, chana, rajma and soybean and mix well. Now add finely chopped tomatoes, chopped green chillies, roasted cumin, a pinch of asafoetida, olive oil and lemon juice to the sprouts, mix all these things well and add salt as per taste.
Pisces
Some additional perks can be expected by those in the private sector. An enjoyable outing is on the cards for some. Family life will cruise along smoothly and give you time for rest and recoup. A promotion or a prestigious appointment is in store for those in a government job.
Receive the Most Exclusive News
Switching to healthy foods will be the key to remaining fit and active. A family issue may need to be deliberated upon, so that it does not disturb domestic harmony. An out of town invitation will tempt some to undertake the journey. Spirituality may bring a special meaning to your life.
JANUARY 21 - FEBRUARY 19
Businesspersons are likely to do good business today and earn well. The day proves excellent for you, both personally and professionally. Appease someone in the family to have your way.You may have to put your foot down against a trip you are reluctant to go on.
You are likely to experience a positive phase in your existence. Favourable decision can be expected regarding a piece of property under dispute. Those in tourism and hospitality sectors will find new opportunities knocking at their door. You may take the initiative of organising a family gathering.
Gemini MAY 21 - JUNE 21
Leo JULY 24 - AUGUST 23
OCTOBER 23 - NOVEMBER 22
Things positivelymoveon the academic front and encourage you to give your best. Good man management will help you in completing a project or assignment in time. Travelling with your near and dear ones to the countryside will prove immensely fulfilling.
Scorpio
VEGETABLE SALAD This is for people who are on a low-calorie or low-fat diet. to like Cabbage Salad: Cabbage is thinly sliced and taken by adding black salt, lemon juice, red pepper, green coriander, celery strips, vinegar, and black pepper. Mix Vegetable Salad: You can make the salad by adding broccoli, green capsicum, cherry tomato, carrot, flax seed, garlic, salt, pepper, spices, white vinegar etc.
FRUITS SALAD To increase immunity in the body, you can take salads rich in fruits and vegetables. Papaya, pomegranate, banana, kiwi, orange, apple,
Your professionalism is likely to be praised at work. homeunexpectedSomeone’sarrivalatthreatensto upset your personal plans. Seeing new places, meeting new people is in store for some. There is nothing that can go wrong today, except things involving property.
hen it comes to complete nutrients, you get them from salads because salads aren't heated or microwaved, so their nutrients don't spoil. The salad itself is rich in fibre, protein and minerals. In this, you get nutrients like vitamin C, E, A, beta carotene etc.
NOVEMBER 23 - DECEMBER 22
On Whatsapp
Plate of colourful salad creased depending on the amount each individual should give based on their lifestyle. A healthy person can comfortably eat 1 bowl or half a plate of salad. honey, cream or curd, chaat masala, mint, parsley, SURBHI UPADHYAY cityfirst@firstindia.co.in W
Taurus APRIL 21 - MAY 20 Meeting someone new is likely to enlarge your social circle. Something you had wanted for the home may be gifted to you. Your ideas will work on the professional front and speed up the progress. Your financial condition is not bad, but you do possess the potential to earn much more.
CHHAVI, Model
You will be able to get the study stream you desire on the academic front. Going is likely to get better on the professional front. Purchasing a new car or an expensive appliance is indicated. Children can keep you entertained. The day is favourable to get a project underway.
Aquarius
Capricorn DECEMBER 23 - JANUARY 20
VINTAGE
P riyanka Chopra is one of the most talented actresses in the industry. Priyanka also enjoys a massive fan following and every now and then, she updates fans with her daily routine on social media. A few hours back, Priyanka took to her Instagram story and thanked Khushi Kapoor and Boney Kapoor for treating her with yummy Indian snacks. Sharing the photo, the actress wrote, “Thank you @boney.kapoor and @ khushi05k for a taste of home! So kind!” The picture featured many Indian delicacies like khakhra, poha, namkeen, and bhujia. Priyanka is a big fan of Indian cuisine and also owns an Indian restaurant in New York called Sona. Earlier this week, Boney Kapoor and Khushi Kapoor checked into Los Angeles. BEAUTY
P A of Aishwarya Rai Bachchan as Nandini from the film has surfaced on social media. The diva defines elegance in the royal princess avatar with a silk saree and heavy gold jewellery. This magnum opus is based on thisSeptemberthescreensthemahistoricalductions,andMadrasthenunderSubaskara-namducedsame1955Krishnamurthy’sKalkinovelofthename.Pro-byManiRat-andAllirajahunderbannersofTalkiesLycaPro-thedra-willhitbigon30thofyear.Thefirstfromatwo-partse-rieswillenjoyanensemblecastwithVikramasAdityaKarika-lan,KarthiasVanthiyathevan,TrishaasKundavai,andJayamRaviasArunmozhiVar-man,alongwithSarathkumar,Prab-hu,PrakashRaj,Lal,Kishore,Ash-winKakumanu,SobhitaDhulipala,andAishwaryaLek-shmiinprominentroles.Whilethebe-hindthescenesonlygatheredthismuchbuzz,fansaresuperex-citedandhappyforthefilm.
