word alive specialty

Page 1

releases MAY-AUGUST 2024

ISBN:

Binding:

Retail:

Discount:

Release:

9781546005780

Hardcover

$35.00 42% May 7, 2024

Joyce Meyer Summary:

Each of us was created to live a life that has distinct purpose and that leaves a unique imprint on the world. Joyce Meyer helps us learn how to hear and follow God’s voice when He calls us.

Did you ever dream about what you would be when you grew up? We think naturally about our purpose because God tells us that He created us to do great things. But how do we know when we have truly found God’s calling for our lives? Many people live most of their lives striving to find and follow God’s will but still wondering whether they’ve gotten it right.

Joyce Meyer invites us on a journey to confidence, freedom, and peace through exploring the wisdom of what the Bible tells us about God’s character and about His love and purpose for us. She also offers practical steps to discovering how to build your trust in God, seek His guidance, and overcome the fear of missing out on His best for you.

If you’re struggling to have confidence that you can hear God’s voice and know what He’s created you to be and do, Finding God’s Will for Your Life will leave you with more peace and more confidence to live joyfully in God’s love and walk the path He has for you.

Also Available:

9781546007586

$38.00

Previous:

ISBN:

Binding:

Retail:

Discount:

Release:

9781540904126

Tradepaper

$24.49

50%

July 16, 2024

Heidi Barr

Summary:

The incredible true story of a Jewish girl who died at age 16 and had an unexpected encounter with Jesus before returning to this life--and how that experience in heaven changed her forever.

Heidi Barr didn't believe in Jesus. No one in her Jewish family did, nor did they want to--especially not her father, who told her that Jesus Christ was the greatest hoax ever perpetrated on humankind. So when Heidi was in a terrible horseback riding accident and died at age 16, Jesus was the last person she expected to see. Yet she did. And then she returned to life.

This is the incredible true story of Heidi's difficult family life, her sudden death, her unexpectedly loving encounter with Jesus, and her return to life on earth as a person completely and irrevocably changed. This is also the story of Heidi loving her father and mother despite their disbelief of and disagreement with her faith. And this is the gripping, beautiful story of her parents' eventual reconciliation both with Heidi and with God, through the redeeming grace and all-encompassing love of Jesus Christ.

ISBN:

Binding:

Retail:

9798887692357

Tradepaper

$25.99

Discount: 45%

Release: June 18, 2024

Shagufta Kausar Summary:

Raised as a Christian minority in a Muslim nation, Shagufta Kausar learned early on to never argue about faith or to stand up for her beliefs. Doing so could easily lead to riots and deadly violence, so she was told to always be silent, like a lamb.

In 2013, local police raided Shagufta's home, accusing her of sending a blasphemous text to a local imam. As a mother of four, Shagufta was arrested, her handicapped husband, Shafqat, was hung upside down and beaten, and her children were put in state custody. The truth was, Shagufta didn't even have a phone and was illiterate – she couldn’t write or speak the language in the text. She was impossibly innocent.

Convicted at a trial she was not allowed to attend and sentenced to death by hanging, Shagufta was told that she could save herself and her family if she would only abandon her faith and accept Islam. Under threat of death, she refused.

Her stunning true story of a courageous mother of four standing against the tyranny of her country’s blasphemy laws illuminates the reality of what many Christians around the world face every day. Shagufta is a voice for Christian minorities that suffer daily persecution under unjust laws.

Similar biographies:

ISBN:

Binding:

Retail:

Discount:

9798887692258

Tradepaper $23.49 45%

Release: June 4, 2024

Emily T. Wierenga

Summary:

Theabsorbingliterarymemoirofayoungwoman sufferingfromafamineofbodyandsoulwhoisledby thepoortothegreatestfeastonearth.

Inthisabsorbingliterarymemoir,EmilyWierenga,authorof AtlasGirl,drawsyouintoherintricateandprofoundworld, transportingyoufrommemoriesofherpainfulpastwith anorexiaandtroubledrelationships,tosacredmomentsasa wifeandmother,toafellowshipofsufferinginAfrican villages.HerdeepesthungerissatisfiedbytheGodWho BecameBread—whowelcomesusalltoHistablesothatHe canfillus,andthen,throughus,satisfythehungerofthe world.

ThegospelofGodistheBreadofthePresence,andit reachesdownintothedeepest,darkest,ugliestrecessesof thehumanspirit,theplacespolitechit-chatwon’tallow... Thesearetheplacesinwhichweruntothealtarandfind thebread,stillwarm.Thesearetheplaceswebegintoget full.WhereouronlyfoodbecomesGodHimself.

AndwhenyoufindHim,Hewillpullyoucloseandfeedyou untilyoufeastuntilyoulaughuntilyoucannothelpbutpull othersclosetoo.

Thefedbecomesthefeeder.

About the Author:

Emily is passionate about advocating for the poor. She is a regular columnist for Christian Courier, and president of The Lulu Tree (www.thelulutree.com), a non-profit preventing tomorrow's orphans by equipping today’s families through the local church in Africa and Asia. She lives in Alberta.

ISBN:

Binding:

Retail:

Discount:

9780825448195

Tradepaper

$27.49 42%

Shannon Popkin Summary:

Teengirlsdiscoverpurposeinaworldthatsaysthey aren'tenough

Mostteengirlsstrugglewithcomparison.Thepressureto measureuptopeersandsocialmediainfluencersis relentless.Everyoneseemstohavetheirownstandardfor whatateengirlshouldbe,andthoseexpectationsfeel impossibletomeet.

ComparisonGirlforTeensistheteengirlguideto navigatingthesetrickywaters.Best-sellingauthorsShannon PopkinandLeeNienhuishaveteameduptoshowteenshow tobreakfreefromthecomparisontrapandembracethe incrediblelifethatJesushasinstoreforthem.

Ajourneyofself-discoverywith40readings,Comparison GirlforTeensincludesquizzes,evaluations(don'tworry-they'refun),discussionquestions,andplentyof heartwarmingstoriestokeepteengirlscompanyalongthe way.Whetherthereaderisaseasonedbelieverorjust exploringherfaith,sheisinvitedtonewfreedom, confidence,andinfluenceassheadoptsJesus's"me-free" mindsetinthistoxic,measure-upworld.

Release: April 23, 2024

Previous:

ages 1-4

ISBN:

Binding:

Retail:

Discount:

Release:

9781546007647

Board Book

$10.99

42%

July 16, 2024

Phil Vischer Summary:

Reassure little ones that God is bigger than their fears with this comforting board book based on a beloved VeggieTales song.

When the lights go out at bedtime and shadows loom, children tend to let their imaginations run wild, envisioning monsters in every dark corner. This soothing board book proclaims the calming truth that God is always watching over us, and He is bigger and more powerful than any of our fears.

Tackling a tough topic with colorful illustrations, beloved characters, and a dash of VeggieTales silliness, this book will help little ones sleep easier at night, secure in the knowledge that God is watching over them.

42%

Premium Value Thinline Bibles

This Bible has readable text, an attractive layout, and an affordable price in a thin, easy-to-carry size. And while it has the same low price of basic text Bibles, it has so much more!

It not only features a bold new design, but also includes the groundbreaking Filament Bible app.

SpecialFeatures:

--8.5fontsize/10.25fontLGPRT

--5.4"x8.5"trimsize/6.3"x9.3"LGPRT

--LifeApplicationLifeTopicsIndex

9781496484772

9781496484789

9781496484031

9781496484048

June 4

July 9

Trinity Cross Black LL.....................$24.99
Dusty Pink Vines LL........................$24.99
Black Cross LGPRT LL....................$31.99
Lavender Song LGPRT LL..............$31.99
Large Print

Premium Value

Giant Print

Bibles

9781496482624

9781496482631

9781496482648 Black LL

This Giant Print Bible has a comfortably readable text, an attractive layout, and an affordable price, + the Filament Bible app.

SpecialFeatures:

--14fontsize

--6.5"x9.2"trimsize

--LifeApplicationLifeTopicsIndex

--Presentationpage

IncludestheFilamentApp!

Use your mobile phone or tabletto connect every pagetoa vastarrayof related content, incl. studynotes, devotionals, interactive maps,informative videos, and worshipmusic.

July 23
Lavender Vine LL
British Tan Mountain LL
$47.99

Student Thinline Reference Bibles

9781496483898

9781496483935

9781496483904

9781496483942

Reignite Bible reading in your teen or student.

Ready for a Bible that fits your on-the-go lifestyle? This Bible is your ultimate companion for life's adventures. Packed with readable text, a sleek layout, and crossreferences— all in a slim, easy-to-carry size perfect for school, church, youth group, or wherever you roam.

SpecialFeatures:

--8.75fontsize

--5.4"x8.5"trimsize

WordsofJesusinred

--Presentationpage

--Thousandsofcrossreferences

--Tyndaleversefinder

Overflow Black LL........................................$47.99
Overflow Black LL INDEX...........................$61.99
Tropical Iris Teal Blue LL............................$47.99
Tropical Iris Teal Blue LL INDEX..............$61.99
July 9

Kids’ Thinline Reference

ages 8-12

9781496483973

With fun cover designs and a compact size that's easy to carry, your kids will be thrilled to take it everywhere—to school, church, or camp!

SpecialFeatures:

--8.75fontsize

--5.4"x8.5"trimsize

WordsofJesusinred

--Presentationpage

--Thousandsofcrossreferences

--Tyndaleversefinder

--Maps

Bible
Camo Blue LL.....................................................$40.99
Camo Blue LL INDEX........................................$54.99
Tropical Flowers Dusty Pink LL......................$40.99
Tropical Flowers Dusty PInk LL INDEX........$54.99
9781496483997
9781496483980
9781496484000
July 9

Tyndale House Publishers

9781496481535

Pub Date: 5/7/24

$16.99 USD Trade Paperback

352 Pages

Carton Qty: 1

Fiction / Christian

FIC042100

8.3 in H | 5.5 in W

23.49

Leaning on Air

Cheryl Grey Bostrom

Summary

They last spoke as teens . . .

But on a country road twelve years later, a surprise encounter reunites ornithologist Celia Burke with veterinary surgeon Burnaby Hayes, and they plunge into the most unusual romance of her life.

After a decade of marriage, Celia and Burnaby have found a unique and beautiful rhythm. Then tragedy strikes while Celia hunts for the nest of a research hawk near the Snake River. Reeling with grief, she’s certain Burnaby won’t understand her anguish or forgive the choice that initiated it.

She flees to kindness at a remote farm in Washington’s Palouse region, where a wild prairie and an alluring neighbor convince her to begin anew. But when unexplained accidents, cryptic sketches, and a mute little boy make her doubt her decision, only a red-tailed hawk and the endangered lives of those she loves can compel her to examine her past—and reconsider her future.

A soaring tale of wonder, loss, redemption, and restoration from Cheryl Grey Bostrom, the award-winning author of Sugar Birds.

A beautifully crafted story set in the Pacific Northwest that brings the setting to...

Focus

on the Family

9781646070824

Pub Date: 5/7/24

$16.99 USD Trade Paperback

256 Pages

Carton Qty: 1

Religion / Christian Living

REL012130

8.3 in H | 5.5 in W

23.49

A Survivor's Secrets

Once Trafficked, Now Free from Feelings of Worthlessness, Fear, and Shame

Summary

In a world where darkness can seem impenetrable, A Survivor’s Secrets emerges as a testament to the indomitable power of the human spirit and the transformative nature of God’s love.

Just as she emerged from years of childhood physical and sexual abuse, Gina Cavallo found herself ensnared for nearly three years in the clutches of human traffickers, enduring the unspeakable horrors of prostitution. After a harrowing escape, Gina spent the next three decades shackled by fear, shame, and a crushing sense of worthlessness as she concealed her painful past—even from her husband. Her tale is ultimately one of resilience, courage, and eventual liberation. Today, Gina is a prominent speaker, advocate, and mentor for survivors of human trafficking. A Survivor’s Secrets will …

increase your understanding of the human trafficking crisis, strengthen your resolve for change, provide insight into the mechanisms used to lure people, and inspire you to advocate for those trapped in bondage.

You will discover God’s astounding power to free anyone of the grip of fear, shame, and worthlessness that holds so ...

previous bk: Sugar Bird (reads like a novel)

TYNDALE HOUSE PUBLISHERS tyndale interiors b spr 24 - January 2024 Page 3
BIOG

NavPress

9781641582926

Pub Date: 6/4/24

$16.99 USD Trade Paperback

224 Pages

Carton Qty: 1

Religion / Christian Living

REL012030

8.3 in H | 5.5 in W

23.49

The Rhythm of Home

Five Intentional Practices for a Thriving Family Culture

Chris Graebe, Jenni Graebe

Summary

FAMILY

Feeling overwhelmed by the challenges of parenting? Want to cultivate a home life that aligns with your deepest dreams and values as a family?

Chris and Jenni Graebe, authors of The Rhythm of Us: Create the Marriage You Long For, are back to share the intentional habits of flourishing families who love God and truly enjoy each other. You’ll take inventory of your current family rhythms, consider your unique core values, and move toward the life you truly envision for your family. Along the way, Chris and Jenni offer practical tips and strategies to navigate the challenges of parenting and cultivate a thriving family life.

Through exploring five intentional practices of flourishing families, you will learn to map out a vision for your family legacy, create a home environment that supports your deepest family values, connect on a deeper level with your kids in ways that will last a lifetime, and shape a loving and joy-filled family culture.

Whether you are just starting your family or are farther along in your parenting journey, The Rhythm of Home will help you create a strong foundation. You...

Authors/Pastors cohost the Rhythm of Us podcast

NavPress

9781641587679

Pub Date: 7/9/24

$16.99 USD

Trade Paperback

192 Pages

Carton Qty: 1

Religion / Christian Living

REL012160

8.3 in H | 5.5 in W

23.49

Little Habits, Big Faith

How Simple Practices Help Your Family Grow in Jesus Christie Thomas

Summary

Feeling daunted by how to help your kids really grow in their faith? It’s time to start little.

We want our kids to know God. We know we’re supposed to disciple them. But parenthood is hard, and we’re busy, tired, and often feel unequipped. What if our kids don’t seem all that interested or can’t sit still long enough for us to read the Bible?

Christie Thomas has a secret for you: helping your kids connect with God is way easier than you think. It all starts with 30 seconds a day--and the power of a simple habit. Through Christie’s empowering, encouraging insights, you’ll discover how to overcome common struggles, implement easy practices that fit your unique kids, and change your family’s faith culture. In this book, you will:

discover how to make Scripture and spiritual practices come alive for short attention spans learn simple steps for developing faith through the Faith Growth Cycle and its three stages- seed, sprout, and root. develop practical strategies for establishing consistent habits

Life-changing moments can come out of simple habits. If you’re feeling overwhelmed by all the t...

Author

is from Sherwood Park, AB

NAVPRESS tyndale interiors b spr 24 - January 2024 Page 7

Focus on the Family

9781646070466

Pub Date: 5/7/24

$15.99 USD

Trade Paperback

240 Pages

Carton Qty: 1

Religion / Christian Living

REL012030

8.3 in H | 5.5 in W

21.99

Caring for Kids from Hard Places

How to Help Children and Teens with a Traumatic Past

Summary

Why doesn’t he act his age? Why does she behave so impulsively? Why does he have meltdowns so often?

There is always meaning behind behavior in all of us. It might be a behavioral reaction from something as simple as hunger or exhaustion. Or something far more serious – a triggered reaction to a traumatic, frightening experience.

Children who have experienced early childhood neglect or trauma are often greatly impacted in developmental ways. Children in foster care or who are given up for adoption often deal with these kinds of negative early experiences and it can be difficult to know how to help. People who teach–either in school or children’s ministry often see these youngsters’ behavior as confusing and don’t understand why.

In Caring for Kids from Hard Places, Jayne and David Schooler discuss the reasons behind why children and teens sometimes exhibit potentially disruptive behavior. Together, they offer practical strategies on training, equipping and resourcing staff and volunteers to provide a responsive environment for children with behavioral challenges. Caring for Kids from Ha...

David is a pastor & counselor

CHRISTIAN LIVING

Tyndale Momentum

9781496486332

Pub Date: 5/7/24

$17.99 USD Trade Paperback

208 Pages

Carton Qty: 1

Religion / Christian Living

REL012120

8.3 in H | 5.5 in W

24.99

Heaven Awaits

Anticipate Your Future Hope, Your Eternal Home, Your Daily Reality

Summary

Is There Something More Than This Life?

This world is full of crises and conflicts, difficulties and troubles -- but this world will not last. No matter what your age is, your earthly life is slowly slipping away. This is why Jesus encourages us not to store treasures on this earth. In other words, invest in heaven.

In Heaven Awaits, you will explore what the Bible says about heaven and begin to envision the wonders and glories that await you. Heaven is real. And throughout these pages, you will discover that your eternal home is far more real than your earthly experience right now. As such, you will be energized to live each day in light of that awe-inspiring reality.

Heaven Awaits will serve as your eternal investment guide by helping you:

Envision the 9 blessings of heaven—which include the joy of no longer experiencing any loss to the freedom from the pain of disillusionment;

Explore the 8 facets of heaven—which includes the rest that you will experience to the abundant life that you are destined to possess;

Discover the 10 benefits of heaven—which includes the loving family whose comp...

FOCUS ON THE FAMILY tyndale interiors b spr 24 - January 2024 Page 8

NavPress

9781641589154

Pub Date: 8/6/24

$14.99 USD

Trade Paperback

144 Pages

Carton Qty: 1

Religion / Biblical Studies

REL006740

Series: Experience Scripture

9 in H | 7 in W

20.99

Experience the Wisdom of Proverbs

31 Days of Reading, Learning, and Living God’s Word

Summary

Help your students experience the wisdom of Proverbs!

BIBLE STUDIES

The principles and truth contained in the book of Proverbs are as relevant as ever. This beautiful study guides students to wise living and instills a lifelong love and appreciation for Scripture. Each day, a student will read a Proverb and be challenged to apply its wisdom to their everyday life. Experience Scripture resources are designed specifically to help readers engage with God’s Word through reading and reflection. As they become Biblically fluent, students will be able to apply its principles in everyday life. These resources are:

Rooted in Scripture - this is not a self-help manual, but a resource that fosters a life-long habit of reading the Bible.

Beautifully designed - contemporary design that appeals to students who appreciate a clean reading experience.

Accessible - can be completed in one month. Each day includes brief explanation of passage’s major themes to quickly understand context.

Experiential - Scripture is meant to be experienced. This resource provides tangible ways for students to interact with Scripture.

Author is a pastor; with a BA from Moody Institute for teens & young adults

NavPress

9781641589079

Pub Date: 8/6/24

$14.99 USD

Trade Paperback

144 Pages

Carton Qty: 1

Religion / Biblical Studies

REL006710

Series: Experience Scripture

9 in H | 7 in W

20.99

Experience the Gospel of Mark 30 Days of Reading, Learning, and Living God’s Word

Summary

Help your students experience the storyline of Jesus and the major themes of the book of Mark.

The book of Mark introduces us to the life and ministry of Jesus and describes what it looks like to be a Christian. This beautiful and experiential study inspires students to follow Jesus and instills a lifelong love and appreciation for Scripture. Each day, a student will read a portion of Scripture and then be challenged to apply its truth to their everyday life. Experience Scripture resources are designed specifically to help readers engage with God’s Word through reading and reflection. As they become Biblically fluent, students will be able to apply its principles in everyday life. These resources are:

Rooted in Scripture - this is not a self-help manual, but a resource that fosters a life-long habit of reading the Bible.

Beautifully designed - contemporary design that appeals to students who appreciate a clean reading experience.

Accessible - can be completed in one month. Each day includes brief explanation of passage’s major themes to quickly understand context.

Experiential - Scripture...

NAVPRESS tyndale interiors b spr 24 - January 2024 Page 13

Tyndale House Publishers

9781414348308

Pub Date: 7/1/11

$16.99 USD

Hardcover

416 Pages

Carton Qty: 24

Ages 03 to 06, Grades P to 01

Juvenile Nonfiction / Religion

JNF049010

8.6 in H | 5.7 in W | 0.9 in T | 1.4 lb Wt

23.49

My First Hands-On Bible

Tyndale, Group Publishing

Summary

cover update - ages 4-6

KIDS

My First Hands-On Bible is the preschooler version of the popular Hands-On Bible, which has sold over a half million copies. Jesus taught with hands-on lessons and illustrations; My First Hands-On Bible uses the same experience-based learning to communicate God’s Word in an active, understandable way. My First Hands-On Bible is a fun and simple yet meaningful way to engage preschool, pre-K, and K children (ages 3-6) with the Bible while helping them build a solid faith foundation. Each lesson focuses on a specific Bible point through a variety of activities in order to reinforce and help young children remember the stories and lessons. Using common household items, you can help your children have a “hands-on” learning experience while engaging them in 85 key stories from the Bible. My First Hands-On Bible doesn’t just retell the Bible stories; it also includes actual Scripture from the easy-to-understand and easy-to-read Holy Bible, New Living Translation. In addition to the stories and activities, there are fun illustrations, prayers, and a special Jesus Connection feature.

Tyndale Kids

9781496484123

Pub Date: 8/6/24

$29.99 USD

Trade Paperback

792 Pages

Carton Qty: 1

Juvenile Fiction / Religious

JUV033160

Series: The Dead Sea Squirrels

7.6 in H | 5.5 in W

40.99

The Dead Sea Squirrels 6-Pack Books 7-12: Merle of Nazareth / A Dusty Donkey Detour / Jingle Squirrels / Risky River Rescue / A Twisty-Turny Journey / BabbleLand Breakout

Mike Nawrocki, Luke Séguin-Magee

Summary

ages 6-10

A second nutty buddy collection of Dead Sea Squirrels adventures!

Merle and Pearl have been squirrel-napped and taken back to Israel! As Michael, Sadie, Justin, and the Gomez family set off on a wild rescue mission, the squirrels will uncover a villainous plot and meet more talking animals like a lock-picking alpaca, a retired tour-guide donkey, and a honey-loving lizard. Get ready for daring disguises, hilarious jokes, and much more Middle Eastern mayhem in books 7–12 of the Dead Sea Squirrels series.

You’ll laugh out loud and learn more about the life of Jesus from two previously petrified squirrels who actually lives in Bible times!

TYNDALE HOUSE PUBLISHERS tyndale interiors b spr 24 - January 2024 Page 17

Tyndale Kids

9781496473073

Pub Date: 6/4/24

$21.99 USD Trade Paperback

624 Pages

Carton Qty: 1

Juvenile Fiction / Religious

JUV033050

Series: Backyard Horses 7 in H | 5 in W

30.49

Backyard Horses 4-Pack: Horse Dreams / Cowboy Colt / Chasing Dream / Night Mare

Summary

ages 6-10

Four horse-loving adventures tucked together in one heart-warming collection.

Join Ellie James and her quirky family in their exciting, horse-loving adventures. This Backyard Horses set includes books 1–4 of this fun chapter book series, where Ellie learns to love horses that are better kept in backyards than fancy stables. Life is never boring for Ellie James, a feisty fourth grader, who is always daydreaming about owning a sleek black station and winning trophies at the horse show. But when a backyard horse shows up in her life, even she can’t imagine the wild ride she’s in for.

This 4-Pack Collection Includes:

#1 Horse Dreams: Ellie’s finds a runaway horse at school! Can she rescue her before animal control arrives?

#2 Cowboy Colt: Ellie’s best friend, Colt, is going through a rough time and dreams of a horse of his own. #3 Chasing Dream: Ellie stages a competition to prove her backyard horse, Dream, is as good as a stable horse.

#4 Night Mare: Dream’s true owners arrive. Will Ellie get to keep her beloved horse?

Fans of horse books will love this chapter book series.

Focus on the Family

9781646071326

Pub Date: 8/6/24

$14.99 USD Trade Paperback

160 Pages

Carton Qty: 1

Juvenile Fiction / Religious

JUV033040

Series: Magnificent Mulligans

8.3 in H | 5.5 in W

20.99

Dolphins in Danger

Summary

#5 Magnificent Mulligans

ages 8-12

From best-selling author Bill Myers comes a hilarious, faith-filled, and action-packed adventure starring the Mulligan family.

The Magnificent Mulligans are back, and they’re learning again how to stick together, protect the vulnerable, and stand up for what’s right. When Dad gets a call from a friend who needs help with a distressed dolphin, he and Lisa drive up the coast to try to help. But a big storm in the forecast is going to make this mission difficult.

Meanwhile, the other Mulligans are excited about new opportunities. Julie is learning to take care of flamingoes, Janelle is learning to play tennis, and Nick is learning how to fly an airplane. Nick’s first lesson? Convincing his instructor that he’s really ready to take the yoke. The guy keeps glancing nervously at the parachute he brings along for the flight!

#2 - Lions, Elephants, and Lies

#4 - What a Croc!

TYNDALE KIDS tyndale interiors b spr 24 - January 2024 Page 18
#1 - Leapin' Leopards #3 - Smoke in the Air

Tyndale Kids

9781496473035

Pub Date: 6/4/24

$19.99 USD Trade Paperback

720 Pages

Carton Qty: 1

Juvenile Fiction / Religious JUV033040

Series: Red Rock Mysteries 7.3 in H | 5.3 in W

27.49

Red Rock Mysteries 3-Pack Books 13-15: Hidden Riches / Wind Chill / Dead End

Summary

ages 8-12

Best-selling and award-winning authors Jerry Jenkins and Chris Fabry grab the attention of kids in these fast-paced, exciting books.

Watch out! The Timberline twins are on the loose. Bryce and Ashley are 13-year-old twins from Colorado who unearth action-packed mystery and adventure wherever they go. The twins’ growing faith and the strong example of their parents guide them through even the most life-threatening situations. Using their trademark page-turner style, authors Jerry Jenkins and Chris Fabry (Left Behind: The Kids series), will keep even reluctant readers on the edge of their seats as they read these fast-paced books. Perfect for ages 8–12.

This set includes books 13–15 in the 15-Book Red Rock Mysteries series:

Hidden Riches: Ashley and Bryce are in a tough spot. Will their quick getaway on their ATVs keep them safe…or send them over a cliff?

Wind Chill: Among a handful of students competing in a tournament at a mountainside college, Ashley discovers a student is missing. Can she and Bryce find the missing girl before they are found missing?

Dead End: Bryce notices a suspiciou...

Wander

9781496473196

Pub Date: 6/4/24

$49.99 USD Trade Paperback

1408 Pages

Carton Qty: 1

Young Adult Fiction / Religious

YAF051060

Series: Dragons in Our Midst 9 in H | 6 in W

Dragons in Our Midst 4-Pack: Raising Dragons / The Candlestone /Circles of Seven / Tears of a Dragon

Summary

TEEN

The Dragons in Our Midst series is a modern-day Arthurian adventure following a boy with fire breath and a girl with dragon wings as they battle against a thousand-year-old dragon slayer.

Readers will be drawn to the hair-raising adventure with relevant themes like trusting friends, compassion, forgiveness, loyalty to family, faith, and light triumphing over darkness. This complete set includes the four books in the Dragons in Our Midst series:

Raising Dragons: Outcasts Billy and Bonnie must come together to preserve a thousand-year-old secret legacy. Thrust into an evil war they didn’t even know existed; the teens’ newly formed friendship will be tested as they battle a blood thirsty dragon slayer who wields a powerful, medieval weapon. This unlikely pair will try to save their dragon heritage before it’s destroyed forever.

The Candlestone: Billy and Bonnie learn to use their unique strengths as they battle powerful enemies wielding the candlestone, an ancient gemstone weapon used against dragons.

Circles of Seven: Billy and Bonnie discover seven evil circles in a multidimensional world...

TYNDALE KIDS tyndale interiors b spr 24 - January 2024 Page 19
68.49

Focus on the Family

9781646070909

Pub Date: 6/18/24

$14.99 USD Trade Paperback

256 Pages

Carton Qty: 1

Young Adult Fiction / Religious

YAF051110

Series: Riverbend Friends

8.3 in H | 5.5 in W

20.99

Running on Empty

Summary

#7 Riverbend Friends

Running on Empty is the seventh book in a series that travels alongside four friends as they deal with teen life in Riverbend, Indiana. The novel inspires young women to deepen their relationships with God as they face real-life issues and solve their problems in God-honoring ways.

Who is the real Isabella Valadez? Izzy has been spending the summer trying to find that out. She’s tried all sorts of hobbies, games, and sports—even golf. She still loves art and showing off her baking creations, but is there something unexpected there?

Speaking of something unexpected, she’s been growing closer to her cute neighbor, Cody. Could that friendship morph into something more? Maybe, but she’s starting to question everything. School is starting up again, and it’s time to choose where she’ll invest her energy, and who she’ll be doing it with. It seems everyone that she’s close to has something dark lurking beneath the surface. Daniel, Shay, and now Cody?

When everyone has a smartphone, access to inappropriate or hurtful content can affect mental health and damage relationships. Gossip and misinform...

#1 - Real, Not Perfect #5 - Life in the Middle

#2 - Searching for Normal #6 - Heart of Belonging

#3 - The Me You See

#4 - Chasing the Spotlight

Tyndale House Publishers

9781496481108

Pub Date: 7/23/24

$17.99 USD Trade Paperback

256 Pages

Carton Qty: 1

Religion / Christian Living

REL012060

8.3 in H | 5.5 in W

24.99

From Broken Boy to Mended Man SPANISH

SPANISH

Un plan práctico y lleno de esperanza para liberarse de lo que te está limitando: heridas ocultas, ciclos viciosos destructivos, enojo reprimido y más.

Somos millones. Cargamos el dolor de heridas de la niñez. Ese dolor que no hemos procesado nos hace actuar de maneras que lastiman nuestras relaciones. Nos ofendemos con facilidad. Somos enojadizos y frágiles. Estallamos. Nos ensimismamos. Nos desconcerta nuestro propio comportamiento. Siendo francos, ni siquiera estamos seguros de qué concierne el comportamiento normal.

Puedes, por la gracia de Dios, tomar el control de tu vida y lograr mucho, mucho más.

En De niño quebrantado a hombre restaurado, Patrick Morley describe su propia travesía a través de la sanidad y ofrece consejos sobre cómo revelar heridas que pueden alimentar patrones destructivos por décadas. Este libro te puede ayudar a descubrir:

Cómo superar la negación y reconocer tu sufrimiento Cómo encontrar la sanidad para las heridas de tu niñez y librarte de ciclos viciosos destructivos y disfuncionales que te están limitando Cómo cambiar tu perspectiva para tener un punto de vi...

FOCUS ON THE FAMILY tyndale interiors b spr 24 - January 2024 Page 20
NONFICTION MAY–AUGUST 2024
XY

HOW TO BUILD A THRIVING MARRIAGE AS YOU CARE FOR CHILDREN WITH DISABILITIES

Build a Vibrant, Joyful Marriage While Raising a Child with Disabilities

·Authors are credentialed, with personal and professional experience in this field

·Practical guidance for couples on building marriage skills backed by research

·Unique marriage and parenting resource that will reach an underserved market with a strong felt need

Building a vibrant and joyful marriage is always a challenge. When you add the stresses inherent in parenting children with disabilities, it becomes both more difficult and more critical.

MAY 14 • US $18.99 • CAN $24.49 9781540903730

Paperback / softback

8.500 in H | 5.500 in W

288 pages • Carton Quantity: 40

RELIGION / Christian Living / Love & Marriage

RELIGION / Christian Living / Parenting

FAMILY & RELATIONSHIPS / Children with Special Needs

Once on the brink of divorce, Kristin and Todd Evans uncovered the unique set of skills critical for growing a fulfilling relationship amid the extraordinary challenges of caring for their two children with special needs. Now they are sharing their hard-won discoveries and inspiring marriage story with you. Weaving together insights from Scripture, research, and clinical and personal experience, Kristin and Todd offer you the practical relationship tools you need to save, strengthen, and enjoy your marriage. They help you

·identify your unique needs

Kristin Faith Evans, MA, MS, LMSW, and Todd Evans, PhD, MA , are award-winning authors, speakers, and disability parents. They earned their MA in Christian educational ministries at Wheaton College in Illinois and have served together in full-time ministry in church, camping, and retreat settings. Todd received his PhD from Vanderbilt University's School of Engineering and currently manages his own business. Kristin earned her MSW from the University of Tennessee and is a Licensed Master Social Worker experienced in couples, child and family, substance abuse, and crisis counseling.

·assess your strengths and weaknesses

·set your priorities

·develop healthy stress management skills

·deepen your communication and connection

·tackle problems as a team

·find ways to rest and recharge

·nurture sexual intimacy

·build a strong support network

·and so much more

MAY 2024 Baker Books
3

PRAYING THROUGH YOUR PREGNANCY, REPACKAGED ED.

A Week-by-Week Devotional for Expecting Moms

Jennifer Polimino and Carolyn Warren

Cover Your Pregnancy in Prayer While Learning about Your Baby's Growth

·Previous editions have sold more than 50,000 copies

·Interactive guidebook with prayers, reflection questions, and information about your baby's growth

·Beautifully repackaged resource is a great gift for expectant mothers

Pregnancy is a time of great preparation. We prepare the nursery for the baby, we prepare our families to welcome a new member, we prepare our bodies to bring a sweet new life into the outside world. But how much thought do we give to preparing our hearts?

JULY 23 • US $18.99 • CAN $24.49 9780800746018

Paperback / softback

8.500 in H | 5.500 in W

288 pages • Carton Quantity: 32

RELIGION / Christian Living / Prayer RELIGION / Christian Living / Women's Interests HEALTH & FITNESS / Pregnancy & Childbirth

Praying Through Your Pregnancy is the perfect companion for this special time in your life. Each chapter in this week-by-week guide reveals what is happening with your baby's development that week, starting with the very first moment of conception. You'll discover how to reduce stress and anxiety by placing your confidence in God for the healthy development of your precious growing baby. Journaling space helps you remember in years to come how God was at work at every stage. And each chapter contains a special list of Scripture verses to guide further prayer and meditation on God's Word.

Jennifer Polimino is the founder of PrayForYourBaby.com. She has been featured on the 700 Club and Focus on the Family, as well as countless other radio programs and podcasts. Jennifer and her husband, Dan, have two children and live in Kailua-Kona, Hawaii.

Carolyn Warren is the author of several books on finance and has been interviewed on Money Talk and other programs. She lives in Bellevue, Washington, with her husband and has a son and a daughter. Learn more at AskCarolynWarren.com.

As you enter a time of great joy--and great change--for your family, let Praying Through Your Pregnancy be with you every step of the way.

JULY 2024
Revell
16

ONE YEAR WITH JESUS

A Weekly Devotional Journal for Middle School Girls

Kelsey Scism

Much-Needed Devotional for Early Teen Girls Navigating Life's Changes and Challenges

·Each devotion includes a verse, reflection questions, prayer prompts, and journaling space

·Great conceptualization from an author who has vocational and parenting experience with the target audience

·Strong felt need for moms looking for something to help their teen girls connect with their faith

Being a middle school girl has rarely felt so challenging and confusing as it does today, with crises exploding around loneliness, mental health, social media, and gender and identity issues.

JULY 30 • US $17.99 • CAN $22.99 9780764242496

Paperback / softback

8.000 in H | 6.000 in W

160 pages • Carton Quantity: 32

JUVENILE NONFICTION / Religious / Christian / Devotional & Prayer

YOUNG ADULT NONFICTION / Religious / Christian / Devotional & Prayer

RELIGION / Christian Living / Devotional

Kelsey Scism is a former middle and high school language arts teacher, mom of six, and principal's wife. A passionate and authentic writer, she is focused on encouraging and connecting with others through her writing. A member of Her View From Home website's editorial team, she lives in northeast Kansas. Learn more at LovingOurLord.com.

As a former middle school teacher and mom of six, Kelsey Scism knows how much you need help navigating these changes and challenges. Guiding you through each week of the year, this hands-on devotional includes Scripture, real-life application, reflection questions, journaling space, and prayer prompts. You'll begin to develop an independent faith as you

·apply Bible verses to real-life problems you face

·discover the source of your true identity and self-worth ·stay anchored in Jesus in the face of pain or heartache

·connect deeply with your Creator

This in-between space is hard--but it's also beautiful. Because it's here that God shapes the girl you once were into the woman he created you to be.

80% devotional, with a daily corresponding Bible story that speaks to a specific issue + journaling questions, activity & prayer.

JULY 2024
Bethany House
33

A STUDENT’S GUIDE TO SEXUAL INTEGRITY REPACKAGED ED.

God's Plan for Sex and Your Body

Burns with Erin Mashaw

Trusted parenting expert tackles sensitive issues of sexuality for preteens and teens.

·Author is part of panel of hosts at New Life Live radio broadcast, which reaches 2 million listeners a week

·Jim Burns's Bethany House books have sold more than 250,000 copies

In today's hyper-sexualized culture, most children receive conflicting, even damaging, messages about sex, their bodies, and sexuality before they're twelve years old. As they enter the hormonally charged adolescent stage, it's vital they receive compassionate, biblically grounded answers to their most embarrassing and confusing questions.

AUGUST 6 • US $17.99 • CAN $22.99 9780764243080

YOUNG ADULT NONFICTION / Social Topics / Dating & Sex RELIGION / Christian Living / Family & Relationships

Paperback / softback

8.500 in H | 5.500 in W

176 pages • Carton Quantity: 72

Jim Burns is the president of HomeWord. He speaks to thousands of people around the world each year and has more than two million resources in print in twenty languages. He primarily writes and speaks on the values of HomeWord. His books include Doing Life with Your Adult Children; The Purity Code; Creating an Intimate Marriage; Have Serous Fun; and Finding Joy in the Empty Nest. Jim and his wife, Cathy, live in Southern California and have three grown daughters, Christy, Rebecca, and Heidi; three sons-in-law, Steve, Andy, and Matt; and three grandchildren, James, Charlotte, and Huxley. Learn more at HomeWord.com.

In this must-have resource for preteens, teens, and parents, trusted parenting and relationship expert Jim Burns tackles the tough, sensitive issues of sexuality for today's kids. With honest, biblical, age-appropriate information, he lovingly and compassionately

·answers both their delicate and taboo questions

·helps them navigate a sexually confused culture

·reveals God's beautiful plan for sex and sexuality

·equips them to make decisions that honor God and their bodies

Complete with discussion questions to spark open conversations between you and your child, this book is a powerful tool that will help your child live a life of sexual integrity.

ages 8-14

25% new content

AUGUST 2024
Bethany House
34
50%

The Word Became Flesh

The

ESV

Value

Compact

VALUE COMPACT BIBLE

Bible is a conveniently sized and a fordably priced edition, making it a practical option for anyone who wants to take God’s Word wherever they go.

•Smyth-sewn binding

•Quality TruTone cover

•Low cost

•Lifetime guarantee

3.9375" x 6" | 6-point Lexicon | 1,056 pages | Double-column format | Black letter

1 In the beginning was the Word, and the Word was with God, and the Word was God. 2 He was in the beginning with God. 3 All things were made through him, and without him was not any thing made that was made.

4 In him was life,1 and the life was the light of men. 5 The light shines in the darkness, and the darkness has not overcome it.

6 There was a man sent from God, whose name was John. 7 He came as a witness, to bear witness about the light, that all might believe through him. 8 He was not the light, but came to bear witness about the light.

9 The true light, which gives light to everyone, was coming into the world. 10 He was in the world, and the world was made through him, yet the world did not know him. 11 He came to his own,2 and his own people3 did not receive him. 12 But to all who did receive him, who believed in his name, he gave the right to become children of God, 13 who were born, not of blood nor of the will of the flesh nor of the will of man, but of God.

14 And the Word became flesh and dwelt among us, and we have seen his glory, glory as of the only Son4 from the Father, full of grace and truth. 15 (John bore witness about him, and cried out, “This was he of whom I said, ‘He who comes after me ranks before me, because he was before me.’”) 16 For from his fullness we have all received, grace upon grace.5 17 For the law was given through Moses; grace and truth came through Jesus Christ. 18 No one has ever seen God; the only God,6 who is at the Father’s side,7 he has made him known.

The Testimony of John the Baptist

19 And this is the testimony of John, when the Jews sent priests and Levites from Jerusalem to ask him, “Who are you?” 20 He confessed, and did not deny, but confessed, “I am not the Christ.” 21 And they asked him, “What then? Are you Elijah?” He said, “I am not.” “Are you the Prophet?” And he answered, “No.” 22 So they said to him, “Who are you? We need to give an answer to those who sent us. What do you say about yourself?” 23 He said, “I am a the

voice of one crying out in the wilderness, ‘Make straight8 the way of the Lord,’ as the prophet Isaiah said.”

24 (Now they had been sent from the Pharisees.) 25 They asked him, “Then why are you baptizing, if you are neither the Christ, nor Elijah, nor the Prophet?” 26 John answered them, “I baptize with water, but among you stands one you do not know, 27 even he who comes after me, the strap of whose sandal I am not worthy to untie.” 28 These things took place in Bethany across the Jordan, where John was baptizing.

Behold, the Lamb of God

29 The next day he saw Jesus coming toward him, and said, “Behold, the Lamb of God, who takes away the sin of the world! 30 This is he of whom I said, ‘After me comes a man who ranks before me, because he was before me.’ 31 I myself did not know him, but for this purpose I came baptizing with water, that he might be revealed to Israel.”

32 And John bore witness: “I saw the Spirit descend from heaven like a dove, and it remained on him. 33 I myself did not know him, but he who sent me to baptize with water said to me, ‘He on whom you see the Spirit descend and remain, this is he who baptizes with the Holy Spirit.’ 34 And I have seen and have borne witness that this is the Son9 of God.”

Jesus Calls the First Disciples

35 The next day again John was standing with two of his disciples, 36 and he looked at Jesus as he walked by and said, “Behold, the Lamb of God!” 37 The two disciples heard him say this, and they followed Jesus. 38 Jesus turned and saw them following and said to them, “What are you seeking?” And they said to him, “Rabbi” (which means Teacher), “where are you staying?” 39 He said to them, “Come and you will see.” So they came and saw where he was staying, and they stayed with him that day, for it was about the tenth hour.10 40 One of the two who heard John speak and followed Jesus11 was Andrew, Simon Peter’s brother. 41 He first found his own brother Simon and said to him, “We have found the Messiah”

(which means Christ). 42 He brought him to Jesus. Jesus looked at him and said, “You are Simon the son of John. You shall be called Cephas” (which means Peter1).

Jesus Calls Philip and Nathanael

43 The next day Jesus decided to go to Galilee. He found Philip and said to him, “Follow me.”

44 Now Philip was from Bethsaida, the city of Andrew and Peter. 45 Philip found Nathanael and said to him, “We have found him of whom Moses in the Law and also the prophets wrote, Jesus of Nazareth, the son of Joseph.”

46 Nathanael said to him, “Can anything good come out of Nazareth?” Philip said to him, “Come and see.” 47 Jesus saw Nathanael coming toward him and said of him, “Behold, an Israelite indeed, in whom there is no deceit!”

48 Nathanael said to him, “How do you know me?” Jesus answered him, “Before Philip called you, when you were under the fig tree, I saw you.” 49 Nathanael answered him, “Rabbi, you are the Son of God! You are the King of Israel!”

50 Jesus answered him, “Because I said to you, ‘I saw you under the fig tree,’ do you believe? You will see greater things than these.” 51 And he said to him, “Truly, truly, I say to you,2 you will see heaven opened, and the angels of God ascending and descending on the Son of Man.”

The Wedding at Cana

2 On the third day there was a wedding at Cana in Galilee, and the mother of Jesus was there. 2 Jesus also was invited to the wedding with his disciples. 3 When the wine ran out, the mother of Jesus said to him, “They have no wine.” 4 And Jesus said to her, “Woman, what does this have to do with me? My hour has not yet come.” 5 His mother said to the servants, “Do whatever he tells you.”

6 Now there were six stone water jars there for the Jewish rites of purification, each holding twenty or thirty gallons.3 7 Jesus said to the servants, “Fill the jars with water.” And they filled them up to the brim. 8 And he said to them, “Now draw some out and take it to the master of the feast.” So they took it. 9 When the master of the feast tasted the water now become wine, and did not know where it came from (though the servants who had drawn the water knew), the master of the feast called the bridegroom 10 and said to him, “Everyone

JOHN 3 : 3  887

serves the good wine first, and when people have drunk freely, then the poor wine. But you have kept the good wine until now.” 11 This, the first of his signs, Jesus did at Cana in Galilee, and manifested his glory. And his disciples believed in him.

12 After this he went down to Capernaum, with his mother and his brothers4 and his disciples, and they stayed there for a few days.

Jesus Cleanses the Temple

13 The Passover of the Jews was at hand, and Jesus went up to Jerusalem. 14 In the temple he found those who were selling oxen and sheep and pigeons, and the money-changers sitting there. 15 And making a whip of cords, he drove them all out of the temple, with the sheep and oxen. And he poured out the coins of the money-changers and overturned their tables.

16 And he told those who sold the pigeons, “Take these things away; do not make my Father’s house a house of trade.”

17 His disciples remembered that it was written, a “Zeal for your house will consume me.”

18 So the Jews said to him, “What sign do you show us for doing these things?” 19 Jesus answered them, “Destroy this temple, and in three days I will raise it up.” 20 The Jews then said, “It has taken forty-six years to build this temple,5 and will you raise it up in three days?”

21 But he was speaking about the temple of his body. 22 When therefore he was raised from the dead, his disciples remembered that he had said this, and they believed the Scripture and the word that Jesus had spoken.

Jesus Knows What Is in Man

23 Now when he was in Jerusalem at the Passover Feast, many believed in his name when they saw the signs that he was doing.

24 But Jesus on his part did not entrust himself to them, because he knew all people 25 and needed no one to bear witness about man, for he himself knew what was in man.