K areena Kapoor Khan never fails to leave her fans stunned with her looks and fashion game. The actress was recently seen in Aamir Khan starrer Laal Singh Chaddha and her performance was appreciated. Well, the actress left all her fans speechless on Wednesday as she looked gorgeous in a denim jumpsuit for an event. In the pictures, we can see Kareena Kapoor Khan walking the ramp for a brand. She looked sporty in a dark blue coloured denim jumpsuit. She tied her hair in a bun and completed her look with white sports shoes. The Udta Punjab actress’ skin glowed and she looked flawless with kohled eyes and peachy lips. Needless to say that all the fans went gaga looking at Kareena and went to her for pictures. Bebo made sure to oblige her
I n a very short span of time, shareRashmikaunmissablelyvindamwhich,popularity.SpeakinggainedMandannaRashmikahasimmenseoftheGeethaGo-actressrecent-treatedfanstosomephotos.wentontosomephotos. shot.. but other than being an actor… I think these are the four pics that res just describe me as ME! They say na – that pictures can speak a thousand words.. it does.. i don’t remember when these were taken but I think I remember the feeling I had when these were taken.. so well this is me in my own lil world..It makes me feel calm.”
Jacqueline Fernandez
ETCwww.firstindia.co.in I https://firstindia.co.in/epapers/delhi I twitter.com/thefirstindia I facebook.com/thefirstindia I instagram.com/thefirstindia NEW DELHI | FRIDAY, AUGUST 26, 2022 11
eople turn religious in their tough times. The side, that somehow remains hidden, comes out in the open. Jacqueline Fernandez, who is going through a tough time ever since her alleged relationship with conman Sukesh Chandrashekhar made headlines. Many Bollywood families are firm believers of Guruji Nirmal Singh from Delhi. Jacqueline Fernandez is the recent one to visit Guruji’s ashram in Delhi’s Chattarpur. According to the sources, “She visited the ashram in July. Took blessings at the Shiv Mandir that was established by Guruji. Someone close to Jacqueline advised her to visit Guruji’s ashram in Chattarpur to turn tough times into better times. Source adds, since then, Jacqueline is taking Guruji everywhere with her in the form of wearing a bracelet of Guruji & also chanting guru mantra once a day”.
Behind scenesthe Kareena’s sporty side Unmissable photos
Aishwarya Rai Bachchan Kareena Kapoor Khan
P ooja Hegde is a popular actress in the industry.entertainmentShehas made a mark for herself in the industry with her talent. She has worked in movies such as Radhe Shyam, Beast, Housefull 4, and others. Pooja Hegde enjoys a massive fan following and her fans wait for her photographs to come out in the public domain. Speaking of which, just a while back, the actress shared a beautiful monochromatic photo on Instagram. She looked a perfect vintage in a large white hat. As soon as she posted the photo, her fans rushed to drop sweet comments in the comment section.
Pooja Hegde Rashmika Mandanna Priyanka Chopra Her post...
There is no shortcut: Shaily Shaily Pandey,Priyaborn in Patna and raised in New Delhi will be playing the female lead in Kismat LakeeronKi Se. In an &aboutactressinterview,exclusivethetalkstheshowhercharacter! t was a visual treat to witness a ists’Kathputlisupportednon-Profitnumberatyambeautifultle’sVarshneyBiswasteenagers,kata.Khushledwithin”“Manasa-andfromatyamtemporaryfreedom,”“Mukti-themainCenterumingUSA,Washington,toKolkata,ofcollaborationglobalartistsfromDelhiSeattle,theonAug22even-atSteinauditori-atIndianHabitatDelhi.TheattractionsofeveningwereAquestforasolocon-Bharatan-productionSeattle,USA,adancedramachurningbySubhagikbySubhajitDasfromKol-Inaddition,twoTonoyaandIshritafromSeat-presentedaBharatan-invocatoryandSeattle’sSadhana-Delhi’scolonyart-puppetdance.