You Must Be Born Again

3 Now there was a man of the Pharisees named Nicodemus, a ruler of the Jews.

2 This man came to Jesus6 by night and said to him, “Rabbi, we know that you are a teacher come from God, for no one can do these signs that you do unless God is with him.” 3 Jesus answered him, “Truly, truly, I say to you, unless

11:54 AM

886

SPRING 2024
Sample spread (90% actual size)
1 Cephas and Peter are from the word for rock in Aramaic and Greek, respectively 2 The Greek for you is plural; twice in this verse 3 Greek two or three measures (metrētas); a metrētē was about 10 gallons or 35 liters 4 Or brothers and sisters In New Testament usage, depending on the context, the plural Greek word adelphoi (translated “brothers”) may refer either to brothers or to brothers and sisters 5 Or This temple was built forty-six years ago 6 Greek him a Ps. 69:9 43.John.indd 887 5/19/16 11:54 AM 1 Or was not any thing made. That which has been made was life in him 2 Greek to his own things that is, to his own domain, or to his own people 3 People is implied in Greek 4 Or only One or unique One 5 Or grace in place of grace 6 Or the only One, who is God some manuscripts the only Son 7 Greek in the bosom of the Father 8 Or crying out, ‘In the wilderness make straight 9 Some manuscripts the Chosen One 10 That is, about 4 P M 11 Greek him a Isa. 40:3
JOHN
THE GOSPEL ACCORDING TO
43.John.indd
5/19/16
SPRING 2024 AVAILABLE JUNE 20, 2024 VALUE COMPACT BIBLE Paris Sky Branch TT 978-1-4335-9320-8 $20.99 TruTone, Turquoise, Emblem Design 978-1-4335-6089-7 $20.99 TruTone Navy 978 -1- 4335 - 6869 -5 $20.99 Chestnut Mosaic Cross TT 978-1-4335-9321-5 $20.99 TruTone, Mahogany, Border Design 978-1-4335-5165-9 $20.99 TruTone , Black 978 -1- 4335 - 8253 - 0 $20.99 TruTone, Olive, Celtic Cross Design 978-1-4335-4756-0 $20.99 TruTone , Brown 978 -1- 4335 - 4759 -1 $20.99 TruTone, Goldenrod, Ornament Design 978-1-4335-4758-4 $20.99 TruTone, Raspberry, Floral Design 978-1-4335-6870-1 $20.99

The top-selling ESV Thinline Bible is ideal for use at home and on the go. At one inch thick and available in multiple designs, there is a perfect ESV Thinline Bible for everyone.

•1" thick

•Words of Christ in red (various editions)

•Ribbon marker

•Gilding (various editions)

•Concordance

•Smyth-sewn binding

•Lifetime guarantee (TruTone and leather editions)

5.375" x 8.375" | 8-point Lexicon | 1,120 pages | Double-column format | Red letter

GENESIS 1 : 31

it was so. 31 And God saw everything that he had made, and behold, it was very good. And there was evening and there was morning, the sixth day.

The Seventh Day, God Rests

2 Thus the heavens and the earth were finished, and all the host of them. 2 And on the seventh day God finished his work that he had done, and he rested on the seventh day from all his work that he had done. 3 So God blessed the seventh day and made it holy, because on it God rested from all his work that he had done in creation.

The Creation of Man and Woman

4 These are the generations of the heavens and the earth when they were created, in the day that the Lord God made the earth and the heavens.

5 When no bush of the field1 was yet in the land2 and no small plant of the field had yet sprung up—for the Lord God had not caused it to rain on the land, and there was no man to work the ground, 6 and a mist3 was going up from the land and was watering the whole face of the ground— 7 then the Lord God formed the man of dust from the ground and breathed into his nostrils the breath of life, and the man became a living creature. 8 And the Lord God planted a garden in Eden, in the east, and there he put the man whom he had formed. 9 And out of the ground the Lord God made to spring up every tree that is pleasant to the sight and good for food. The tree of life was in the midst of the garden, and the tree of the knowledge of good and evil.

10 A river flowed out of Eden to water the garden, and there it divided and became four rivers.

11 The name of the first is the Pishon. It is the one that flowed around the whole land of Havilah, where there is gold. 12 And the gold of that land is good; bdellium and onyx stone are there.

13 The name of the second river is the Gihon. It is the one that flowed around the whole land of Cush. 14 And the name of the third river is the Tigris, which flows east of Assyria. And the fourth river is the Euphrates.

15 The Lord God took the man and put him in the garden of Eden to work it and keep it.

16 And the Lord God commanded the man, saying, “You may surely eat of every tree of the

GENESIS 4 : 12  2 3

garden, 17 but of the tree of the knowledge of good and evil you shall not eat, for in the day that you eat4 of it you shall surely die.”

18 Then the Lord God said, “It is not good that the man should be alone; I will make him a helper fit for5 him.” 19 Now out of the ground the Lord God had formed6 every beast of the field and every bird of the heavens and brought them to the man to see what he would call them. And whatever the man called every living creature, that was its name. 20 The man gave names to all livestock and to the birds of the heavens and to every beast of the field. But for Adam7 there was not found a helper fit for him.

21 So the Lord God caused a deep sleep to fall upon the man, and while he slept took one of his ribs and closed up its place with flesh. 22 And the rib that the Lord God had taken from the man he made8 into a woman and brought her to the man. 23 Then the man said,

“ This at last is bone of my bones and flesh of my flesh; she shall be called Woman, because she was taken out of Man.”9

24 Therefore a man shall leave his father and his mother and hold fast to his wife, and they shall become one flesh. 25 And the man and his wife were both naked and were not ashamed.

The Fall

3 Now the serpent was more crafty than any other beast of the field that the Lord God had made.

He said to the woman, “Did God actually say, ‘You10 shall not eat of any tree in the garden’?”

2 And the woman said to the serpent, “We may eat of the fruit of the trees in the garden, 3 but God said, ‘You shall not eat of the fruit of the tree that is in the midst of the garden, neither shall you touch it, lest you die.’” 4 But the serpent said to the woman, “You will not surely die. 5 For God knows that when you eat of it your eyes will be opened, and you will be like God, knowing good and evil.” 6 So when the woman saw that the tree was good for food, and that it was a delight to the eyes, and that the tree was to be desired to make one wise,11 she took of its fruit and ate, and she also gave some to her husband who was with her, and he ate. 7 Then the eyes of both were opened, and they knew that they were naked. And they sewed fig leaves together and made themselves loincloths.

8 And they heard the sound of the Lord God walking in the garden in the cool1 of the day, and the man and his wife hid themselves from the presence of the Lord God among the trees of the garden. 9 But the Lord God called to the man and said to him, “Where are you?”2 10 And he said, “I heard the sound of you in the garden, and I was afraid, because I was naked, and I hid myself.” 11 He said, “Who told you that you were naked? Have you eaten of the tree of which I commanded you not to eat?” 12 The man said, “The woman whom you gave to be with me, she gave me fruit of the tree, and I ate.” 13 Then the Lord God said to the woman, “What is this that you have done?” The woman said, “The serpent deceived me, and I ate.”

14 The Lord God said to the serpent, “ Because you have done this, cursed are you above all livestock and above all beasts of the field; on your belly you shall go, and dust you shall eat all the days of your life.

15 I will put enmity between you and the woman, and between your ofspring3 and her ofspring; he shall bruise your head, and you shall bruise his heel.”

16 To the woman he said,

“ I will surely multiply your pain in childbearing; in pain you shall bring forth children. Your desire shall be contrary to4 your husband, but he shall rule over you.”

17 And to Adam he said,

“ Because you have listened to the voice of your wife and have eaten of the tree of which I commanded you, ‘ You shall not eat of it,’ cursed is the ground because of you; in pain you shall eat of it all the days of your life; 18 thorns and thistles it shall bring forth for you; and you shall eat the plants of the field.

19 By the sweat of your face you shall eat bread, till you return to the ground, for out of it you were taken; for you are dust, and to dust you shall return.”

20 The man called his wife’s name Eve, because she was the mother of all living.5 21 And the Lord God made for Adam and for his wife garments of skins and clothed them.

22 Then the Lord God said, “Behold, the man has become like one of us in knowing good and evil. Now, lest he reach out his hand and take also of the tree of life and eat, and live forever—” 23 therefore the Lord God sent him out from the garden of Eden to work the ground from which he was taken. 24 He drove out the man, and at the east of the garden of Eden he placed the cherubim and a flaming sword that turned every way to guard the way to the tree of life.

Cain and Abel

4 Now Adam knew Eve his wife, and she conceived and bore Cain, saying, “I have gotten6 a man with the help of the Lord.” 2 And again, she bore his brother Abel. Now Abel was a keeper of sheep, and Cain a worker of the ground. 3 In the course of time Cain brought to the Lord an ofering of the fruit of the ground, 4 and Abel also brought of the firstborn of his flock and of their fat portions. And the Lord had regard for Abel and his ofering, 5 but for Cain and his ofering he had no regard. So Cain was very angry, and his face fell. 6 The Lord said to Cain, “Why are you angry, and why has your face fallen? 7 If you do well, will you not be accepted?7 And if you do not do well, sin is crouching at the door. Its desire is contrary to8 you, but you must rule over it.”

8 Cain spoke to Abel his brother.9 And when they were in the field, Cain rose up against his brother Abel and killed him. 9 Then the Lord said to Cain, “Where is Abel your brother?” He said, “I do not know; am I my brother’s keeper?”

10 And the Lord said, “What have you done?

The voice of your brother’s blood is crying to me from the ground. 11 And now you are cursed from the ground, which has opened its mouth to receive your brother’s blood from your hand.

12 When you work the ground, it shall no longer

SPRING 2024
Sample spread (65% actual size)
1 Or open country 2 Or earth also verse 6 3 Or spring 4 Or when you eat 5 Or corresponding to also verse 20 6 Or And out of the ground the LORD God formed 7 Or the man 8 Hebrew built 9 The Hebrew words for woman ishshah) and man (ish sound alike 10 In Hebrew you is plural in verses 1–5 11 Or to give insight 1 Hebrew wind 2 In Hebrew you is singular in verses 9 and 11 3 Hebrew seed so throughout Genesis 4 Or shall be toward (see 4:7) 5 Eve sounds like the Hebrew for life-giver and resembles the word for living 6 Cain sounds like the Hebrew for gotten 7 Hebrew will there not be a lifting up [of your face]? 8 Or is toward 9 Hebrew; Samaritan, Septuagint, Syriac, Vulgate add Let us go out to the feld
THINLINE BIBLE
SPRING 2024 AVAILABLE MAY 23, 2024 THINLINE BIBLE Blush Rose Emblem TT 9781433593130 $45.49 Genuine Leather, Black 978-1-58134-503-2 $82.49 Clamshell Box TruTone Espresso 978 -1- 4335 - 4402- 6
45.49 Slipcase Deep Brown Genuine Leather 9781433593147 $109.99 Bonded Leather, Black 978-1-58134-373-1 $61.99 Slipcase TruTone, Mahogany, Border 978-1-4335-8710-8 $45.49 Slipcase TruTone, Brown, Royal Lion Design 978-1-4335-5136-9 $45.49 Slipcase TruTone Charcoal Crown Design 978-1-58134-897-2 $45.49 Slipcase TruTone, Stone, Branch Design 978-1-4335-8709-2 $45.49 Slipcase TruTone, Brown/Cordovan, Portfolio Design 978-1-58134-736-4 $45.49 Slipcase TruTone Deep Teal Rotunda Design 978-1-4335-7087-2 $45.49 Slipcase TruTone, Charcoal, Celtic Cross Design, Red Letter 978-1-58134-654-1 $45.49 Slipcase
$

TEEN STUDY BIBLE

The ESV Teen Study Bible informs the mind, encourages worship and communion with God, and promotes living for the Lord in day-to-day life.

•For Ages 14–18: Providing teens with faithful biblical resources

•365 Short Devotions: Adapted from Jon Nielson’s book, God's Great Story

•Quality Study Resources: 200 applicational and doctrinal sidebars, 12,000 study notes adapted from the ESV Concise Study Bible, and more

5.375" x 8.625" | 8.5-point Milo Serif | 2,208 pages | Double-column format | Black letter

EVERY SPIRITUAL BLESSING

EPHESIANS 1 : 1–14

If your family is like most American families, at Thanksgiving you probably share what you’re thankful for. Aunts, uncles, brothers, sisters, and grandparents probably talk about the blessings of health, family, food, and friends. And this is all good! It is right that we remember our blessings. But when was the last time that you thought deeply about the immense spiritual blessings that you have in Christ Jesus? It’s with these blessings in mind that Paul begins his letter to the ancient church at Ephesus. What are the blessings of Christ Jesus all about?

First, we are blessed through God’s sovereign choice to save us. This is probably one of the places where the Bible most clearly teaches the doctrine called election or predestination. Paul says that Christians are blessed because God “predestined [them] for adoption” (1:5), and this is something that God decided to do “before the foundation of the world” (1:4). If you have trusted in Jesus as your Lord and Savior, that means that God chose you long before you were born to be his child. That is a great blessing!

Second, we are blessed through redemption and forgiveness through the cross of Jesus Christ. Remember, friend: your redemption comes through the blood of Jesus! Your salvation was not cheap; it was bought through the work of Jesus. This work was God’s lavishing his grace upon sinners like you and me.

Third, we are blessed with a future inheritance in Jesus that will last forever. Since we belong to Jesus, we are going somewhere! We share a future home with our great Savior and Lord. That’s not all; God has given his Holy Spirit to dwell in us and act as the guarantee of our future inheritance with Jesus. Heaven is coming, and the Spirit’s presence in our hearts and lives is God’s promise to us that we will get there!

There are many small blessings to thank God for—and we should thank him for blessings great and small! But make sure that you are most thankful for the eternal, infnite blessings that you have through faith in Jesus Christ, the Son of God. Thank God for his sovereign choice of you. Praise God for the gracious work of redemption. Ask God to help you trust his Holy Spirit’s presence as the guarantee of your future life with Jesus forever!

Sample spread (65% actual size)

thanks for you, remembering you in my prayers, 17 that the God of our Lord Jesus Christ, the Father of glory, may give you the Spirit of wisdom and of revelation in the

Praying Big Prayers

EPHESIANS 1:15–23

We can learn from Paul’s prayers what his priorities are for the people he leads, loves, serves, and disciples. Look over Paul’s prayer in Ephesians 1:15–23 which includes his soaring hopes for the Ephesians’ spiritual growth, holiness, love, wisdom, and understanding of Christ and the gospel. More than anything else, Paul wants these believers to grow in maturity, grace, and hope in what lies ahead of them eternally through Christ. We can learn from these prayers of Paul! It is not that God does not want to hear our prayers for skinned knees, sick pets, or tests at school; God cares about all the details of our lives. But most of all God delights to answer prayers for the spiritual growth of his people and the work of the gospel in their hearts and in the world. Let us remember to pray big prayers in the midst of the daily requests we bring to God.

Greek fesh

EPH E SIANS 2:3 1839

knowledge of him, 18 having the eyes of your hearts enlightened, that you may know what is the hope to which he has called you, what are the riches of his glorious inheritance in the saints, 19 and what is the immeasurable greatness of his power toward us who believe, according to the working of his great might 20 that he worked in Christ when he raised him from the dead and seated him at his right hand in the heavenly places, 21 far above all rule and authority and power and dominion, and above every name that is named, not only in this age but also in the one to come. 22 And he put all things under his feet and gave him as head over all things to the church, 23 which is his body, the fullness of him who fills all in all.

By Grace Through Faith

2 And you were dead in the trespasses and sins 2 in which you once walked, following the course of this world, following the prince of the power of the air, the spirit that is now at work in the sons of disobedience— 3 among whom we all once lived in the passions of our flesh, carrying out the desires of the body1

side.49.1.indd 1 10/12/22 4:26 PM

1:17 God of our Lord Jesus Christ. Paul afrms both Christ’s humanity (God the Father is the “God of” Christ) and his oneness with God (Christ is “Lord”). Spirit of wisdom The Holy Spirit gives Christians knowledge of salvation and spiritual growth (4 12–14; 1 Cor. 2 6 –12).

1:18 hope Confdent assurance that God keeps all his promises. his glorious inheritance in the saints God’s people are his inheritance, and he is theirs.

1:19–20 immeasurable greatness of his power Christ’s resurrection showed that God’s power overcomes death and all other enemies (Acts 19:19–20). right hand. See Dan. 7:13–14; Acts 2:33

1:21 above all rule and authority. See note on 3:10

1:22 all things. Paul cites Ps. 8 6 to stress that Christ has authority over all creation. head. See note on 1 Cor. 11:3

1:23 Christ’s church is his visible body on earth.

2:1–10 Salvation by Grace through Faith

2:1 you were dead. Without spiritual life. trespasses. Violations of God’s commandments. sins Ofenses against God in thought, speech, or action.

2:2 sons of disobedience. Rebels against God. Compare “sons of this world” (Luke 16:8). prince. Satan was their leader.

2:3 by nature children of wrath. As rebels, they merited God’s judgment (v. 2). See Rom. 5:12–21

SPRING 2024
Trinitarian Formulas and Expressions in Ephesians ReferenceFather Son Spirit 1:3 Blessed be the God and Fatherof our Lord Jesus Christevery spiritual blessing 1:11–13him who works all things according to . his will to hope in Christ sealed with the promised Holy Spirit 1:17God the Father of glory our Lord Jesus Christ the spirit of wisdom and of revelation 2:18access . to the Father through him in one Spirit 2:22a dwelling place for God In him by the Spirit 3:2–5the stewardship of God’s gracethe mystery of Christrevealed . by the Spirit 3:14–17the Father the riches of his gloryso that Christ may dwell in your hearts through his Spirit 4:4–6one God and Father one Lord one Spirit 5:18–20giving thanks . to God the Fatherin the name of our Lord Jesus Christ be filled with the Spirit chart.49-1.indd 2 4/8/21 12:20 PM

TEEN STUDY BIBLE

TruTone

978

978

Half-jacket

SPRING 2024 AVAILABLE APRIL 25, 2024
easide Blue TT 978-1-4335-9310-9 $54.99
, Desert Sun 978-1-4335-9048-1
47.99
S
Half-jacket Hardcover
$
, Burnt Sienna
Half-jacket -1-4335-8847-1 $54.99
, Wellspring
-1-4335-9047-4 $47.99
Half-jacket Hardcover
Paperback 978 -1- 4335 - 8892-1 $40.99
Hardcover, Wildwood 978-1-4335-8846-4 $47.99
Half-jacket
, Cliffside 978-1-4335-9049-84 $47.99 Half-jacket
Half-jacket Hardcover

MEN’S STUDY BIBLE

This ESV Bible includes study notes, articles, and daily devotionals written especially for men by more than 100 of the world’s leading Bible scholars and teachers, helping readers understand God’s Word more deeply and apply it to their lives.

•Robust Bible Study Materials: Features 12,000 theologically rich study notes, comprehensive introductions of each Bible book, 120 character profiles, and 900 key biblical facts

MATTHEW 22 : 29 1434

29 But Jesus answered them, “You are wrong, v because you know neither the Scriptures nor w the power of God. 30 For in the resurrection they neither x marry nor x are given in marriage, but are like angels in heaven. 31 And as for the resurrection of the dead, y have you not read what was said to you by God: 32 z ‘I am the God of Abraham, and the God of Isaac, and the God of Jacob’? He is not God of the dead, but of the living.” 33 And when the crowd heard it, a they were astonished at his teaching.

The Great Commandment

34 b But when the Pharisees heard that he had silenced c the Sadducees, they gathered together.

35 dAnd one of them, e a lawyer, asked him a question to test him. 36 “Teacher, which is the great commandment in the Law?” 37 And he said to him,

g “You shall love the Lord your God with all your heart and with all your soul and with all your mind.

38 This is the great and first commandment. 39 And h a second is like it: You shall love your neighbor as yourself. 40 j On these two commandments depend k all the Law and the Prophets.” Whose Son Is the Christ?

41 Now while the Pharisees m were gathered together, Jesus asked them a question, 42 saying,

•Daily Devotionals: Readings for each day of the year are tied to key Bible texts

“What do you think about n the Christ? Whose son is he?” They said to him, n “The son of David.” 43 He said to them, “How is it then that David, o in the Spirit, calls him Lord, saying,

44 p The Lord said to my Lord, “ Sit at my right hand, until I put your enemies under your feet”’?

45 If then David calls him Lord, q how is he his son?”

46 And no one was able to answer him a word, s nor from that day did anyone dare to ask him any more questions.

Seven Woes to the Scribes and Pharisees

23 Then Jesus t said to the crowds and to his disciples, 2 u “The scribes and the Pharisees v sit on Moses’ seat, 3 so do and observe whatever they tell you, w but not the works they do. x For they preach, but do not practice. 4 y They tie up heavy burdens, hard to bear,1 and lay them on people’s shoulders, but they themselves are not willing to move them with their finger. 5 t They do all their deeds z to be seen by others. For they make a their phylacteries broad and b their fringes long, 6 and they c love the place of honor at feasts and d the best seats in the synagogues 7 and d greetings in e the marketplaces

•Contributions from Leading Bible Teachers:

Includes content from Alistair Begg, Bryan Chapell, Sam Storms, and more

WE LOVE BECAUSE HE FIRST LOVED US MATTHEW

22:34–40

Jewish leaders often tried to trap Jesus, and although that must have grieved him, their trick questions provided occasions for vital teaching. The leaders couldn’t agree on what the greatest commandment was, but Jesus knew that God himself had summarized the law in Deuteronomy

6, shortly after he delivered it.

The greatest commandment is also the most daunting: “You shall love the Lord your God with all your heart and with all your soul and with all your mind” (Matt. 22:37). Mark 12:30 adds, “and with all your strength.” That is, we love God with every power, faculty, and talent—even our sense of humor. We love God with heart and soul when we give him our affections and when he comes first in our convictions and commitments. We love God with the mind when we learn his truth, see the world as he sees it, and dedicate our past, present, and future to him. We love God with our strength when we devote the body, with all its skill and energy, to him. We love God when we train our will to follow him, whatever the price. In all of this, we simply answer the love that God has freely bestowed on us. “Be imitators of God” (Eph. 5:1) is a great theme of Scripture.

We forgive because Jesus forgave (Eph. 4:32). We serve because Jesus served (Matt. 20:26–28). Above all, we “walk in love, as Christ loved us and gave himself up for us” (Eph. 5:2).

“We love because he first loved us” (1 John 4:19). When God pours his love into us, that leads us to love our neighbors as ourselves. Our love for God precedes and empowers our love for neighbors.

We don’t always love ourselves properly, but we should love our neighbor as we ought to love ourselves. Love organizes, unites, and protects every virtue, every command. We love parents when we honor them. We love our spouses with our faithfulness. We love neighbors by telling the truth to them and about them, and by promoting their good instead of coveting their goods. So the life of the redeemed flows from God’s prior, covenantal, and gracious love.

DAN DORIANI

SPRING 2024
Sample spread (55% actual size)
22:29–30 But are like angels in heaven who do not marry or have children This teaching might at first seem discouraging to married couples who deeply love each other Yet people will know their loved ones in heaven (see 8:11; Luke 9:30, 33) 22:31–32 I am the God of Abraham and Isaac and Jacob The present tense in the quotation from Ex. 3:6 shows that God was still in covenant relationship with the patriarchs even though they had died centuries earlier The Sadducees should recognize God’s power to raise the patriarchs and all of God’s people to enjoy his eternal covenant in a life beyond this one 22:35 A lawyer is an expert in the law it is another term for “scribes of the Pharisees” (Mark 2:16; see Acts 23:9) 22:36 the great commandment The rabbis had an ongoing debate regarding which commandments were “light” and which were “weighty” (compare 23:23; see note on 5:19) The Law refers here to the entire OT 22:37–38 love the Lord your God heart soul mind This command from Deut. 6:5 was repeated twice daily by faithful Jews It expresses the idea of total devotion to God It includes the duty to obey the rest of God’s commandments (see Matt 5:16 –20) “Heart, “soul and “mind” together refer to the whole person 22:39 You shall love your neighbor as yourself See Lev. 19:18, 34. 22:40 the Law and the Prophets See note on 5:17. 22:41–46 Jesus now asked the Pharisees about the long-awaited Messiah (the Christ), Whose son is he? Their reply, The son of David, reflected the common understanding that the Messiah would be a descendant of David (see 2 Sam 7:12–14; Ps 89:3–4; Isa 11:1; Jer 23:5) Jesus then cites Ps. 110:1, one of the messianic texts most quoted in the NT In the psalm David said that the coming Messiah (that is David’s “son”) will not be just a special human descended from David He will also be David’s Lord The fact that the descendant (Jesus) would have a more prominent role and title than the ancestor (David) further indicates the uniqueness of the Messiah and the greater honor that is due him as the Son of God Psalm 110 emphasizes the Messiah’s deity The Messiah is to be God in the flesh (see John 1:14) 23:2 The scribes and the Pharisees See notes on 2:4; 3:7. Moses’ seat refers to a place of authority from which experts on the law taught 23:3 so do and observe whatever they tell you “So” connects this verse with v. 2. The mention of Moses evidently indicates “whatever they tell you about the Law of Moses” and does not include the Pharisees’ later extensive additions to Mosaic laws 23:4 heavy burdens See note on 11:28. 23:5 phylacteries Small cube-shaped cases made of leather containing Scripture passages written on parchment They were worn on the left arm and forehead as a literal way to obey Deut 11:18. fringes These tassels with a blue cord attached to the four corners of a man’s garment (Num 15:37–41) reminded people to obey God’s commandments and to be holy (Num. 15:40) 23:7 Rabbi literally meant “my lord” but it was used generally for outstanding teachers of the law
29vJohn 20:9 w1 Cor. 6:14 30xch. 24:38; Luke 17:27 31ySee ch. 21:16 32 Acts 7:32; Cited from Ex. 3:6 33 See ch. 7:28 34bFor ver. 34-40, see Mark 12:28-33 ver. 23 35d[Luke 10:25-28] See Luke 7:30 fver. 18 37gLuke 10:27; Cited from Deut. 6:5 39h[1 John 4:21] Cited from Lev. 19:18; See ch. 19:19 40j[Rom. 13:8, 10] kch. 7:12; [Gal. 5:14] 41lFor ver. 41-45, see Mark 12:35-37; Luke 20:41-44 mver. 34 42nSee ch. 1:1, 17 43oRev. 1:10; 4:2; [2 Sam. 23:2] 44pActs 2:34, 35; Heb. 1:13; Cited from Ps. 110:1; [1Cor. 15:25; Heb. 10:13] 45q[Rom. 1:3, 4] 46 [Luke 14:6] Mark 12:34; Luke 20:40 CHAPTER 23 1tFor ver. 1, 2, 5-7, see Mark 12:38, 39; Luke 20:45, 46; [Luke 11:43] 2u[Ezra 7:6, 10, 25; Neh. 8:4] v[Deut. 17:10, 11; John 9:28, 29] 3w[ch. 5:20; 15:3-13] xRom. 2:17-23 4yLuke 11:46; [ch. 11:28-30; Acts 15:10] 5t[See ver. above] ch. 6:1, 16; [John 5:44] Ex. 13:9; Deut. 6:8; 11:18 bSee ch. 9:20 6 Luke 14:7, 8 dLuke 11:43 7d[See ver. 6 above] ech. 11:16; 20:3 1 Some manuscripts omit hard to bear Phylacteries (23:5) were small cube-shaped leather cases that were tied to the left arms and foreheads of Jewish men attending the synagogue In the cases were passages of Scripture written on pieces of parchment This was done in an efort to literally fulfill the OT command to keep the words of the Lord on their hands and between their eyes (Ex 13:9; Deut. 6:8)
6.25" x 9" | 8.2-point Lexicon | 2,336 pages | Double-column format | Black letter
SPRING 2024 AVAILABLE MAY 23, 2024
Brown/Cordovan Portfolio TT 978-1-4335-9316-1 $95.99 Slipcase Genuine Leather Black 978-1-4335-9056-6 $136.99 Slipcase TruTone Brown 978 -1- 4335 - 8163 -2 $95.99 Slipcase Hardcover 978 -1- 4335 - 8162-5 $68.49 No Packaging
MEN’S STUDY BIBLE

STUDY BIBLE ® , PERSONAL SIZE

The ESV Study Bible, Personal Size contains the original ESV Study Bible ’s 20,000 study notes, 240 full-color maps and illustrations, 200 charts and timelines, and book introductions into a smaller size for easier transport.

•20,000 study notes

•200+ charts and timelines

•240+ full-color maps and illustrations

•50+ topical theology articles

•Ribbon markers (TruTone and leather editions)

•Gilding (TruTone and leather editions)

•Concordance

•Smyth-sewn binding

•Lifetime guarantee (TruTone and leather editions)

5.375" x 8" | 7.7-point Lexicon (type) | 6.3-point Frutiger (content text) | 2,720 pages | Single-column format | Black letter

GENESIS 1 : 3

3 And God said, c “Let there be light,” and there was light. 4 And God saw that the light was good. And God separated the light from the darkness. 5 God called the light Day, and the darkness he called Night. And there was evening and there was morning, the first day.

6 And God said, d “Let there be an expanse1 in the midst of the waters, and let it separate the waters from the waters.” 7 And God made2 the expanse and e separated the waters that were under the expanse from the waters that were f above the expanse. And it was so.

8 And God called the expanse Heaven.3 And there was evening and there was morning, the second day.

9 And God said, g “Let the waters under the heavens be gathered together into one place, and let the dry land appear.” And it was so. 10 God called the dry land Earth,4 and the waters that were gathered together he called Seas. And God saw that it was good.

11 And God said, h “Let the earth sprout vegetation, plants5 yielding seed, and fruit trees bearing fruit in which is their seed, each according to its kind, on the earth.” And it was so.

12 The earth brought forth vegetation, plants yielding seed according to their own kinds, and trees bearing fruit in which is their seed, each according to its kind. And God saw that it was good. 13 And there was evening and there was morning, the third day.

14 And God said, “Let there be lights in the expanse of the heavens to separate the day from the night. And let them be for i signs and for seasons,6 and for days and years, 15 and let them be lights in the expanse of the heavens to give light upon the earth.” And it was so. 16 And God k made the two great lights—the greater light to rule the day and the lesser

the two words tehom and “Tiamat”). There are many linguistic reasons however for doubting a direct identifcation between the two. In any event there is no confict in Genesis or in the rest of the Bible between God and the deep since the deep readily does God s bidding (cf. 7 11; 8:2; Ps. 33 7; 104:6).

1:3–5 And God said. In ch. 1 the absolute power of God is conveyed by the fact that he merely speaks and things are created. Each new section of the chapter is introduced by God s speaking. This is the frst of the 10 words of creation in ch. 1. Let there be light. ight is the frst of God s creative works, which God speaks into existence. the light was good (v. 4). Everything that God brings into being is good. This becomes an important refrain throughout the chapter (see vv. 10, 12 18, 21, 25, 31). God called the light Day (v. 5). The focus in v. 5 is on how God has ordered time on a weekly cycle; thus let there be light may indicate the dawning of a new day. God is pictured working for six days and resting on the Sabbath which is a model for human activity. ay 4 develops this idea further: the lights are placed in the heavens for signs and seasons for the purpose of marking days and years and the seasons of the great festivals such as Passover. This sense of time being structured is further emphasized throughout the chapter as each stage of God s ordering and flling is separated by evening and morning into specifc days. there was evening and there was morning the rst day The order—evening then morning—helps the reader to follow the fow of the passage after the workday (vv. 3–5a) there is an evening and then a morning implying that there is a nighttime (the worker s daily rest) in between. Thus the

darkness so waters are separated to form an expanse (vv. 6–7) which God calls Heaven (v. 8). As the esv footnote illustrates by offering the alternative term “sky,” it is diffcult to fnd a single English word that accurately conveys the precise sense of the Hebrew term shamayim “heaven heavens.” In this context it refers to what humans see above them i.e. the region that contains both celestial lights (vv. 14–17) and birds (v. 20).

1:9–13 Two further regions are organized by God: the dry land forming Earth, and the waters forming Seas (vv. 9–10). These are the last objects to be specifcally named by God. God then instructs the earth to bring forth vegetation (vv. 11–12). While the creation of vegetation may seem out of place on day 3, it anticipates what God will later say in vv. 29–30 concerning food for both humanity and other creatures. The creation of distinctive locations in days 1–3, along with vegetation, prepares for the flling of these in days 4–6.

1:14–19 This section corresponds closely with the ordering of ay and Night on the frst day involving the separation of light and darkness (vv. 3–5). Here the emphasis is on the creation of lights that will govern time as well as providing light upon the earth (v. 15). By referring to them as the greater light and lesser light (v. 16) the text avoids using terms that were also proper names for pagan deities linked to the sun and the moon. Chapter 1 deliberately undermines pagan ideas regarding nature s being controlled by different deities. (To the ancient pagans of the Near East the gods were personifed in various elements of nature. Thus in Egyptian texts the gods a and Thoth are personifed in the sun and the moon respectively.) The term made (Hb. asah v. 16) as the esv footnote shows need only mean that God “fashioned or “worked on them; it does not of itself imply that they did not exist in any form before this. ather the focus here is on the way in which God has ordained the sun and moon to order and defne the passing of time according to his purposes. Thus the references to seasons (v. 14) or “appointed times” (esv footnote) and to days and years are probably an allusion to the appointed times and patterns in the Hebrew calendar for worship festivals and religious observance (Ex. 13 10; 23 15). 1:16 and the stars. The immense universe that God created (see note on

51 GENESIS 1 : 28 light to rule the night—and the stars. 17 And God set them in the expanse of the heavens to give light on the earth, 18 to l rule over the day and over the night, and to separate the light from the darkness. And God saw that it was good. 19 And there was evening and there was morning, the fourth day.

20 And God said, “Let the waters swarm with swarms of living creatures, and let birds1 fly above the earth across the expanse of the heavens.”

21 So m God created the great sea creatures and every living creature that moves, with which the waters swarm, according to their kinds, and every winged bird according to its kind. And God saw that it was good.

22 And God blessed them, saying, n “Be fruitful and multiply and fill the waters in the seas, and let birds multiply on the earth.”

23 And there was evening and there was morning, the fifth day.

24 And God said, “Let the earth bring forth living creatures according to their kinds— livestock and creeping things and beasts of the earth according to their kinds.” And it was so. 25 And God made the beasts of the earth according to their kinds and the livestock according to their kinds, and everything that creeps on the ground according to its kind. And God saw that it was good.

26 Then God said, o “Let us make man2 in our image, p after our likeness. And q let them have dominion over the fish of the sea and over the birds of the heavens and over the livestock and over all the earth and over every creeping thing that creeps on the earth.”

27 So God created man in his own image, in the image of God he created him; male and female he created them.

28 And God blessed them. And God said to them, s “Be fruitful and multiply and fill the

Isa. 40:25–26) is mentioned here only in a brief phrase almost as if it were an afterthought. The focus of Genesis 1 is on the earth the focus of the rest of the Bible is on man (male and female) as the pinnacle of God s creation and the object of his great salvation.

1:20–23 Having previously described the creation of the waters and the expanse of the heavens this section focuses on how they are flled with appropriate creatures of different kinds. As reproductive organisms they are blessed by God so that they may be fruitful and fll their respective regions.

1:21 The term for great sea creatures (Hb. tannin in various contexts can denote large serpents dragons or crocodiles as well as whales or sharks (the probable sense here). Some have suggested that this could also refer to other extinct creatures such as dinosaurs. Canaanite literature portrays a great dragon as the enemy of the main fertility god Baal. Genesis depicts God as creating large sea creatures but they are not in rebellion against him. He is sovereign and is not in any kind of battle to create the universe.

1:24–31 This is by far the longest section given over to a particular day indicating that day 6 is the peak of interest for this passage. The fnal region to be flled is the dry land or Earth (as it has been designated in v. 10). Here a signifcant distinction is drawn between all the living creatures that are created to live on the dry land and human beings. Whereas vv. 24–25 deal with the “living creatures that the earth is to bring forth vv. 26–30 concentrate on the special status assigned to humans.

1:24–25 livestock and creeping things and beasts of the earth

These terms group the land-dwelling animals into three broad categories probably refecting the way nomadic shepherds would experience them: the domesticatable stock animals (e.g. sheep goats cattle and perhaps camels and horses); the small crawlers (e.g. rats and mice lizards spiders); and the larger game and predatory animals (e.g. gazelles lions). This list is not intended to be exhaustive and it is hard to know where to put some animals (e.g. the domestic cat). See further Introduction: Genesis and Science.

1:26 Let us make man in our image. The text does not specify the identity of the us mentioned here. Some have suggested that God may be addressing the members of his court, whom the OT elsewhere calls sons of God (e.g. Job 1:6) and the NT calls angels,” but a signifcant objection is that

man is not made in the image of angels nor is there any indication that angels participated in the creation of human beings. Many Christians and some Jews have taken us to be God speaking to himself, since God alone does the making in Gen. 1:27 (cf. 5:1) this would be the frst hint of the Trinity in the Bible (cf. 1:2).

1:27 There has been debate about the expression image of God. Many scholars point out the idea commonly used in the ancient Near East of the king who was the visible representative of the deity thus the king ruled on behalf of the god. Since v. 26 links the image of God with the exercise of dominion over all the other creatures of the seas heavens and earth one can see that humanity is endowed here with authority to rule the earth as God s representatives or vice-regents (see note on v. 28). Other scholars seeing the pattern of male and female have concluded that humanity expresses God s image in relationship particularly in well-functioning human community both in marriage and in wider society. Traditionally the image has been seen as the capacities that set man apart from the other animals—ways in which humans resemble God such as in the characteristics of reason morality language a capacity for relationships governed by love and commitment and creativity in all forms of art. All these insights can be put together by observing that the resemblances (man is like God in a series of ways) allow mankind to represent God in ruling and to establish worthy relationships with God with one another and with the rest of the creation. This image and this dignity apply to both male and female human beings. (This view is unique in the context of the ancient Near East. In Mesopotamia e.g. the gods created humans merely to carry out work for them.) The Hebrew term adam translated as man is often a generic term that denotes both male and female while sometimes it refers to man in distinction from woman (2:22 23 25; 3:8 9 12 20): it becomes the proper name “Adam (2:20; 3 17 21; 4:1; 5:1). At this stage humanity as a species is set apart from all other creatures and crowned with glory and honor as ruler of the earth (cf. Ps. 8:5–8). The events recorded in Genesis 3 however will have an important bearing on the creation status of humanity.

1:28 As God had blessed the sea and sky creatures (v. 22), so too he blesses humanity. Be fruitful and multiply This motif recurs throughout Genesis in association with divine blessing (see 9:1 7; 17 20; 28:3 35:11; 48:4) and serves as

SPRING 2024
Sample spread (65% actual size)
the basis of the biblical view that raising faithful children is a part of God s creation plan for mankind. God s creation plan is that the whole earth 18 Jer. 31:35 21 Ps. 104:25, 26 22nch. 8:17; 9:1 26och. 3:22; 11:7; Isa. 6:8 pch. 5:1; 9:6; 1 Cor. 11:7; Eph. 4:24; Col. 3:10; James 3:9 qch. 9:2; Ps. 8:6-8; James 3:7 27rch. 2:18, 21-23; 5:2; Mal. 2:15; Matt. 19:4; Mark 10:6 28sch. 9:1, 7 1 Or fying things see Leviticus 11:19–20 2 The Hebrew word for man (adam is the generic term for mankind and becomes the proper name Adam 01.Genesis.indd 51 2/1/19 10:23 AM 50
divide
birds created on day 5 (see chart below). By a simple reading of Genesis, these days must be described as days in the life of God, but how his days relate to human days is more diffcult to determine (cf. Ps. 90 4; 2 Pet. 3 8). See further Introduction: Genesis and Science. 3 2 Cor. 4:6 6dJob 37:18; Ps. 136:5; Jer. 10:12; 51:15 7eProv. 8:27-29 Ps. 148:4 9gJob 38:8-11; Ps. 33:7; 136:6; Jer. 5:22; 2 Pet. 3:5 11hPs. 104:14 14iJer. 10:2; Ezek. 32:7, 8; Joel 2:30, 31; 3:15; Matt. 24:29; Luke 21:25 Ps. 104:19 16kDeut. 4:19; Ps. 136:7-9 1 Or a canopy also verses 7, 8, 14, 15, 17, 20 2 Or fashioned also verse 16 3 Or Sky also verses 9, 14, 15, 17, 20, 26, 28, 30; 2:1 4 Or Land also verses 11, 12, 22, 24, 25, 26, 28, 30; 2:1 Or small plants also verses 12, 29 6 Or appointed times Location Inhabitants 1. Light and dark 4. Lights of day and night 2. Sea and sky 5. Fish and birds 3. Fertile earth 6. Land animals (including mankind) 7. Rest and enjoyment *********GENESIS CHART 2***** chart.1-2.indd 1 6/25/08 5:40:18 PM 1:6–8 waters Water plays a crucial role in ancient Near Eastern creation literature. In Egypt for example the creator-god Ptah uses the preexistent waters (personifed as the god Nun) to create the universe. The same is true in Mesopotamian belief: it is out of the gods of watery chaos—Apsu Tiamat and Mummu—that creation comes. The biblical creation account sits in stark contrast to such dark mythological polytheism. In the biblical account water at creation is no deity; it is simply something God created and it serves as material in the hands of the sole sovereign Creator. As light was separated from
reader is prepared for the next workday to dawn. Similar phrases
ch. 1 into six distinctive workdays while 2 1–3 make a seventh day God s Sabbath. On the frst three days God creates the environment that the creatures of days 4–6 will inhabit; thus sea and sky (day 2) are occupied by fsh and
01.Genesis.indd 50 2/1/19 10:23
AM
SPRING 2024 AVAILABLE JUNE 20, 2024 STUDY BIBLE ® , PERSONAL SIZE Brown/Cordovan Portfolio TT 978-1-4335-9323-9 $102.99 Box TruTone Turquoise Emblem Design 978-1-4335-6078-1 $102.99 Box TruTone, Forest/Tan, Trail Design 978-1-4335-8855-6 $102.99 Box TruTone Saddle Ornament Design 978-1-4335-4407-1 $102.99 Box TruTone , Brown 978 -1- 4335 - 4762-1 $102.99 Box Hardcover 978 -1- 4335 -2461-5 $68.49 L-card Paperback 978 -1- 4335 -3083 - 8 $54.99 Backer Card Genuine Leather, Black 978-1-4335-2462-2 $123.49 Box

LARGE PRINT PERSONAL SIZE BIBLE

The ESV Large Print Personal Size Bible features highly readable 12-point Bible text in a portable trim size—made from quality materials and with line-matched text to minimize show-through from page to page, intended to provide a clean reading experience.

•Line matching

•Words of Christ in red

•Ribbon marker

•Gilding

•Concordance

•Smyth-sewn binding

•Lifetime guarantee

evening and there was morning, the fourth day.

20 And God said, “Let the waters swarm with swarms of living creatures, and let birds1 fly above the earth across the expanse of the heavens.” 21 So God created the great sea creatures and every living creature that moves, with which the waters swarm, according to their kinds, and every winged bird according to its kind. And God saw that it was good. 22 And God blessed them, saying, “Be fruitful and multiply and fill the waters in the seas, and let birds multiply on the earth.” 23 And there was evening and there was morning, the fifth day.

24 And God said, “Let the earth bring forth living creatures according to their kinds—livestock and creeping things and beasts of the earth according to their kinds.” And it was so. 25 And God made the beasts of the earth according to their kinds and the livestock according to their kinds, and everything that creeps on the ground according to its kind. And God saw that it was good.

26 Then God said, “Let us make man2 in our image, after our likeness. And let them have dominion over the fish of the sea and over the birds of the heavens and over the livestock and over all the earth and over every creeping thing that creeps on the earth.”

27 So God created man in his own image, in the image of God he created him; male and female he created them.

28 And God blessed them. And God said to them, “Be fruitful and multiply and fill the earth and subdue it, and have dominion over the fish of the sea and over the birds of the heavens and over every living thing that moves on the earth.” 29 And God said, “Behold, I have given you every plant yielding seed that is on the face of all the earth, and every tree with seed in its fruit. You shall have them for food. 30 And to every beast of the earth and to every bird of the heavens and to everything that creeps on the earth, everything that has the breath of life, I have given every green plant for food.” And it was so. 31 And God saw everything that he had made, and behold, it was very good. And there was evening and there was morning, the sixth day.

The Seventh Day, God Rests 2 Thus the heavens and the earth were finished, and all the host of them. 2 And on the seventh day God finished his work that he had done, and he rested on the seventh day from all his work that he had done. 3 So God blessed the seventh day and

made it holy, because on it God rested from all his work that he had done in creation.

The Creation of Man and Woman

4 These are the generations of the heavens and the earth when they were created, in the day that the Lord God made the earth and the heavens.

5 When no bush of the field 1 was yet in the land2 and no small plant of the field had yet sprung up—for the Lord God had not caused it to rain on the land, and there was no man to work the ground, 6 and a mist 3 was going up from the land and was watering the whole face of the ground— 7 then the Lord God formed the man of dust from the ground and breathed into his nostrils the breath of life, and the man became a living creature. 8 And the Lord God planted a garden in Eden, in the east, and there he put the man whom he had formed. 9 And out of the ground the Lord God made to spring up every tree that is pleasant to the sight and good for food. The tree of life was in the midst of the garden, and the tree of the knowledge of good and evil.

10 A river flowed out of Eden to water the garden, and there it divided and became four rivers.

11 The name of the first is the Pishon. It is the one that flowed around the whole land of Havilah, where there is gold. 12 And the gold of that land is good; bdellium and onyx stone are there.

13 The name of the second river is the Gihon. It is the one that flowed around the whole land of Cush. 14 And the name of the third river is the Tigris, which flows east of Assyria. And the fourth river is the Euphrates.

15 The Lord God took the man and put him in the garden of Eden to work it and keep it. 16 And the Lord God commanded the man, saying, “You may surely eat of every tree of the garden, 17 but of the tree of the knowledge of good and evil you shall not eat, for in the day that you eat 4 of it you shall surely die.”