12 NEW DELHI | FRIDAY, AUGUST 26, 2022www.firstindia.co.in I www.firstindia.co.in/epapers/delhi I twitter.com/thefirstindia facebook.com/thefirstindia I instagram.com/thefirstindia CITY BUZZGETSTAYVACCINATEDMASKED
FREEDOM
Ganesha idols to Premium with“GorgeousRuchitacomessionciousnessthatHomeModaks/SweetsHandcrafted&DecorArtPiecescombinetheauspi-oftheocca-andthebeautythatwithit.Ontheoccasion,Bansalstated,indesign&anartisticexpression, our Ganesh Chaturthi collection is perfect for every home for the holy festival. God Ganesh is praised before any other God or Goddess in every puja. We have made murtis as special as the God Himself for this Ganesh Chaturthi.” cityfirstdel@gmail.com
Have you done any professional course in acting? When I was in Delhi University, I enrolled myself for a course in Shri Ram Centre of Performing Arts. I somehow managed to attend both college and acting school. Tell us about your role in the upcoming show, Kismat Ki Lakeeron Se. I play pastthingsunlearngirl.whoShraddha,triestokeepherfamilyto-gether.ShraddhaisasoftnaturedIhadtomanyfrommyrolesinorderto get into the skin of this character. Give us some insight about the show. It’s a story of two sisters. Shraddha is the elder one, who shoulders all the responsibilities. She is sorted and financially stable whereas the younger one, Kirti, is completely opposite. She is vivacious and irresponsible. Which character is closest to your heart? My role in Queens Hai Hum because it was my debut show. And if that wouldn’t have happened, I wouldn’t have been here today.
Elated with the guidelines: Dr Sanjay
The official Twitter handle of the Police Family Welfare Society shared glimpses of the event where Mission Olympic Disabled player Sangeeta was felicitated for setting a world record by travelling 3500 km on a scooty. Biswas De
Purana by Bijay Gupta. Indian folklore and culture have consistently built a bridge between the GODS, GODDESSES, and us humans. Especially in Bengal, we often see the Devis are treated like their own daughter, a part of their family. As per Subhajit, “This project is a story from Bengal. As an artist, I wanted to explore and I wanted to present the richFOR MITALI DUSAD cityfirst@firstindia.co.in I Chic yet classy
Dr Sanjay
cityfirst@firstindia.co.in CITY FIRST S haily Priya Pandey is an Indian television actress. She is known for playing lead role of Pavitra in Azaad’s television show Pavitraa Bharose Ka Safar. She has also appeared in several TV shows such as Shaadi Ke Siyape, Aap Ke Aa Jane Se and Queens Hain Hum. Tell us about your background. I was born in Patna and raised in different cities like Lucknow, Chandigarh and Delhi. I completed my graduation from Delhi University and I was also into performing arts in my school and college days.
MUKTI- A QUEST
Police Family Welfare Society President Ritu Arora, while visiting the Wellness Center Model Town, appreciated Herbal Garden for their initiative to make the environment green and assured the residents of their redressal by listening carefully to their problems on Wednesday.
GO GREEN!FELICITATION CEREMONY! Piyali
CITY FIRST D r Sanjay Gupta - Vice Chancellor of UniversityWorldof Design on UGC's latest stance at accepting the proposal to hire industry experts as faculty members in Higher Educational Institutes said, "Running an institute that has creativity at its core, I am extremely elated with the latest draft guidelines laid out by UGC. In the art, architecture & design domain, It is not just a significant development at bringing students to terms with knowledge based on practice and making their learning experiential but is essential in nurturing design aspirants to be industryready. At any juncture in our academic lives, we all face a wide lapse between theory and what exists; which is why the possibility of bringing in experts with an enriching experience in a domain as 'Professors of Practice' raises the scope for chiselling out the best in students."
Subhajit Khush Das Shaily Priya Pandey
Gupta ‘Manasa- the churning within’ dance drama
The show started with two American teenagers of Indian origin presenting Shiva Panchakshara stotram with tanatyamcontemporarythought-drivensearch-basedfreedom”settledevenupthesegoodKauthuvam.NateshaItisafeelingtoseeteenskeepingIndiantraditionsthoughtheyareabroad.“Mukti-aquestforisare-deepsoloBhara-production
BansalRuchita