18 Then the Lord God said, “It is not good that the man should be alone; I will make him a helper fit for 5 him.” 19 Now out of the ground the Lord God had formed6 every beast of the field and every bird of the heavens and brought them to the man to see what he would call them. And whatever the man called every living creature, that was its name. 20 The man gave names to all livestock and to the birds of the heavens and to every beast of the field. But for Adam7 there was not found a helper fit for him. 21 So the Lord God caused a deep sleep to fall upon the man,

SPRING 2024 Sample spread (65% actual size)
3 GENESIS 2:21
1 Or open country 2 Or earth also verse 6 3 Or spring 4 Or when you eat 5 Or corresponding to also verse 20 6 Or And out of the ground the LORD God formed 7 Or the man 1 Or fying things see Leviticus 11:19–20 2 The Hebrew word for man (adam) is the generic term for mankind and becomes the proper name Adam
GENESIS 1:20 2 5.375" x 8.375" | 12-point Milo Serif | 1,952 pages | Double-column format | Red letter
SPRING 2024 AVAILABLE APRIL 24, 2024 LARGE PRINT PERSONAL SIZE BIBLE Deep Teal Emblem TT 978-1-4335-9309-3 $68.49 Slipcase TruTone, Forest/Tan, Trail Design 978-1-4335-6877-0 $68.49 Slipcase TruTone, Mahogany, Trellis Design 978-1-4335-8850-1 $68.49 Slipcase TruTone, Chestnut 978 -1- 4335 - 4154 - 4 $68.49 Slipcase Buffalo Leather, Deep Brown 978-1-4335-7202-9 $123.49 Clamshell Box TruTone, Lavender, Ornament Design 978-1-4335-8166-3 $68.49 Slipcase TruTone, Brown, Engraved Mantel Design 978-1-4335-5590-9 $68.49 Slipcase Genuine Leather, Black 978-1-4335-4152-0 $109.99 Clamshell Box TruTone Mahogany 978-1-4335-4153-7 $68.49 Slipcase

PSALM 33:3

ESV SPIRAL-BOUND JOURNALING BIBLE

The ESV Spiral-Bound Journaling Bible was created from the ground up to facilitate deeper interaction with God’s Word. It features the complete ESV Bible in a convenient hardcover format with an easy-toread layout and generous space for notes.

• Hardcover Journaling Bible: Pages lay flat and fold over completely to make reading and writing more comfortable

• Attractive Design: Easy to read, with ample space for notes

• A Great Gift for Students

8.5" x 11" | 9.5-point Lexicon | Single-column format

Sing to him a new song; play skillfully on the strings, with loud shouts.

For the word of the Lord is upright, and all his work is done in faithfulness.

5 He loves righteousness and justice; the earth is full of the steadfast love of the Lord

6 By the word of the Lord the heavens were made, and by the breath of his mouth all their host.

7 He gathers the waters of the sea as a heap; he puts the deeps in storehouses.

8 Let all the earth fear the Lord let all the inhabitants of the world stand in awe of him!

9 For he spoke, and it came to be; he commanded, and it stood firm.

10 The Lord brings the counsel of the nations to nothing; he frustrates the plans of the peoples.

11 The counsel of the Lord stands forever, the plans of his heart to all generations. Blessed is the nation whose God is the Lord the people whom he has chosen as his heritage!

The Lord looks down from heaven; he sees all the children of man;

14 from where he sits enthroned he looks out on all the inhabitants of the earth,

15 he who fashions the hearts of them all and observes all their deeds.

16 The king is not saved by his great army; a warrior is not delivered by his great strength.

17 The war horse is a false hope for salvation, and by its great might it cannot rescue.

18 Behold, the eye of the Lord is on those who fear him, on those who hope in his steadfast love,

PSALM 34:11

that he may deliver their soul from death and keep them alive in famine.

Our soul waits for the Lord; he is our help and our shield.

21 For our heart is glad in him, because we trust in his holy name.

22 Let your steadfast love, O Lord, be upon us, even as we hope in you.

Taste and See That the Lord Is Good

341 Of David when he changed his behavior before Abimelech so that he drove him out and he went away

1 I will bless the Lord at all times; his praise shall continually be in my mouth.

2 My soul makes its boast in the Lord; let the humble hear and be glad.

3 Oh, magnify the Lord with me, and let us exalt his name together!

4 I sought the Lord, and he answered me and delivered me from all my fears.

Those who look to him are radiant, and their faces shall never be ashamed.

6 This poor man cried, and the Lord heard him and saved him out of all his troubles.

7 The angel of the Lord encamps around those who fear him, and delivers them.

8 Oh, taste and see that the Lord is good! Blessed is the man who takes refuge in him!

9 Oh, fear the Lord, you his saints, for those who fear him have no lack!

10 The young lions sufer want and hunger; but those who seek the Lord lack no good thing.

11 Come, O children, listen to me;

This psalm is an acrostic poem, each verse beginning with the successive letters of the Hebrew alphabet

SPRING 2024
36 37
spread (40% actual size)
Sample

ESV SPIRAL-BOUND JOURNALING BIBLE

5-Volume Set

978-1-4335-9317-8

$205.49

Prophets

978-1-4335-9646-9

$47.99

AVAILABLE MAY 9, 2024

Pentateuch

978-1-4335-9643-8

$47.99

History

978 -1- 4335 - 9644 -5 $47.99

Poetry

978 -1- 4335 - 9645 -2 $47.99

New Testament

978-1-4335-9318-5

$47.99 O-Wrap

O-Wrap
O-Wrap
O-Wrap
O-Wrap
O-Wrap

AVAILABLE JUNE 6, 2024

ESV DAILY DEVOTIONAL NEW TESTAMENT

The ESV Daily Devotional New Testament features 365 daily readings with New Testament passages and verses from the Psalms, brief reflections taken from the ESV Gospel Transformation Study Bible, and prayer prompts.

• 365-Day Devotional: Includes designated Scripture readings for January 1 through December 31

• Interactive: Each day features passages from the New Testament and Psalms, along with insightful reflections and thoughts for prayer

• Makes a Thoughtful Gift: Includes the plan of salvation to help share the gospel

5.375" x 8.375" | 9-point Lexicon | 900 pages | Single-column format

Paperback

978 -1- 4335 - 9322-2

$27.49

A YEAR (PAPERBACK)

JANUARY 7

978-1-4335-9322-2

11 10

dishonor God by breaking the law. 24 For, as it is written, “The name of God is blasphemed among the Gentiles because of you.”

R EFLECTIO N Paul continues to explain humanity’s separation from God due to their sin There are two kinds of people on earth : those “without the law, ” known as Gentiles (non-Jews) ; and those “under the law, ” the Jews (Rom . 2:12 ) Gentiles have an inner awareness of God’s moral demands (v . 15 ) but do not live up to their own sense of right and wrong Jews are descendants of Abraham and of Moses , who received the law from God But God is not pleased with people based on their lineage : he wants his people to obey what he told them to do (v . 13 ) Paul charges the Jews (his own people ; see 9:3; 10:1; 11:1 ) with dishonoring God by violating the law he gave them ( 2:23 ) This gives God a bad name among the Gentiles Paul will eventually turn from his focus on sin and judgment to talk about the gospel (see 3:21 ) But this portion of Romans helps us understand the true sinfulness of humanity . Readers and hearers of Romans can be confident that all this bad news will help us more clearly see the beauty of the good news that Paul will begin sharing in the next chapter Psalm 138 : 6 For though the L ord is high, he regards the lowly, but the haughty he knows from afar.

THO U GHTS FO R P RAY ER Because we are all guilty of sin , our hearts should take a humble posture before God admitting our need for his salvation Cultivate this humility by openly sharing with God several ways in which you are aware of your need for Christ today

J ANUARY 7

Matthew 4 : 1 –11

Then Jesus was led up by the Spirit into the wilderness to be tempted by the devil.

2 And after fasting forty days and forty nights, he was hungry. 3 And the tempter came and said to him, “If you are the Son of God, command these stones to become loaves of bread.” 4 But he answered, “It is written, “‘ Man shall not live by bread alone, but by every word that comes from the mouth of God.’”

5 Then the devil took him to the holy city and set him on the pinnacle of the temple 6 and said to him, “If you are the Son of God, throw yourself down, for it is written,

JANUARY 5

THO U GHTS FO R P RAY ER

We must be careful not to allow ourselves to become comfortable with sin in our lives

Ask God to give you a desire for his ways so that you will have strength to turn quickly from sin when you see it in your life

J ANUARY 6

Matthew 3 : 13 –17

Then Jesus came from Galilee to the Jordan to John, to be baptized by him. 14 John would have prevented him, saying, “I need to be baptized by you, and do you come to me?”

15 But Jesus answered him, “Let it be so now, for thus it is fitting for us to fulfill all righteousness.” Then he consented. 16 And when Jesus was baptized, immediately he went up from the water, and behold, the heavens were opened to him, and he saw the Spirit of God descending like a dove and coming to rest on him; 17 and behold, a voice from heaven said, “This is my beloved Son, with whom I am well pleased.”

R EFLECTIO N

Baptism is how Christians demonstrate that they identify themselves with Jesus and his kingdom John was surprised to see Jesus coming to him for baptism because as John had just said , he was baptizing those who needed to turn away from their sin (Matt . 3:11 ) However, even though Jesus never sinned , he came to John to be baptized in order to show his followers the importance of this symbolic action Romans

2 : 12 –24 For all who have sinned without the law will also perish without the law, and all who have sinned under the law will be judged by the law. 13 For it is not the hearers of the law who are righteous before God, but the doers of the law who will be justified. 14 For when Gentiles, who do not have the law, by nature do what the law requires, they are a law to themselves, even though they do not have the law. 15 They show that the work of the law is written on their hearts, while their conscience also bears witness, and their conflicting thoughts accuse or even excuse them 16 on that day when, according to my gospel, God judges the secrets of men by Christ Jesus. 17 But if you call yourself a Jew and rely on the law and boast in God 18 and know his will and approve what is excellent, because you are instructed from the law; 19 and if you are sure that you yourself are a guide to the blind, a light to those who are in darkness, 20 an instructor of the foolish, a teacher of children, having in the law the embodiment of knowledge and truth—

21 you then who teach others, do you not teach yourself? While you preach against stealing, do you steal?

22 You who say that one must not commit adultery, do you commit adultery? You who abhor idols, do you rob temples? 23 You who boast in the law Sample spread (100% actual size)

SPRING 2024
ESV DAILY
NEW
DEVOTIONAL
TESTAMENT: THROUGH THE NEW TESTAMENT IN

LARGE PRINT WIDE MARGIN BIBLE

The ESV Large Print Wide Margin Bible features generous 11-point type, one-inch margins, and enlarged and bolded verse numbers, designed for easy reading and reference.

•Enlarged and bolded verse numbers

•Extra-wide one-inch margins

•Line matching

6.25" x 9" | 11-point Lexicon | 1,568 pages | Double-column format | Black letter

1330

JOHN 2:5

have to do with me? My hour has not yet come.” 5 His mother said to the servants, “Do whatever he tells you.”

6 Now there were six stone water jars there for the Jewish rites of purification, each holding twenty or thirty gallons.1 7 Jesus said to the servants, “Fill the jars with water.” And they filled them up to the brim.

8 And he said to them, “Now draw some out and take it to the master of the feast.” So they took it. 9 When the master of the feast tasted the water now become wine, and did not know where it came from (though the servants who had drawn the water knew), the master of the feast called the bridegroom 10 and said to him, “Everyone serves the good wine first, and when people have drunk freely, then the poor wine. But you have kept the good wine until now.”

11 This, the first of his signs, Jesus did at Cana in Galilee, and manifested his glory. And his disciples believed in him.

12 After this he went down to Capernaum, with his mother and his brothers2 and his disciples, and they stayed there for a few days.

Jesus Cleanses the Temple

13 The Passover of the Jews was at hand, and Jesus went up to Jerusalem. 14 In the temple he found those who were selling oxen and sheep and pigeons, and the moneychangers sitting there. 15 And making a whip of cords, he drove them all out of the temple, with the sheep and oxen. And he poured out the coins of the money-changers and overturned their tables. 16 And he

told those who sold the pigeons, “Take these things away; do not make my Father’s house a house of trade.” 17 His disciples remembered that it was written, a “Zeal for your house will consume me.”

18 So the Jews said to him, “What sign do you show us for doing these things?” 19 Jesus answered them, “Destroy this temple, and in three days I will raise it up.” 20 The Jews then said, “It has taken forty-six years to build this temple,3 and will you raise it up in three days?” 21 But he was speaking about the temple of his body. 22 When therefore he was raised from the dead, his disciples remembered that he had said this, and they believed the Scripture and the word that Jesus had spoken.

Jesus Knows What Is in Man

23 Now when he was in Jerusalem at the Passover Feast, many believed in his name when they saw the signs that he was doing. 24 But Jesus on his part did not entrust himself to them, because he knew all people 25 and needed no one to bear witness about man, for he himself knew what was in man.

You Must Be Born Again

3 Now there was a man of the Pharisees named Nicodemus, a ruler of the Jews. 2 This man came to Jesus4 by night and said to him, “Rabbi, we know that you are a teacher come from God, for no one can do these signs that you do unless God is with him.” 3 Jesus answered him, “Truly, truly, I say to you, unless one is born again5 he cannot see the

1331

kingdom of God.” 4 Nicodemus said to him, “How can a man be born when he is old? Can he enter a second time into his mother’s womb and be born?” 5 Jesus answered, “Truly, truly, I say to you, unless one is born of water and the Spirit, he cannot enter the kingdom of God.

6 That which is born of the flesh is flesh, and that which is born of the Spirit is spirit.1 7 Do not marvel that I said to you, ‘You2 must be born again.’ 8 The wind3 blows where it wishes, and you hear its sound, but you do not know where it comes from or where it goes. So it is with everyone who is born of the Spirit.”

9 Nicodemus said to him, “How can these things be?” 10 Jesus answered him, “Are you the teacher of Israel and yet you do not understand these things? 11 Truly, truly, I say to you, we speak of what we know, and bear witness to what we have seen, but you4 do not receive our testimony. 12 If I have told you earthly things and you do not believe, how can you believe if I tell you heavenly things? 13 No one has ascended into heaven except he who descended from heaven, the Son of Man.5 14 And as Moses lifted up the serpent in the wilderness, so must the Son of Man be lifted up, 15 that whoever believes in him may have eternal life.6

For God So Loved the World

16 “For God so loved the world,7 that he gave his only Son, that whoever believes in him should not perish but have eternal life. 17 For God did not send his Son into the world to condemn the world, but in

1

JOHN 3:29

order that the world might be saved through him. 18 Whoever believes in him is not condemned, but whoever does not believe is condemned already, because he has not believed in the name of the only Son of God.

19 And this is the judgment: the light has come into the world, and people loved the darkness rather than the light because their works were evil.

20 For everyone who does wicked things hates the light and does not come to the light, lest his works should be exposed. 21 But whoever does what is true comes to the light, so that it may be clearly seen that his works have been carried out in God.”

John the Baptist Exalts Christ

22 After this Jesus and his disciples went into the Judean countryside, and he remained there with them and was baptizing. 23 John also was baptizing at Aenon near Salim, because water was plentiful there, and people were coming and being baptized 24 (for John had not yet been put in prison).

25 Now a discussion arose between some of John’s disciples and a Jew over purification. 26 And they came to John and said to him, “Rabbi, he who was with you across the Jordan, to whom you bore witness—look, he is baptizing, and all are going to him.” 27 John answered, “A person cannot receive even one thing unless it is given him from heaven.

28 You yourselves bear me witness, that I said, ‘I am not the Christ, but I have been sent before him.’

29 The one who has the bride is the bridegroom. The friend of the bridegroom, who stands and hears him,

SPRING 2024
Sample spread (55% actual size)
1 Greek two or three measures (metrētas); a metrē ēs was about 10 gallons or 35 liters 2 Or brothers and sisters In New Testament usage, depending on the context, the plural Greek word adelphoi (translated “brothers”) may refer either to brothers or to brothers and sisters 3 Or This temple was built forty-six years ago 4 Greek him 5 Or from above the Greek is purposely ambiguous and can mean both again and from above also verse 7 a Ps. 69:9
The same Greek word means both wind and spirit 2 The Greek for you is plural here
The same Greek word means both wind and spirit 4 The Greek for you is plural here; also four times in verse 12 5 Some manuscripts add who is in heaven
Some interpreters hold that the quotation ends at verse 15 7 Or For this is how God loved the world
3
6
SPRING 2024 AVAILABLE MAY 23, 2024
Blue Ornament TT 978-1-4335-9315-4
82.49 Slipcase TruTone, Brown/Cordovan, Portfolio Design 978-1-4335-6245-7
82.49 Slipcase Genuine Leather, Black 978-1-4335-6195-5
123.49
Box
LARGE PRINT WIDE MARGIN BIBLE Slate
$
$
$
Clamshell

VEST POCKET NEW TESTAMENT WITH PSALMS AND PROVERBS

The ESV Vest Pocket New Testament with Psalms and Proverbs is a fordable, portable, and durable—a great choice for those who want to carry God’s Word with them wherever they go.

•Includes Psalms and Proverbs

•High-quality Bible paper

•Words of Christ in red (various editions)

•Smyth-sewn binding

•Lifetime guarantee (TruTone editions)

2.6875" x 4.33" | 6-point Lexicon | 656 pages | Double-column format | Red letter

JOHN 1:46 146

wrote, Jesus of Nazareth, the son of Joseph.” 46Nathanael said to him, “Can anything good come out of Nazareth?” Philip said to him, “Come and see.” 47Jesus saw Nathanael coming toward him and said of him, “Behold, an Israelite indeed, in whom there is no deceit!” 48Nathanael said to him, “How do you know me?” Jesus answered him, “Before Philip called you, when you were under the fig tree, I saw you.” 49Nathanael answered him, “Rabbi, you are the Son of God! You are the King of Israel!” 50 Jesus answered him, “Because I said to you, ‘I saw you under the fig tree,’ do you believe? You will see greater things than these.” 51And he said to him, “Truly, truly, I say to you, you will see heaven opened, and the angels of God ascending and descending on the Son of Man.”

The Wed ding at Cana

2 On the third day there was a wedding at Cana in Galilee, and the mother of Jesus was there. 2 Jesus also was invited to the wedding with his disciples. 3When the wine ran out, the mother of Jesus said to him, “They have no wine.” 4And Jesus said to her, “Woman, what does this have to do with me? My hour has not yet come.” 5His mother said to the servants, “Do whatever he tells you.”

6 Now there were six stone water jars there for the Jew-

ish rites of purification, each holding twenty or thirty gallons. 7Jesus said to the servants, “Fill the jars with water.” And they filled them up to the brim.

8And he said to them, “Now draw some out and take it to the master of the feast.” So they took it.

9When the master of the feast tasted the water now become wine, and did not know where it came from (though the servants who had drawn the water knew), the master of the feast called the bridegroom 10 and said to him, “Everyone serves the good wine first, and when people have drunk freely, then the poor wine. But you have kept the good wine until now.” 11 This, the first of his signs, Jesus did at Cana in Galilee, and manifested his glory. And his disciples believed in him.

12 After this he went down to Capernaum, with his mother and his brothers and his disciples, and they stayed there for a few days.

Jesus Cleans es the Tem ple

13 The Passover of the Jews was at hand, and Jesus went up to Jerusalem. 14In the temple he found those who were selling oxen and sheep and pigeons, and the money-changers sitting there. 15And making a whip of cords, he drove them all out of the temple, with the sheep and oxen. And he poured out the

147 JOHN 3:13 coins of the money-changers and overturned their tables. 16And he told those who sold the pigeons, “Take these things away; do not make my Father’s house a house of trade.” 17His disciples remembered that it was written, “Zeal for your house will consume me.”

18 So the Jews said to him, “What sign do you show us for doing these things?” 19Jesus answered them, “Destroy this temple, and in three days I will raise it up.” 20The Jews then said, “It has taken forty-six years to build this temple, and will you raise it up in three days?” 21But he was speaking about the temple of his body. 22When therefore he was raised from the dead, his disciples remembered that he had said this, and they believed the Scripture and the word that Jesus had spoken.

Jesus Knows What Is in Man

23 Now when he was in Jerusalem at the Passover Feast, many believed in his name when they saw the signs that he was doing. 24But Jesus on his part did not entrust himself to them, because he knew all people 25and needed no one to bear witness about man, for he himself knew what was in man.

You Must Be Born Again

3 Now there was a man of the Pharisees named Nicodemus, a ruler of the Jews. 2This man

came to Jesus by night and said to him, “Rabbi, we know that you are a teacher come from God, for no one can do these signs that you do unless God is with him.” 3 Jesus answered him, “Truly, truly, I say to you, unless one is born again he cannot see the kingdom of God.” 4Nicodemus said to him, “How can a man be born when he is old? Can he enter a second time into his mother’s womb and be born?” 5Jesus answered, “Truly, truly, I say to you, unless one is born of water and the Spirit, he cannot enter the kingdom of God. 6That which is born of the flesh is flesh, and that which is born of the Spirit is spirit. 7Do not marvel that I said to you, ‘You must be born again.’ 8The wind blows where it wishes, and you hear its sound, but you do not know where it comes from or where it goes. So it is with everyone who is born of the Spirit.”

9 Nicodemus said to him, “How can these things be?”

10Jesus answered him, “Are you the teacher of Israel and yet you do not understand these things?

11 Truly, truly, I say to you, we speak of what we know, and bear witness to what we have seen, but you do not receive our testimony. 12If I have told you earthly things and you do not believe, how can you believe if I tell you heavenly things? 13No one has ascended into heaven

SPRING 2024
spread (100% actual size)
Sample
SPRING 2024 AVAILABLE JUNE 20, 2024
VEST POCKET NEW TESTAMENT WITH PSALMS AND PROVERBS
TT 978-1-4335-9319-2 $13.99 O-wrap
Nubuck Caramel Wildflower
, Chestnut 978 -1- 4335 - 4821-5 $13.99 O-wrap TruTone, Berry, Floral Design 978-1-4335-8711-5 $13.99 O-wrap TruTone, Teal 978 -1- 4335 -5901-3 $13.99 O-wrap
TruTone
, Silver, Sword Design 978-1-4335-5898-6 $13.99 O-wrap
, Black 978 -1- 4335 - 4820 - 8 $13.99 O-wrap
TruTone
TruTone

ESV PREMIUM GIFT BIBLE

5 375 x 8 375, TruTone, 1,120 pages

978-1-4335-9311-6, $1 99 , Case qty: 24

BISAC: BIBLES / English Standard Version / Text

(BIB003060)

BIBLES / English Standard Version / Reading (BIB003110)

BIBLES / English Standard Version / General (BIB003000)

Available April 25, 2024

ACTUAL TYPE SIZE

No Image Found

ESV PREMIUM GIFT BIBLE

TruTone®, Nubuck Caramel, Wildflower Design

Affordable and Portable ESV Bible with a Quality TruTone Cover

The ESV Premium Gift Bible retains many of the popular features of the original ESV Thinline Bible This highly affordable edition features a quality TruTone cover and a concordance, all in a portable format that is less than one inch thick. Containing the complete ESV text in readable type, the ESV Premium Gift Bible offers the highest value for a thinline Bible at the best price.

FEATURES

High Value: Highly affordable edition features a quality TruTone cover and concordance

Portable: This Bible is less than one inch thick and features a readable 8-point Lexicon type

Lifetime Guarantee

SAMPL

E SPREAD

No Image Found

SPRING 2024
CROSSWAY.ORG
$27.49

ESV GOSPEL OF JOHN, LARGE PRINT

With a generous type size and an inviting layout, the ESV Gospel of John, Large Print allows all readers to encounter Christ as they engage with the beautiful depiction of the words and work of our life-giving Savior.

• Easy-to-Read Format: 10.5-point type size and inviting layout make the Gospel of John more readable

• Popular: Original ESV Gospel of John has sold over one million copies

• Additional Resources: Along with the full text of the Gospel of John, this edition features an introduction, gospel presentation, list of central verses, glossary, and reading plans

John 5 : 45

receive glory from one another and do not seek the glory that comes from the only God? 45 Do not think that I will accuse you to the Father. There is one who accuses you: Moses, on whom you have set your hope. 46 For if you believed Moses, you would believe me; for he wrote of me. 47 But if you do not believe his writings, how will you believe my words?”

Jesus Feeds the Five Thousand

6After this Jesus went away to the other side of the Sea of Galilee, which is the Sea of Tiberias. 2 And a large crowd was following him, because they saw the signs that he was doing on the sick. 3 Jesus went up on the mountain, and there he sat down with his disciples. 4 Now the Passover, the feast of the Jews, was at hand. 5 Lifting up his eyes, then, and seeing that a large crowd was coming toward him, Jesus said to Philip, “Where are we to buy bread, so that these people may eat?” 6 He said this to test him, for he himself knew what he would do. 7 Philip

answered him, “Two hundred denarii worth of bread would not be enough for each of them to get a little.” 8 One of his disciples, Andrew, Simon Peter’s brother, said to him, 9 “There is a boy here who has five barley loaves and two fish, but what are they for so many?” 10 Jesus said, “Have the people sit down.” Now there was much grass in the place. So the men sat down, about five thousand in number. 11 Jesus then took the loaves, and when he had given thanks, he distributed them to those who were seated. So also the fish, as much as they wanted. 12 And when they had eaten their fill, he told his disciples, “Gather up the leftover fragments, that nothing may be lost.” 13 So they gathered them up and filled twelve baskets with fragments from the five barley loaves left by those who had eaten. 14 When the people saw the sign that he had done, they said, “This is indeed the Prophet who is to come into the world!”

15 Perceiving then that they were about to come and take him by force to make him king, Jesus withdrew again to the mountain by himself.

John 6 : 15 24

25

SPRING 2024
Sample spread (82% actual size)
43.John.indd 24-25
10:27
9/18/23
AM
4.25" x 6" | 10.5-point Lexicon | 150 pages | Single-column format
APRIL
4, 2024
Paperback 978-1-4335-9308-6 $3.99

45% B&H

20% LIFEWAY

DISCOVERING THE

Sin has a price. Genesis 2:15–17

3 And God blessed the seventh day, and sanctified it: because that in it he had rested fromall his workwhich God created and made.

4 These are the generations of the heavens and of the earth when they

were cre ated, in the day that the Lord God made the earth and the heavens,

5 And every plant of the field before it was in the earth, and every herb of the field before it grew: for the Lord God had not caused it to rain upon the earth, and there was not a man to till the ground.

6 But there went up a mist from the earth, and watered the whole face of the ground.

7 And the Lord God formed man of the dust of the ground, and breathed into his nostrils the breath of life; and man became a living soul.

THE GARDEN OF EDEN

8 And the Lord God planted a garden eastward in Eden; and there he put the man whom he had formed.

9 And out of the ground made the Lord God to grow every tree that is pleasant to the sight, and good for food; the tree of life also in the midst of the garden, and the tree of knowledge of good and evil.

10 And a river went out of Eden to water the garden; and from thence

HIDDEKEL AND EUPHRATES RIVERS

DID YOU KNOW that the Hiddekel (Tigris) River is about 1,150 miles long (that’s farther than Miami, FL, to Dallas, TX), and that the Euphrates is about 1,700 miles long (that’s almost as far as Los Angeles, CA, to Chicago, IL)? Rivers mentioned in Genesis 2:14 are found in Iraq (ancient Mesopotamia). Check it out!

EUPHRATES RIVER

18 And the L ord God said, It is not good that the man should be alone; I will make him an help meet for him.

ADAM NAMES LIVING CREATURES

19 And out of the ground the Lord God formed every beast of the field, and every fowl of the air; and brought them unto Adam to see what he would call them: and whatsoever Adam called everyliving creature, that was the name thereof.

FIELD GUIDE

ADAM

First Man on Earth

STORY IN BIBLE: Genesis 1–3.

BORN: Fully grown in garden of Eden, before 4000 BC.

NAME MEANING “Mankind.”

OCCUPATIONS: Gardener, zoologist.

RELATIVES: Wife—Eve. Children— Cain, Abel, Seth, and many more.

CLAIM TO FAME:

• First human.

• Had a personal relationship with God.

• Lived in the garden of Eden.

• Named the animals and tended the garden.

• Had a perfect life for a while.

• Blamed others rather than taking responsibility for his actions.

• Tried to hide his sin from God.

• Lived to be 930 years old.

20 And Adam gave names to all cattle, and to the fowl of the air, and to every beast of the field; but for Adam there was not found an help meet for him.

THE CREATION OF WOMAN

21 And the Lord God caused a deep sleep to fall upon Adam, and he slept: and he took one of his ribs, and closed up the flesh instead thereof;

22 And the rib, which the L ord God had taken from man, made he a wom an, and brought her unto the man.

23 And Adam said, This is now bone of my bones, and flesh of my flesh: she shall be called Woman, because she was taken out of Man.

Genesis2 Genesis 2 it was parted, and became into four heads. it which compasseth the whole land of Hav lah, where there is gold; And the gold of that land is good: there is bdellium and the onyx stone. it that compasseth the whole land of Ethiopia. And the name of the third riv is Hiddekel: that is it which goeth toward the east of Assyria. And the fourth river is Euphrates. and put him into the garden of to dress it and to keep it. And the L God commanded treeofthe But of the tree of the knowledge of good and evil, thou shalt not eat that thou eatest die. God said, the man should be alone; will make him an help meet And out of the ground the Lord beast of the field, fowl of the air; and brought eryliving creature, that the all catthe fowl of the air, and for Adam there was not found an help meet for him. And the ord God caused a deep sleep to fall upon Adam, and he slept: and he took one of his ribs, and closed up the flesh instead thereof; And the rib, which the God had taken from man, made a woman, and brought herunto the am said, This of my bones, and flesh of my shall be called Woman, because she was taken out of Man. And God blessed the seventh and sanctified it: be that had rested from all his work which These are the generations heav and of the earth when ated, in the day that the L God made the earth and the ery plant it was in the earth, and every herb of the field before it for the L God had caused it rain the earth, ground. But there went mist from the earth, and watered the whole face of the ground. of the dust of the ground, and breathed into his nostrils the breath of life; and man be a living soul. And the Lord God planted garden eastward in Eden; and there he put ADAM Fully grown in garden of Eden, before 4000 BC. NAME MEANING “Mankind.” OCCUPATIONS Gardener, zoologist. RELATIVES Wife—Eve. Children— Cain, Abel, Seth, and many more. Had personal relationship with Lived in the garden of Eden. Named the animals and tended the garden. Had perfect life for while. Blamed others rather than taking responsibility for his actions. Lived to be 930 years old. Sin has a price. HIDDEKEL AND EUPHRATES RIVERS 1,150 miles long (that’s farther than Miami, FL, to Dallas, TX), and that the Euphrates is about 1,700 miles long (that’s almost as far as Los Angeles, CA, to Chicago, IL)? Rivers mentioned in Genesis 2:14 are found in Iraq (ancient Mesopotamia). Check it out! HOW TO USE THIS BIBLE Five different BADGES are placed throughout the Bible to help kids understand and interact with Scripture. QR CODES placed throughout the Bible lead to educational on-scene videos to help kids apply essential truths of the Bible to their own lives. ARCHIVING DISCOVERIES highlighting key memory verses throughout the Bible. DISCUSSION QUESTIONS are listed after each video for parents or ministry leaders to use as a conversation and discipleship tool For additional resources, study helps, and available curriculum, visit www.ExplorerBibleforKids.com BOOK INTRODUCTIONS, including the Who, What, When, Where, and Why?" CHRIST IN CONTEXT for each book to show how the whole Bible points to Jesus and the good news of the gospel. Printable Explorer ACTIVITY PAGES for home or classroom use to help kids better understand and apply God’s Word. DISCUSSION QUESTIONS Where do we see God’s amazing power in creation? Why did God Create you? What is your purpose? DOWNLOAD ACTIVITIES PAGES by scanning this QR code. LAW GENESIS 15:1–6; 17:1–9, 15–22; 21:1–7 STAR COLOR God told Abraham, “Look at the sky and count the stars, you can. Your CHARTING DISCOVERING THE THE PAST CREATION GENESIS LAW WHO WROTE THE TEXT? Moses. WHO IS THE AUDIENCE? Israelites, traveling to the promised land. WHAT WAS HAPPENING IN THE WORLD? China created the first zoo in 2000 BC; Babylonians and Egyptians divided the days into hours, minutes, and seconds in 2000 BC; Multiplication tables developed in Mesopotamia in 1800 BC. Israel’s journey from slavery in Egypt to the land of Canaan. WHEN WAS GENESIS WRITTEN? Considered between 1445 and 1406 BC. WHEN DID THE EVENTS OF GENESIS TAKE PLACE? From creation to about 1805 BC (Joseph’s death). WHY WAS GENESIS WRITTEN? To lay the foundation for history and theology for the entire Bible. Genesis reveals one’s need for redemption and lays out God’s plan to send beginnings. In the beginning, God created perfect world. Sin separated mankind from God and showed that people need a Savior. God called Abraham and promised him that one day his descendants would be God’s special people and one day, he would send Messiah—Jesus—to rescue them. GENESIS GOD CREATED EVERYTHING AND HAS A PLAN FOR HIS PEOPLE. ALMONDS plants consumed water from mist coming from the ground Bible. It appears in Genesis 8:7 when ark by Noah to see 5 Genesis2 Genesis1–2 And the evening and the morning were the fifth day. 24 And God said, Let the earth bring forth the living creature after his kind, cattle, and creeping thing, and beast of the earth after his kind: and it was so. And God made the beast of the earth af his kind, and cattle af theirkind, and every thing that creepeth upon the earth after his kind: and God that it good. 26 And God said, Let us make man in our image, after our likeness: and let them have dominion over the fish of the sea, and over the fowl of the air, and over the cattle, and over all the earth, and over every creeping thing that creepeth upon the earth. 27 So God created in his image, in the image of God created he him; male and female created he them. And God blessed them, and God said unto them, Be fruitful, and multiply, and replenish the earth, and subdue it: and have dominion over the fish of the sea, and the fowl of the air, and erylivingthingthatmoveth upon the earth. THE GIVING OF FOOD 29 And God said, Behold, have given you every herb bearing seed, which is upon the face of all the earth, and every tree, in the which is the fruit of a tree yielding seed; you it shall be for meat. And to every beast of the earth, and toevery fowl of the air, and toevery thing that creepeth upon the earth, wherein there is life, have given ery green herb for meat: and it was so. AndGod sawevery thingthat he had made, and, behold, it was very good. And the evening and the morning were the sixth day. THE SEVENTH DAY 2 Thus the heavens and the earth were finished, and all the host of them. And on the seventh day God ended hisworkwhich he hadmade;and he rested on the seventh day from all his work which he had made. What is seven inches long, has 50-mile-per-hour punch, is as colorful as rainbow, and is strong enough to break glass? It’s the PEACOCK MANTIS SHRIMP! This creature’s super-strong claws come in handy when cracking into the crabs and other mollusks it finds to eat in the tropical waters of the Indian and Pacific Oceans. Why does such a beautiful, strong, and interesting creature exist? YAHWEH, the everlasting God, created everything— including the peacock mantis shrimp. Like all of God’s creatures, this colorful shrimp exists to give glory to our awesome God! CRAZYCOOLCREATION Throughout history, people have tried to explain how the world began. Here are some ARTIFACTS from those people. The Bible teaches us that God created everything and rules over it. We can have CONFIDENCE in this because the Bible is the perfect, accurate, inspired Word of God. ARCHAEOLOGICALHELPS BRONZE SWORD SHOWING A CREATION MYTH MESOPOTAMIA, 1200–800BC TEXT OF THE BABYLONIAN EPIC OF CREATION, 700 BC SILVER GOBLET SHOWING SCENES FROM A BABYLONIAN CREATION MYTH, AROUND 2000 BC WITH THE TEXTOF THE SUMERIAN CREATION MYTH, 2000 BC MATTHEW 1:1–17 GOSPELS Find each the names listed below in the word search puzzle. EZQAEISAAC ELEAZARVOO AUIQJOEUJB HHOUYRAMAE AMAIDMQYCD IELZAZADOK ZQYRAEIOBQ ZLAQHPESOJ UYTAMAREZA Joseph 6 7 Genesis 2 Genesis 2 it was parted, and became into four heads. 11 The name of the first is Pison: that is it which compasseth the whole land of Havilah, where there is gold; 12 And the gold of that land is good: there is bdellium and the onyx stone. 13 And the name of the second river is Gihon: the same is it that compasseth the whole land of Ethiopia. 14 And the name of the third river is Hiddekel: that is it which goeth toward the east of Assyria. And the fourth river is Euphrates. MAN TO CARE FOR THE GARDEN
And the Lord God took the man, and put him into the garden of Eden to dress it and to keep it. 16 And the Lord God commanded the man, saying, Of every tree of the garden thou mayest freely eat: 17 But of the tree of the knowledge of good and evil, thou shalt not eat of it: for in the day that thou eatest thereof thou shalt surely die.
15
HIDDEKEL RIVER THE PAST
bhpublishing.com 32
Interior spread

ages 8-12

KJV Explorer Bible for Kids

The KJV Explorer Bible for Kids helps kids place God’s Word in the middle of God’s world. Within its engaging, full-color pages, kids will interact with the people, places, and things of the Bible and God’s creation. Fascinating images, illustrations, timelines, and study helps show archeological evidence, introduce key characters, explain new concepts, and help kids experience the wonder and truth of the Bible. QR codes placed throughout the Bible bring educational videos, discussion questions, and activity pages to life, helping kids apply key truths of the Bible to real world experiences..

features

• Book introductions to help kids understand the key truths and takeaways for every book, including the “Who, What, When, Where, and Why”

• “Christ in Context” for each book to show how the whole Bible points to Jesus and the good news of the gospel

• “Discovering the Truth” callouts to help kids understand the essential truths of the Bible and apply them to their life

• “Excavating the Past” illustrations and real-world images to help connect the dots between important archaeological discoveries and the Bible

• “Exploring Creation” facts and images connecting modern-day objects and things in the world today to God and the Bible

• “Charting History” illustrated timelines to survey key time periods and events in biblical history

• “Character Field Guide” profiles with fun facts and insights about important people in the Bible

• “Archiving Discoveries” highlighting key memory verses throughout the Bible

• “Explorer Glossary” and topical concordance to help with some of the big words found in the Bible

• QR codes placed throughout the Bible with online videos and activities for home or church

• 9.5-point type size that is easy-to-read with words of Jesus in red

• Ribbon marker for easy referencing between pages

• Specially designed presentation page for gift giving or awards

audience

• Parents, caretakers, children’s pastors, teachers, and those giving gifts to children

release date: August 15, 2024 pages : 1 , 472

size: 6 x 9 spine

rights: Worldwide bisac: BIB001050/ BIBLES/King James Version/Children

• Full-color maps section to help find places mentioned in the Bible

• 6” x 9” page size

The KJV Explorer Bible for Kids features the authorized Pure Cambridge Edition text of the King James Version (KJV) translation. The KJV is one of the best-selling translations of all time and captures the beauty and majesty of God’s Word for those who love the rich heritage and reverent language of this rendering of the Holy Bible.

marketing highlights

• A range of colorful and fact-packed study helps, illustrations, charts, maps, and diagrams bring God’s Word close to home for curious kids

• QR-accessible online activities ensure the learning continues beyond the pages of the Bible

• The KJV Explorer Bible for Kids features the authorized Pure Cambridge Edition text of the King James Version (KJV) translation

A 9781430095798 Hardcover $47.99 B 9798384502258 Brown LeatherTouch® $61.99 B 9798384502265 Brown LeatherTouch® - Indexed $75.49 C 9798384502272 Bubble Gum LeatherTouch® $61.99 C 9798384502289 Bubble Gum LeatherTouch® - Indexed $75.49 D 9798384502296 Purple LeatherTouch® $61.99 D 9798384502302 Purple LeatherTouch® - Indexed $75.49 E 9798384502319 Royal Blue LeatherTouch® $61.99 E 9798384502326 Royal Blue LeatherTouch® - Indexed $75.49 isbn binding material price
width
carton qty: 12
: 1.6"
B C D E
KIDS BIBLES summer 2024 KJV A ALSO AVAILABLE IN CSB

KJV Giant Print Reference Bible

The KJV Giant Print Reference Bible features a giant, easy-to-read 13.5-point type in a convenient trim size that is perfect for devotional reading, personal study, or use at church. The giant print type makes this Bible an ideal choice for those who have diminished or impaired vision.

features

• Pure Cambridge Edition of the KJV text

• Smyth-sewn, lay-flat binding meant to last a lifetime

• Two-column, verse-by-verse text format

• End-of-paragraph cross-references

• Topical page headings

• 13.5-point type size

• Words of Christ in red

• Gilded page edges

• Ribbon marker for easy referencing between pages

• Topical concordance

• Presentation page for gift giving

• Full-color maps

• 6.25” x 9.375” page size

The KJV Giant Print Reference Bible features the authorized Pure Cambridge Edition text of the King James Version (KJV) translation. The KJV is one of the best-selling translations of all time and captures the beauty and majesty of God’s Word for those who love the rich heritage and reverent language of this rendering of the Holy Bible.

audience

• Individuals looking for a reference Bible with large print

• Relatives or friends purchasing a Bible for someone wanting a Bible with larger print

marketing highlights

• Readers of all ages will be able to study Scripture in a setting designed to maximize legibility with giant, 13.5-point type size combined with a robust cross-reference system and verse-by-verse format

• A Bible you can read for a lifetime

• The KJV Giant Print Reference Bible features the authorized Pure Cambridge Edition text of the King James Version (KJV) translation

BIBLES summer 2024 KJV
release date: July 15, 2024 pages: 1,588 size: 6.13 x 9.1 font: 13.5 pt. spine width: 1.41" carton qty: 12 rights: Worldwide bisac: BIB006040/BIBLES/King James Version/Reference A B ALSO AVAILABLE IN CSB AND NASB A 9798384501985 Burnt Sienna LeatherTouch® $54.99 A 9798384501992 Burnt Sienna LeatherTouch® - Indexed $68.49 B 9798384502005 Teal LeatherTouch® $54.99 B 9798384502012 Teal LeatherTouch® - Indexed $68.49 isbn binding material price

release date: August 13, 2024 4–8

isbn: 9781430095835

format: Printed Hardcover price: $20.99

page count: 32 size: 8 x 10

spine width: .25" carton qty: 36

rights: Worldwide

bisac: JUV033080/RELIGION/Juvenile Fiction/Religious/Christian/Early Readers

Raised in small-town Alabama, siblings Madison, Taylor, and Logan Cain started singing together in elementary school and were pursuing a career in music by the time they were adults. Their hit songs, “Rise Up,” “I’m So Blessed,” and “Yes He Can” are just a few of the songs which have touched audiences everywhere. Each sibling is now a parent and resides in Nashville, Tennessee. More than anything, CAIN loves sharing songs that radiate the kind of happiness only found in God’s goodness.

I'm So Blessed

CAIN

This interactive picture book invites kids and parents to sing about God’s blessings in every circumstance. Sibling band, CAIN has harnessed the message from their hit song, “I’m So Blessed,” to create a lyrical picture book with bright and playful illustrations. Kids will follow personified fruits, Tay-Tay Tangerine, Logo Lemon, and Maddie Melon, through their daily lives as they encounter challenges and frustrations but learn how to praise God still.

It's easy to feel blessed and praise God on the best days, but what about the worst days? Throughout this story, each fruit friend encounters a hard day. Tay-Tay’s Tuesday plans get ruined by a rainstorm, Maddie’s friends forget about her birthday, and Logo falls during a flip in front of a big crowd. In each circumstance, they are reminded that even in frustration and embarrassment, God loves them. It’s not because we have good days that God’s children are blessed—it’s because He loves His kids every day!

I’m So Blessed teaches kids that while it’s okay to be sad when plans are ruined, friends let them down, and embarrassment strikes, God is with His children in every circumstance. If kids have breath in their lungs, they can find joy in God’s blessings and praise Him by singing the fruits’ favorite truth: “I’m so blessed!”

audience

• Fans of the sibling band CAIN

• Parents of children ages 4 to 8 (and grandparents, caregivers, and other buyers for kids in this age group)

• Childrens’ pastors, family pastors, Christian schools, church libraries and bookstores, and homeschool families

marketing highlights

• Sibling band CAIN is a Christian contemporary trio that is well-known for their joyful and vibrant songs with positive messages

• This interactive picture book, based on CAIN’s song “I’m So Blessed,” helps remind children that we can praise God in every circumstance because of His love for His children

• B&H will promote this title through a national publicity campaign, paid social media, targeted emails, and other strategic marketing to the key audience

KIDS BOOKS summer 2024
Interior spread

release date: June 4, 2024

isbn: 9781430088561

format: Board Book price: $17.99

page count: 20 size: 5 x 7

spine width: .70" carton qty: 24

rights: Worldwide

bisac: JNF049260/Juvenile Nonfiction/ Religious/Christian/Learning Concepts

Who is God?

A Toddler Theology Book About Our Creator

Even toddlers can learn theology!

It’s never too early to help kids learn about God. This debut book from the series, Toddler Theology, teaches kids to answer basic questions about who God is. Kids will learn that God has always existed, is three in one, is the creator of everything, there is only one God, and more.

Much like a catechism, this question-and-answer-style board book helps toddlers understand who God is at a basic but rich level. Each spread uses beautiful illustrations to help kids pair the question’s answer with bright, memorable images. The questions are simple, and the answers are short and easy to memorize, giving even toddlers tools they need to answer their budding questions about theology.

audience

• Parents and grandparents of children ages 0 to 4 and families looking for books to introduce basic concepts of theology to their children at a young age

• Gift buyers looking for thoughtful books for the children in their lives

• Churches who want to help kids learn basic theology and children’s ministry leaders of toddlers and preschoolers

marketing highlights

• This question-and-answer board book helps toddlers understand who God is at a basic but rich level

• Featuring easy-to-memorize questions and answers in a catechism-style format, this book gives toddlers answers to budding questions about theology

• This book is part of the Toddler Theology series from B&H Kids

KIDS BOOKS summer 2024
0–4
Interior spread

release date: June 4, 2024

isbn: 9781430088578

format: Board Book price: $17.99

page count: 20 size: 5 x 7

spine width: .70" carton qty: 24

rights: Worldwide

bisac: JNF049260/Juvenile Nonfiction/ Religious/Christian/Learning Concepts

What's the Good News?

A Toddler Theology Book About the Gospel

Even toddlers can learn theology!

It’s never too early to help kids learn about the gospel. This book from the new series, Toddler Theology, teaches kids to answer basic questions about the good news: the gospel! Kids will learn that people are made in God’s image, everyone is born a sinner, sin must be punished, Jesus died on the cross, God forgives our sins, and more.

Much like a catechism, this question-and-answer-style board book helps toddlers understand the gospel at a basic but rich level. Each spread uses beautiful illustrations to help kids pair the question’s answer with bright, memorable images. The questions are simple, and the answers are short and easy to memorize, giving even toddlers tools they need to answer their budding questions about theology.

audience

• Parents and grandparents of children ages 0 to 4 and families looking for books to introduce basic concepts of theology to their children at a young age

• Gift buyers looking for thoughtful books for the children in their lives

• Churches who want to help kids learn basic theology and children’s ministry leaders of toddlers and preschoolers

marketing highlights

• This question-and-answer board book helps toddlers understand the gospel at a basic but rich level

• Featuring easy-to-memorize questions and answers in a catechism-style format, this book gives toddlers answers to budding questions about theology

• This book is part of the Toddler Theology series from B&H Kids

0–4 KIDS BOOKS summer 2024
Interior spread

release date: July 9, 2024

isbn: 9781430096351 0–4

format: Board Book price: $17.99

page count: 20 size: 8 x 8

spine width: .70" carton qty: 24

rights: Worldwide

bisac: JNF049130/JUVENILE NONFICTION/ Religious/Christian/Devotional & Prayer

The Lord Is My Shepherd

Elton the Sheepdog Looks at Psalm 23 (and the wisdom he can fetch)

Psalm 23 is one of the most well-known passages of Scripture and a perfect choice for giving courage and comfort to readers of all ages. This delightful board book lets children discover the psalm as they watch Elton the sheepdog rest in green pastures, walk through a dark valley, and enjoy the goodness and love of the Shepherd. A delightful choice for dog lovers and Scripture lovers alike, the book helps young readers not only recognize and learn a beloved Bible passage but also to visualize the role and love of our Good Shepherd

audience

• Parents and grandparents of children ages 0 to 4

• Families looking for books to introduce Scripture to their children at a young age

• Gift buyers looking for thoughtful books for the children in their lives, especially those who love dogs and pets

marketing highlights

• Jay and Kristi Smith own the award-winning Juicebox Designs, and the illustrations will connect with children

• Psalm 23 is a beloved Scripture passage, making this board book one families are sure to want to have in their homes

• The Lord Is My Shepherd points children to their true caregiver, and illustrations of Elton the friendly sheepdog will engage a child’s mind and help them remember their Good Shepherd

JAY and KRISTI SMITH are the owners of Juicebox Designs—an award-winning, independent design studio located in Nashville, Tennessee, that creates unique design solutions for brands big and small. They are also the authors/illustrators of Christmas Eve, Colorful Comfort, Colorful Creation, Patterns for Peace, and Patterns for Prayer, which are sold with their other products on their website. Elton is their Old English Sheepdog who assists them in their work each day, in between naps and walks with his friends.

KIDS BOOKS summer 2024
Interior spread

release date: May 14, 2024

isbn: 9781087729695

format: Printed Hardcover price: $20.99

6-10

page count: 128 size: 7 x 9

spine width: .4" carton qty: 36 rights: Worldwide bisac: JNF049040/JUVENILE NONFICTION/ Religion/Bible Stories/General

JIMMY SCROGGINS is the lead pastor of Family Church in South Florida, where he has served since July 2008. He and his wife, Kristin, have eight children and three grandchildren. Under Jimmy’s leadership, Family Church has grown to a network of neighborhood churches across three counties and in four languages. Family Church is passionate about building families by helping them discover and pursue God’s design while carrying out their vision of taking the gospel to every person, in every family and neighborhood. Jimmy is the author of Full Circle Parenting and Turning Everyday Conversations into Gospel Conversations and hosts the Church for the Rest of Us podcast at familychurchnetwork.com. He also serves on the board of trustees at Palm Beach Atlantic University. Dr. Scroggins teaches as a visiting professor at both The Southern Baptist Theological Seminary and Southeastern Baptist Theological Seminary.

The Plan, the Fall, and the Very Good News

A 3 Circles Bible Storybook

Reading the Bible and understanding the gospel can be as easy as counting to three!

Author and pastor Jimmy Scroggins developed the three circles method as a simple way for people of all ages to understand and share the gospel. This unique Bible storybook shows young readers a new way to approach each story by recognizing the distinct parts of the 3 circles method—God’s perfect plan, the fall, and the very good news: Jesus!

Filled with quirky illustrations, this collection of twenty-one stories—from Earth’s creation to Paul’s conversion—was chosen to show the 3 circles pattern throughout the big story of the Bible. No matter the testament, book, or chapter, Jesus is the answer to the world’s brokenness.

After reading through The Plan, the Fall, and the Very Good News (alone or with the family), readers will be able to apply the 3 circles method to other Bible stories. And, most important, they’ll be able to share with others the simple and wonderful message of the gospel.

audience

• Young children ages 6 to 10 years old who are eager to explore Bible stories in a unique and engaging way

• Parents and caregivers looking for a valuable resource to teach their children about the gospel message and the big story of the Bible

• Children's ministry leaders and educators seeking a practical tool to help children understand and share the gospel, and churches who are utilizing the 3 Circles Method

marketing highlights

• Author and pastor Jimmy Scroggins brings his expertise and passion for sharing the gospel to young readers through this unique Bible storybook

• The Plan, the Fall, and the Very Good News introduces the 3 Circles Method, making it easy for children to understand and share the gospel message while exploring twenty-one engaging Bible stories

• B&H will promote this title through paid social media, targeted emails, and other strategic marketing to the key audience

Interior spread
KIDS BOOKS summer 2024
Kids need HEROES! Introduce the kids in your life to heroes of the faith with these books HEREIAM! series C.S. Lewis price: $20.99 isbn: 9781087759234 Lottie Moon price: $20.99 isbn: 9781087761763 Dietrich Bonhoeffer price: $20.99 isbn: 9781087757742

release date: July 16, 2024

isbn: 9781430096429

format: Printed Hardcover price: $20.99

4–8

page count: 32 size: 8 x 10

spine width: .25" carton qty: 36

rights: Worldwide

bisac: JUV033080/RELIGION/JUVENILE

NONFICTION/Biography & Autobiography/ ReligiousChristian/Early Readers

audience

• Parents of children ages 4 to 8 (and grandparents, caregivers, and other buyers for kids in this age group) and families who love the church and stories of heroes of the faith and childrens’ pastors, family pastors, Christian schools, church libraries and bookstores, and homeschool families

• Followers of Jasmine Holmes who enjoy learning untold stories of Black history

• Previous purchasers of Dietrich Bonhoeffer: The Teacher Who Became a Spy, C. S. Lewis: The Writer Who Found Joy, and Lottie Moon: The Girl Who Reached the World in the Here I Am! biography series for kids

Lulu Fleming

The Doctor Who Shared Jesus JASMINE

Born into slavery in rural Florida, Louisa (Lulu) Fleming might have been the last person anyone expected to grow up and become a doctor. From birth, Lulu was told she wasn’t worthy of dignity or respect because of the color of her skin.

This biographical picture book tells the story of Lulu Fleming, whose grandfather was brought to America from the Congo and enslaved. When Lulu was released from slavery, she discovered that Jesus taught that all people are worthy of respect and dignity. Narrated by a kind and curious cat, readers learn that Lulu became one of the first Black women to attend university in the United States, then decided she wanted to be a missionary to the country where her grandfather had been taken from: the Congo. She served as both a doctor and a teacher in the Congo, speaking against a regime and a culture that devalued people because of the color of their skin. Readers will be inspired by Lulu’s bravery and drive to break barriers so she could love and share Jesus with others.

Lulu Fleming: The Doctor Who Shared Jesus is the fourth book in the Here I Am! biography series for kids ages four to eight, which highlights fascinating and faithful Christians in history. Also available: Dietrich Bonhoeffer: The Teacher Who Became a Spy, C. S. Lewis: The Writer Who Found Joy, and Lottie Moon: The Girl Who Reached the World.

ages 4-8

marketing highlights

• Jasmine L. Holmes is the author of five books including Never Cast Out, Mother to Son, and Carved in Ebony

• This biographical picture book welcomes readers to get to know the first Black missionary teacher and doctor sent to the Congo and to experience her bravery to break barriers so she could love and share Jesus with others

• This is the fourth book in the Here I Am! biography series for kids that highlights fascinating and faithful Christians in history

JASMINE L. HOLMES is the author of Never Cast Out: How the Gospel Puts an End to the Story of Shame, Carved in Ebony: Lessons from the Black Women Who Shape Us and Mother to Son: Letters to a Black Boy on Identity and Hope. She is also a contributing author for World on Fire: Walking in the Wisdom of Christ When Everyone’s Fighting about Everything, Identity Theft: Reclaiming the Truth of Our Identity in Christ, and His Testimonies, My Heritage: Women of Color on the Word of God. She and her husband, Phillip, are parenting their children in Jackson, Mississippi.

KIDS BOOKS summer 2024
Interior spread

release date: January 2, 2024

isbn: 9781430089001

format: Trade Paper price: $13.99

page count: 208 size: 5 x 7

spine width: .40" carton qty: 36

rights: Worldwide

bisac: Juvenile Nonfiction/Religious/Christian/ Devotional & Prayer

Rock-Solid Devotional

100 Days to Know and Trust God’s Truth

God’s truth is rock solid!

In a world that says truth is ever-changing, what are kids supposed to believe? This devotional reminds kids that they can always trust God’s Word to be true.

Through these one hundred short devotions, kids will be challenged as they discover that God’s truth never changes, understand that everyone needs Jesus, and learn to speak the truth in love. Adventure awaits each day as kids explore games, activities, and prayer prompts that encourage readers to believe that what the Bible says is true.

audience

• Churches using Lifeway’s Breaker Rock Beach VBS 2024 will be familiar with the concepts and theme

• One hundred devotions with games, activities, and prayer prompts

• Can be utilized as a standalone devotional for kids

marketing highlights

• Parents of kids ages 6-10 attending Lifeway VBS 2024

• Parents and gift buyers for kids looking for devotionals and activity books they can read on their own

• Children’s pastors and church ministry leaders buying in bulk to gift to their kids

KIDS BOOKS summer 2024
Interior spread

release date: May 7, 2024

isbn: 9781087787602

format: Printed Hardcover price: $20.99

page count: 128 size: 5 x 7

spine width: .47 carton qty: 24

rights: Worldwide

bisac: JNF049120/Juvenile Nonfiction/ Religious/Christian/Devotional & Prayer

ADAM COX has been in serving children’s ministry since 2004 in Kentucky, Georgia, Arkansas, and Texas. He holds a Masters degree from Southwestern Baptist Theological Seminary. Adam currently serves as Minister to Children at Prestonwood Baptist Church North Campus. Adam hopes to set a Christlike example to children and their families as they grow into spiritually thriving individuals. He and his wife Katie have two daughters, Caroline and Catherine.

Never-Ending

52 Devotions About God’s Faithfulness in the Past, Present, and Future ADAM COX

God’s faithfulness never ends! God was faithful to Adam and Eve when He promised someone would come to save His people, He was faithful to the early church when they were persecuted, and He has been faithful ever since. In this 52-week devotional, Adam Cox defines God’s faithfulness as being always good, never-changing, and trustworthy in every situation.

With more than twenty different kids and family leaders from churches across the country, this multi-contributor devotional includes stories of God’s faithfulness from Scripture, stories of His faithfulness from the writers’ childhood, prayer prompts, and reflection questions each week. Kids will learn that the same God who was faithful to the people they know from the Bible is the God who is faithful to them today.

audience

• Children ages 6 to 10 years old and their parents who are seeking a faithbuilding and engaging devotional experience

• Children's ministry leaders looking for a valuable resource to share with young members of their congregation

• Churches whose kid’s ministry leaders wrote these devotions

• Educators and teachers seeking to instill important values and spiritual lessons in their students

marketing highlights

• Dive into the unwavering faithfulness of God with this inspiring 52-week devotional for kids. General Editor, Adam Cox, emphasizes God's unchanging goodness and trustworthiness in every situation

• Featuring stories from more than twenty kids and family ministry leaders across the country, this multi-contributor devotional brings God's faithfulness to life through relatable accounts from Scripture and personal experiences

• Each week includes prayer prompts and reflection questions, helping kids understand that the same faithful God who guided biblical characters is present in their lives today

6-10 KIDS BOOKS summer 2024
Interior spread

TEENS

release date: May 21, 2024

isbn: 9781430093503

format: Printed Hardcover price: $20.99

13-18

page count: 224 size: 6 x 8

spine width: 1.61" carton qty: 24

rights: Worldwide

bisac: JNF049120/Juvenile Nonfiction/Religious/ Christian/Devotional & Prayer

MISSIE BRANCH serves as vice president of Community Engagement for Life Collective, Inc. She is a graduate of Southeastern Seminary with a master's in ethics, theology, and culture. Missie is married to Duce, and together they have four children. She enjoys reading, music, documentaries, walking, and good coffee. She is passionate about discipleship, theology, and ethics. Missie is a contributing author to The Whole Woman: Ministering to Her Heart, Soul, Mind, and Strength and Women & Work: Bearing God’s Image and Joining in His Mission Through Our Work. She is also the cohost of the Women & Work Podcast and is currently serving as a trustee for Charleston Southern University as well as the Chairman of the Board of Trustees at Lifeway Christian Resources.

Guided Prayer Journal for Teen Girls

Teen girls might sometimes think of prayer as challenging or unnecessary. But author Missie Branch wants them to see prayer as a gift—a powerful tool that connects them to a loving and listening God.

This guided prayer journal offers a way for teen girls to grow and welcome a rich practice of prayer. Each of the 100 entries offers:

•A short devotional thought with Scripture reference

•Engaging prayer prompts

•Journaling and response space

As they read, pray, and write, teen girls will better understand the gift and value of prayer. They will realize that God cares about all the details of their lives—from the giddy moments of excitement to the darkest moments of fear and regret.

God is prepping young women for the next season of their lives, and prayer is one of the tools He will use to grow them and fill them. Let the Guided Prayer Journal for Teen Girls show them that God is listening.

audience

• Teen girls ages 13 to 18 who seek to grow in their faith and in their prayer life

• Purchasers of books and devotionals for teen girls such as Prayer Journal for Teen Girls by Shannon Roberts, A Guided Prayer Journey by Germaine Copeland, 5-Minute Devotions for Teens by Laura L. Smith, and For When I’m in My Feels: A Prayer and Reflections Devotional by Mac Bridges

• Group leaders of teen girls, youth pastors, girls' ministers, and small group leaders looking for devotional resources for their students

marketing highlights

• Missie Branch is a speaker, author, and respected voice in the SBC and is passionate about teen girls seeing themselves as theologians and disciples

• This prayer journal will help teen girls grow a practice of prayer and connect to God as they read, pray, and journal

• B&H will promote this title through paid social media, targeted emails, and other strategic marketing to the key audience

Interior spread

KIDS BOOKS summer 2024
42%

GentleThoughtsAfterLoss

WeAllNeedEncouragingWords

PubDate:6/11/2024

Author:

Artist:

ISBN:

Price:

Category:

Binding/Size:

Pages/CLQ:

Author/ArtistBios:

Carol Hamblet Adams

Bobbie Wilkinson

9780736989015

$20.99

Comfort and Grief

Hardcover – 5 x 7

96 pp – 64

CarolHambletAdamsisamotivationalspeakerandthe authorofsixbooks,includingthebelovedbestsellerMy BeautifulBrokenShell.Carol'slifecentersaroundherfaith, herfamily,herfriends,andGod'smagnificentseashore.She hasspentmanyyearsinthegriefministry.Sheistheproud momofthreechildrenandtheproudgrammaofsix grandchildren.Carolcanbereachedonthebeachorat carolhambletadams@comcast.net.

BobbieWilkinsonisaChristianwriter,artist,andmusician. Sheistheproudmotherofthreedaughtersandtheblessed grammaoffivegrandchildren.Sheandherhusband,Tom, alongwiththeirfurrycompanion,Shelly,liveinaselfrenovatedbarninthenorthernVirginiacountryside.When Bobbiegrowsup,shewantstoliveinasmallcottagebythe sea.Shecanbereachedatbobbiewilkinson1@gmail.com.

TheseshortreflectionsandScriptureverses,coupledwithbeautifulartworkthroughout,give grievingreadersthepeaceandhopetheyneed,whenevertheyneeditmost.

Whateveryourlossmaybe—alovedone,yourhealth,yourjob,yoursecurity,yourfreedom,oryour spirit—youneedtoknowthatJesusisrighttherewithyou.ExperienceHispresenceasyoumeditateon selectScriptureversesandencouragingaffirmations,suchas:

IwillgetthroughthiswithGod’shelp.

IamstrongerthanIthink.

IwillonlydowhatIamcomfortabledoingandwhatIhavetheenergyfor.

GentleThoughtsAfterLossalsomakesalovingandthoughtfulgiftforsomeone youknowwho’sgrieving.

Maythisbookbringyoucomfortinsimple,smallwaysandremindyouthatare notalone.

4-ColorInterior

KeySellingPoints:

•Thesesimple,easy-to-understand,encouragingwordsandScriptures,promisingthe presenceofJesus,offermessagesofpeace,comfort,andhope.

•Thecontentisapplicabletomanytypesofloss.

•ThecharmingwatercolorartisbyCarol'stwinsister,BobbieWilkinson.

•Thisthoughtfulbookispricedforimpulsepurchaseandaddressesanevergreenfeltneed.

Over280,000 copiessold!

978073690870

$20.99

Spring/Summer2024

GentleThoughtsAfterLoss

Interiors

Harvest House Publishers 9780736990059

Pub Date: 7/30/24

$12.99 USD

Trade Paperback

160 Pages

Carton Qty: 76

Religion / Christian Living

REL012160

7 in H | 5 in W

17.99

Survival Guide to Motherhood

The Parenting Pep Talk Every Christian Mom Needs

The Survival Guide to Motherhood provides you with wisdom, encouragement, and companionship on your mothering journey. In this uplifting guide, you will encounter sage biblical insights into many different aspects of motherhood while being to encouraged to invite God into every life circumstance.

Summary

Faith-Based Wisdom for Joy-Filled Parenting

While most moms share the desire to love their kids and parent them well, you might be surprised to discover just how many of them feel as though they are messing it up!

An experienced mom of grown children, Karen Stubbs wrote The Survival Guide to Motherhood to provide you with wisdom, encouragement, and companionship on your mothering journey. As you engage with a unique aspect of mothering in each chapter, you will be

equipped with new tools for your parenting tool belt, such as managing your home, connecting with your spouse, and disciplining your child

encouraged to know you’re never alone as you encounter relatable stories and affirmations of your boundless value before God

empowered with the joy of the Lord as you learn to trust Him always

In this uplifting guide, you will discover sage counsel and gentle reminders to invite God into every life circumstance. As you are freed from the prison of perfection and the fear of failure, you will believe that not only can you survive motherhood—you may even thrive!

Harvest House Publishers

9780736990035

Pub Date: 5/7/24

$17.99 USD

Trade Paperback

288 Pages

Carton Qty: 40

Religion / Christian Living

REL012060

8.5 in H | 5.5 in W

24.99

The Man Code

12 Priorities Every Man Needs to Know

Packed with useful insights, authentic stories, and engaging study questions, The Man Code distills the essentials of biblical masculinity into 12 key action points, helping you apply the Bible's transformative teaching to every aspect of your life.

Summary

A Bold Plan of Action for Godly Men

Our world needs men—not just any men, but the kind who understand and embrace the unique calling God has given them as men, husbands, fathers, and leaders.

Scripture provides a code of godly manhood that emboldens you to become all God designed you to be. In The Man Code, pastor Mark Henry distills the essentials of biblical masculinity into 12 key action points, helping you apply the Bible's transformative teaching to every aspect of your life. In this practical guide, you will be

encouraged toward a greater love for Christ and commitment to living out God’s priorities empowered to build your livelihood on the foundation of God's Word enabled to experience the real and lasting fulfillment that comes from living as a godly man equipped to share a clear, biblical ethic of masculinity with the next generation

Packed with useful insights, authentic stories, and engaging study questions, The Man Code will inspire you to embrace your true calling and serve God with courage, conviction, and hope.

HARVEST HOUSE PUBLISHERS harvest house interiors b - January 2024 Page 3

Harvest House Publishers 9780736989886

Pub Date: 7/9/24

$14.99 USD

Imitation Leather

192 Pages

Carton Qty: 52

Religion / Christian Living

REL012060

7 in H | 5 in W

20.99

Five-Minute Devotions for Men (Now in Imitation Leather)

This collection of brief, powerful meditations provides men with daily guidance for shaping godly character and Scriptures for strength and wisdom.

Summary

Daily Strength for Men

This collection of brief, powerful devotions from bestselling author Bob Barnes provides you wise guidance for shaping godly character. Topics such as being dependable, trusting in God’s provision, and choosing to receive and give grace are just what you need for starting or ending the day well, especially amid hectic schedules and difficult life moments.

Each entry contains a short devotion, practical action step, and a prayer. Quick and compelling, these engaging words of encouragement are perfect for refreshing times of connecting with God, who wants the best for you every day.

Harvest House Publishers 9780736984492

Pub Date: 5/7/24

$14.99 USD

Trade Paperback

192 Pages

Carton Qty: 64

Religion / Christian Living

REL012080

Series: The Names of God

Series

8.5 in H | 5.5 in W

20.99

Praying Through the Names of the Holy Spirit

In this powerful collection of 60 devotional prayers, Dr. Tony Evans helps transform your prayer life by acquainting you with the Spirit’s unique identities found in Scripture. These prayers will help you abide in the Holy Spirit’s character as you grow in intimacy with God.

Summary

Accessing the Power of the Holy Spirit—In Us, Through Us, and for Us

Many believers long for a clearer understanding of the Holy Spirit and the role He plays in our lives. When you pray through the Spirit’s names, you’ll discover that not only is He real, but He is also ready to minister to you in many meaningful ways.

In this powerful collection of 60 devotional prayers, Dr. Tony Evans helps transform your prayer life by acquainting you with many of the Spirit’s unique identities. Helper, Intercessor, Living Water—each name or work of the Spirit inspires a unique prayer that invites you into a deeper connection with and dependence upon Him.

When we come to know the Spirit and what He does for us, we can better comprehend the myriad ways God reveals Himself to us. Whether you read out loud or silently, these heartfelt prayers will help you abide in the Holy Spirit’s character as you grow in intimacy with God.

HARVEST HOUSE PUBLISHERS harvest house interiors b - January 2024 Page 4

BIBLEINFOGRAPHICSFORLITTLEONES

TheMostMiraculousMessiah

All About the Miracles of Jesus!

PubDate:8/6/2024

Author:

ISBN:

Price:

Category:

Binding/Size:

Pages/CLQ:

AuthorBio:

Harvest House Publishers

9780736986816

$13.99

Board Book

Board Book – 7 x 7

20 pp – 40

Since1974HarvestHousePublishershasbeen impactingtheheartsofpeoplewithbooksthat pointtowardJesus.Thatfocuscontinueswith fresh,innovativeproductsthatinspirecreativity, encouragefamilies,andenrichlives.Withan emphasisonaddressingthespiritualandpractical needsofmen,women,andchildren,HarvestHouse seekstoserveGodandthosewhoneedHim throughthebooksitpublishes.

Jesus performed many miracles through his life and resurrection. The Most Miraculous Messiah teaches little ones about these astonishing acts with fascinating faith-building facts as part of the craze-mazing Bible Infographics for Little Ones series.

Witness your little one’s amazement as they learn about Jesus’s multitude of memorable miracles. Learn about feats such as the feeding of thousands, healing many, walking on water, and his own resurrection. Page by page, as his miracles are rhythmically retold, kids receive calming reassurance that Jesus really is the Messiah.

Packed with fascinating faith-building facts, poetic prose, and illuminating illustrations, this uniquely creative board book will keep little ones in awe of the miraculous Messiah with each reading. Look for more Bible Infographics for Little Ones brand books at bibleinfographics.com.

4-Color Interior, Ages 0-4

KeySellingPoints:

Previous:

•Thisfull-colorboardbookfeaturesJesus'smostincrediblemiraclestoldinrhymealongwith interestingfactsanddetailsaboutthestory.

•ThisisthethirdtitleintheseriesofboardbooksfromthebestsellingBibleInfographicsforKidsline, illustratingJesusasGod,Jesusasman,andJesusasMessiah.

•Whilethisbookisaimedatyoungchildren,thecleverinformationandillustrationswillengageand interestolderkidsandevenparents!

Spring/Summer2024

TheMostMiraculousMessiah Interiors

MyDaddy’sHero

AStoryAboutJesus,TheUltimateHero

PubDate:5/7/2024

Author:

Artist:

ISBN:

Price:

Category:

Binding/Size:

Pages/CLQ:

Jerrad Lopes

Adam Grason

9780736987769

$24.99

Children’s Picture Book

Hardcover – 8 ½ x 10 ½

32 pp – 24

AuthorBio:

JerradLopesisanauthor,aChristianpastor,and thefounderofDadTired.com,anonprofitministry focusedonequippingmentoleadtheirfamilies well.HehoststheweeklyTheDadTiredpodcast, listenedtobyhundredsofthousandsofmen aroundtheworld.HisbooksincludeDadTired, TheDadTiredQ&AMixtape,andStopBehaving.He andhiswife,Leila,liveinSouthCarolinawiththeir fourchildren..

Thisone-of-a-kindpicturebookpointschildrentoJesus,thetrueheroofeveryfamily,and encouragesdadsintheirroleasaspiritualleaderintheirhome.

Youngchildrenoftenseetheirdaddyasalarger-than-lifefigurewhocanfixeverythingfrombroken toystoscrapedknees.ButbehindeverysuperdadisasupernaturalSaviorwhoshapesordinarymen intoextraordinaryfathers.

ThissweetandsimplestoryhelpschildrenunderstandJesus’sroleasthetrueheadofthefamilyand learntotrustHimwiththeirhearts,justliketheywouldtrusttheirowndad.

Forfathers,MyDaddy’sHeroisapowerfulreminderoftheirmostimportantrole—toleadtheirchildren toJesus.

KeySellingPoints:

•Inthisdelightfulchildren'spicturebook,fathersareremindedthattheloveofGodisasmuchforthemasit isfortheirchildren.

•Childrenages4to8willreceivepracticaltoolstohelpthemdeveloptheirfaith.

•AuthorJerradLopes,DadTiredandLovingIt,offersanall-too-rarepositiveportrayalofafatherinapicture book.

4-ColorInterior,Ages4-8
Spring/Summer2024

MyDaddy’sHero

SampleArtwork

TheLumpy,BumpyPumpkin

AStoryAboutFindingYourPerfectPurpose

PubDate:8/6/2024

Author & Illustrator:

ISBN:

Price:

Category:

Binding/Size:

Pages/CLQ:

Author/IllustratorBio:

Sydney Hanson

9780736987349

$12.49

Children’s Picture Book Trade – 9 x 9

24 pp – 60

SydneyHansonwasraisedinMinnesota alongsidenumerouspetsandbrothers.Her illustrationsandpaintingsstillreflectthese earlyadventuresandaremarkedbyalovefor animalsandthenaturalworld.Sydneyhas workedforseveralmajoranimationshops, includingNickelodeonandDisneyInteractive.

Sydneyhasillustratedseveralchildren’sbooks, includingQuinn’sPromiseRock,QuinnSays Goodbye,andAmazingGrace

This is not a Halloween book. Godly principles throughout.

Thissimple,sweetstoryaboutapumpkinnoonepickedteacheschildrenanimportantlesson aboutfindingtheirtruepurposeinlife.

Formanyfamilies,atriptothefarmisabelovedOctobertradition.Asthousandsofwide-eyed childrenandtheirparentscombthroughthepatchtofindtheperfectfalldecorationsfortheir doorstepsandhomes,therearealwayssomepumpkinsthatgetpassedby.

Thisisthestoryofonesuchsquash—toolumpy,toobumpy,toomushy,andtooyellow-greenfor anyonetowant.Asautumngiveswaytowinter,willTheLumpy,BumpyPumpkinfinallyfinditstrue purpose?

Thischarmingtaleissuretobecomeaseasonalstory-timefavoriteandmakesafun,fallpresentfor yourlittlepumpkins.

4-ColorInterior,Ages4-8

KeySellingPoints:

• Pumpkin fall books sell well every year, and the bestsellers have been around for years (if not decades).

• This book is fall themed as opposed to Halloween themed, making it appealing to all families.

Spring/Summer2024

TheLumpy,BumpyPumpkin

Interiors

Eric’sGreatestRace

TheInspiringTrueStoryofEricLiddell-Athlete, Missionary,Prisoner

PubDate:6/4/2024

Author:

Artist:

ISBN:

Price:

Category:

Binding/Size:

Pages/CLQ:

AuthorBio:

Tim Challies

Paul Mignard

9780736984546

$27.49

Children’s Nonfiction

Hardcover – 6 x 8

192 pp – 36

TimChalliesisaChristian,ahusbandtoAileen,anda fathertotwodaughterswhoareyoungadultsandone sonwhoiswaitingforhiminheaven.Heworshipsand servesasanelderatGraceFellowshipChurchin Toronto,Ontario.Heisablogger,abookreviewer,and theauthorofanumberofpopularbooks. www.challies.com

PaulMignardisanillustratorandwebdeveloperwhose lovefordrawingbeganasacreativewaytopaycloser attentioninchurch.Pauluseshistalenttobemore engagedinhisfaith.HelivesinVirginiawithhiswife andsons.

This engaging, fully illustrated book tells young readers the story of famous Olympian Eric Liddell, whose steadfast courage and commitment to Christ has inspired generations of believers.

Athlete. Missionary. Prisoner.

Eric Liddell’s life was a series of remarkable twists and turns, from his refusal to run on a Sunday in the 1924 Olympics (as depicted in the Oscar-winning film Chariots of Fire) to his extensive missionary work, and finally to his imprisonment during World War II. Through it all, Eric never abandoned his faith in God.

Written and illustrated as a graphic novel, Eric’s Greatest Race tells Eric Liddell’s entire life story and educates young readers about important historical events and concepts along the way. Children will encounter a real-life hero whose incredible impact on Christianity and the world lives on today.

BW Line Drawings, Ages 8-12

KeySellingPoints:

•ThisgraphicnoveloffersavisuallygrippingstoryaboutthefamousOlympianandmissionaryEricLiddell.

•AuthorTimChalliesisknownforhisdeepbutaccessiblepresentationsofChristianhistoryandtheology.

•Nonfictiongraphicnovelsareanincreasinglypopulargenrefortweenreaders.

•Writtenandillustratedinapopularcomicstyle.

Spring/Summer2024

Eric’sGreatestRace

SampleDrawings

WhenIAmAfraid

DISCOVER4YOURSELFINDUCTIVEBIBLESTUDIESFORKIDS

Over1,000,000

PubDate:7/2/2024

Authors:

ISBN:

Price:

Category:

Binding/Size:

Pages/CLQ:

AuthorBios:

Kay Arthur & Janna Arndt

9780736988728

$20.99

Children’s Bible Studies

Trade – 7 x 9

176 pp – 80

JannaArndt,coauthoroftheDiscover4Yourself®series, includingHowToStudyYourBibleForKids,WrongWay, Jonah!,andBoy,HaveIGotProblems!,isaBibleteacher andchildren'strainerforPreceptMinistriesInternational, aministrycommittedtoteachingpeopleofallageshowto studytheBibleforthemselves.Jannaconductsworkshops tohelppeopleusetheinteractiveDiscover4Yourself® BibleStudiesinSundayschool,homeschoolenvironments, andChristianschools.Janna’sheartisforchildrentoknow andloveGod'sWord.

KayArthurisafour-timeGoldMedallionaward–winning author,memberoftheNationalReligiousBroadcasters HallofFame,andinternationallybelovedBibleteacher. SheisthecofounderofPreceptMinistriesInternational andthecoauthorofmanybestsellingbooks,including HowtoStudyYourBibleforKids,JesusintheSpotlight, andWrongWay,Jonah!

ThelatestadditiontothebestsellingDiscover4Yourself®series(overone-millioncopiessold)of Biblestudiesformiddle-gradereadershelpskidsconquertheirfears.

Overcomingfearisacommonhumanchallenge,butchildrencanhaveanespeciallyhardtimeknowing whattodowhentheyfeelafraid.

TrustedBibleteachersJannaArndtandKayArthurinvitechildren(ages8to12)tojointhemforan engagingBibleadventureatCampBraveheart,wherekidswilllearn:

•WHYtheyareafraid

•WHATtodoWHENtheyareafraid

•HOWtheycantrustGod

•WHOtheyshouldfear

•HOWtheycanbestrongandcourageous

•WHOistheirhope

UsingthepopularandinnovativeinductiveBiblestudymethodcreatedbyKayArthur,kidswilltakea deepdiveintoGod’sWordtodiscoverforthemselveshowtheycanovercomefearandlearntotrustto Godinanysituation.

LineDrawings,Ages8-12

*OriginallywrittenforChildrenintheUkraine,noweditedforallchildren.

Spring/Summer2024
copiesofthisseries sold!

WhenIAmAfraid

SampleDrawings

HowtoBeaKingdomNinja

AFullyIllustratedGuidetoMyAwesomeWorld

PubDate:7/2/2024

Author:

Artist:

ISBN:

Price:

Category:

Binding/Size:

Pages/CLQ:

Daniel Gil

Brad Smith

9780736987165

$25.99

Children’s Nonfiction

Hardcover – 6 x 8

128 pp – 80

AuthorBio:

DanielGilisthe2020AmericanNinjaWarriorChampion andeight-timenationalfinalist.Heisalsoamotivational speaker,aworshipleader,aninjaOCRtrainer,andthe authorofKingdomNinja.Heandhiswife,Abby,livein Houston,Texas.

Young fans of American Ninja Warrior and Daniel Gil, the Kingdom Ninja, will love this fully illustrated look into Daniel’s awesome world. Learn what it takes to become a ninja warrior!

American Ninja Warrior legend Daniel Gil has thrilled viewers of all ages with his incredible feats of strength, speed, and agility on the hit TV show. Now Daniel gives kids a glimpse of his everyday life in this fun and imaginative book.

In a kid-friendly comic style, aspiring ninja warriors will learn more about Daniel’s incredible rise from young upstart to 2020 American Ninja Warrior champion. Relive some of his most exciting moments on the show and discover the disciplines that have helped Daniel stay mentally, physically, and spiritually fit.

How to Be a Kingdom Ninja will inspire young readers to pursue their dreams and live healthy and happy lives.

B&W Illustrations, Ages 8-12

KeySellingPoints:

•Thisfully-illustratedgraphicnovelgiveskidsaninsidelookintothelifeofDanielGil,oneofthemost popularAmericanNinjaWarriors.

•Kidswillbeencouragedtopursueahealthylifestyle,beinspiredtopursuetheirpassions, andencouragedintheirfaith.

•Nonfictiongraphicnovelsareanincreasinglypopulargenrefortweenreaders.

Spring/Summer2024

HowtoBeaKingdomNinja

SampleDrawings

The Sapphire Sword

PubDate:8/6/2024

Author:

ISBN:

Price:

Category:

Binding/Size:

Pages/CLQ:

AuthorBio:

Robert Fuller

9780736988254

$20.99

Children’s Fiction

Trade – 5 ½ x 8 ½

320 pp – 40

RobertL.Fullerisawriterandfilmproducer residinginthewindsweptlandsofcentralTexas. HisbooksincludeIntheBellyoftheEarthandIn theDungeonoftheHeart.Robertenjoyslong, solitarystrollsinthewoods,readingtohisthree precociouschildren,culinaryadventureswithhis wife,andtryingtogethisstubborndogtocome whenbeckoned.

To save the world from certain destruction, 3 siblings and their shapeshifting alien guide embark on an out-of-this-world adventure in search of an ancient, all-powerful weapon.

Slugger, Flint, and Scout are always out exploring the mountains of New Mexico near their home. When a cherry-picking expedition puts them in the path of a peculiar pooch in peril, the three siblings have no idea what unstoppable calamity has just been set in motion.

The dog they call Robin Hood isn’t what he appears to be. And neither are the O’Ryan kids. In fact, they’re not even kids! Well, not human ones, at least.

Together, the three unlikely heroes and their trusty “canine” companion must journey the cosmos to snatch Earth back from the clutches of catastrophic evil. And they might just be successful. If only they could find that legendary sword . . .

The Sapphire Sword is book one in The Sapphire Saga trilogy (to be followed by The Sapphire Song and The Sapphire Savior) of suspenseful sci-fi novels for middle-grade readers. This gripping series teaches kids the value of family, forgiveness, and faith in the face of impossible odds.

Ages 8-12

***
THE SAPPHIRE SAGA #1
Spring/Summer2024
42%

Barbour Books

9781636098593

Pub Date: 6/1/24

$9.99 USD

Trade Paperback

224 Pages

Carton Qty: 48

Games & Activities / Crosswords

GAM003000

9 in H | 6 in W

13.99

Calming Bible Crosswords

99 Simple, Relaxing Puzzles

Compiled by Barbour Staff

Summary

In a stressful world, here’s the perfect way to unwind!

ACTIVITY BOOKS

Calming Bible Crosswords is a brand-new collection featuring smaller puzzles with more recognizable, less obscure answers.

The 99 themed puzzles each include 16 to 22 words from the beloved King James Version, with clues sometimes featuring a clever or humorous twist.

Easier to complete and focused completely on God’s Word, these puzzles promise relaxing fun for players of all ages and backgrounds.

Clues are accompanied by Bible references, answers are provided, and the larger type and puzzle grids are easy on the eyes.

Chill a bit with Calming Bible Crosswords!

Barbour Books

9781636099019

Pub Date: 8/1/24

$7.99 USD

Paperback

112 Pages

Carton Qty: 48

Games & Activities / Word &

Word Search

GAM014000

11 in H | 8.5 in W

10.99

Bible Memory Verse Challenge Word Searches Large Print

Compiled by Barbour Staff

Summary

Large Print Puzzles That Will Help Strengthen Your Scripture Memory Muscles

Bible Memory Verse Challenge Word Searches is an exciting Bible word search game with a twist! Dozens of large print word search puzzles feature Bible clues given in the form of scripture selections with missing words. . .then you have to figure out what's missing in order to discover the words you need to search for in the large 15x15 puzzle grid. Scripture hints are provided along with the clues in case you need help completing the scripture selections. A complete easy-to-read answer key is provided for each puzzle. Bible Memory Verse Challenge Word Searches is a fun way to deepen your knowledge of God’s Word!

BARBOUR BOOKS barbour a1 - January 2024 Page 5

A Manageable Plan for Biblical Understanding

• Powerful Study Bible Encourages Scriptural Literacy

• Two-Year Reading Plan Takes About 10 Minutes/Day; Notes Explain Context, Terms, and Themes

• Features 10.2-Point Type Over 10.8 Leading, Single-Column Setting

• Features Words of Christ in Red, Presentation Page, and Ribbon Marker

Surveys have shown that two-thirds of Americans are interested in the Bible (Barna), but less than one-fourth have a systematic plan for reading scripture (LifeWay). The Holy Bible KJV: Featuring an Easy-to-Follow Two-Year Study Plan accommodates both groups with an easy-to-complete reading plan (just 10 minutes a day over two years) along with notes that provide context for the readings, explain confusing ideas and terms, and elaborate on scripture’s larger themes—including God’s love and plan of salvation. While helpful to honest seekers, this Bible also serves Christians who desire greater biblical knowledge—it breaks a daunting job into very manageable pieces, providing needed clarity along the way. NOTES

June 2024

THE HOLY BIBLE KJV: FEATURING A TWO-YEAR STUDY PLAN

King James Version

Cinnamon & Gold 9781636098500

Magenta Florals 9781636098494

$58.99 each

FLEX 6.6875" x 9" 1224 pages

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
TYPE SIZE: APPROXIMATELY 10.2 POINT SCRIPTURE VERSION(S): KJV
................................................................................................................................ ................................................................................................................................

• 101 Devotions That Explain and Encourage Prayer

• Easy-to-Read, Bible-Based Entries Are Appropriate for Men & Women of All Ages and Backgrounds

• Devotions Reflect on Specific Bible Promises Drawn from Barbour’s Simplified KJV

• Features Two-Color Interior and Ribbon Marker

Featuring 101 devotional readings that unpack scriptural teachings on prayer, this book will help men & women discover the secret of a fulfilling, abundant prayer life. Many Christians know that prayer is important— essential, really—but still struggle to pray. And yet, God wants to hear from His children. Encouraging entries—with titles such as “Prayer Can Be Learned,” “Prayer Gets God’s Attention,” “Prayer Blesses Others,” and “Prayer Is the Answer to What You’re Seeking”—present both sound biblical teaching and a spur to put prayer into practice. Readers who make prayer a priority will find themselves in a deeper, more intimate relationship with God.

NOTES

May 2024

101 DEVOTIONS ON POWERFUL PRAYER

BISAC: Religion / Christian Life / Devotion

For Men

9781636098364

For Women

9781636098357

$20.99 each

Hardcover

5" x 7" / 208 pages

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
................................................................................................................................ ................................................................................................................................
SCRIPTURE VERSION(S): SKJV

Barbour Books

9781636098609

Pub Date: 6/1/24

$9.99 USD

Spiral Bound – Wire-O

192 Pages

Carton Qty: 48

Religion / Biblical Studies

REL006000

Series: The Bible Study

Collective

8 in H | 5.5 in W

13.99

Psalms

An All-in-One Study on God's Song Book

Summary

30 studies on Psalms - with Scripture text, outlines, notes & writing space.

Here’s the tool you need to study scripture on your own.

Bible study always takes effort, but this book simplifies the process. Here, in one handy spiral-bound volume, are everything you need to get started:

Bible text study outlines explanatory notes ample writing space

Featuring 30 studies highlighting key Psalms, this book walks you through the “inductive” study process of Observation, Interpretation, and Application. And it also asks thoughtful questions unique to each study.

Explanatory notes, adapted from Barbour’s popular KJV Study Bible, aid your understanding.

With all the necessary tools in a single package and highlighting the most important passages of scripture, Psalms: An All-in-One Study on God's Song Book is a powerful resource both for beginners and long-time Bible students.

Barbour Books

9781636098265

Pub Date: 5/1/24

$19.99 USD

Paperback

384 Pages

Carton Qty: 36

Religion / Christian Living

REL012020

7 in H | 5 in W

27.49

Daily Devotions to Conquer Anxiety and Depression

365 Days of Comforting Inspiration for Women

Compiled by Barbour Staff

Summary

Where should you turn when you're struggling with anxiety and depression? . . .

To God and His Word!

DEVOS

Each of the meditations and prayer starters in this reassuring daily devotional will remind you that you're never alone in your struggles.

With each turn of the page, you'll encounter a memorable scripture, a truth-filled reading, and a prayer that promise to encourage, inspire, and strengthen your faith.

As you read every heartfelt word, trust in and lean on the one who "is with you in this" (1 Chronicles 28:20). . .the one who's with you in all things.

With the heavenly Creator by your side, you'll be well on your way to conquering your anxiety and depression.

BARBOUR BOOKS barbour b1 - January 2024 Page 2

Barbour Books

9781636098463

Pub Date: 6/1/24

$12.99 USD

Paperback

192 Pages

Carton Qty: 36 Religion / Christian Living

REL012020

7 in H | 5.5 in W

Bedtime Devotions for Peaceful Sleep

6 Months of Daily Blessings for Women

Compiled by Barbour Staff, Valorie Quesenberry

Summary

200 Nighttime Devotions for Your Heart!

Inspired by Proverbs 3:24 (NIV): "When you lie down, you will not be afraid; when you lie down, your sleep will be sweet," this delightful nighttime devotional will encourage your heart. Nearly 200 devotions will comfort and refresh your weary spirit as you unwind at the end of your busy day. You'll relax as you spend much-needed quiet time. . .to reflect on and end your day in peaceful conversation with the heavenly Father.

It's a beautiful way to a peaceful night's sleep!

Barbour Books

9781636098258

Pub Date: 5/1/24

$12.99 USD

Paperback

192 Pages

Carton Qty: 36

Religion / Christian Living

REL012020

7 in H | 5.5 in W

Grace, Not Perfection

Encouraging Devotions for Women

Summary

Let God’s Grace Renew Your Heart

Here is a delightful women’s devotional that reminds Christian women of all ages that God provides daily grace to His beloved daughters. Thoughtful readings will speak to your heart, and lovely prayers, memorable quotations, and scripture passages add to the rich spiritual depth of the book. It’s the perfect book to give as a gift or for personal quiet time.

BARBOUR BOOKS barbour b1 - January 2024 Page 3
17.99 17.99

Barbour Books

9781636098456

Pub Date: 6/1/24

$14.99 USD

Imitation Leather

224 Pages

Carton Qty: 18

Religion / Christian Living

REL012020

7 in H | 5 in W

20.99

Joy in the Morning Devotional Inspiration for Women

Summary

Joy in the Morning is designed to enhance your spiritual journey.

Featuring 200 biblically based meditations designed to enhance your positive outlook, Joy in the Morning offers a powerful blend of inspiration, encouragement, and motivation no matter your age or stage of life.

Touching on topics like beauty, blessings, family, faith, patience, prayer, relationships, rest, and more, each refreshing reading will draw you ever closer to your heavenly Father as you meditate on each truth-filled page and open your heart and mind to God’s Word.

Barbour Books

9781636098449

Pub Date: 6/1/24

$14.99 USD

Hardcover

224 Pages

Carton Qty: 18

Religion / Christian Living

REL012020

7 in H | 5 in W

20.99

The Power of One Prayer Devotional Inspiration for Women

Summary

If you've experienced the power of prayer. . .you know that just one single little prayer goes a very, very long way. . .resulting in a bigger, bolder faith!

You're invited to grow your faith alongside these 200-plus prayer-themed devotions, where you'll be challenged and inspired to pray—every day—with more courage, more love, more hope, more joy, more patience, more trust. . .and all of your heart.

With each turn of the page, you'll be drawn closer to the heavenly Father as you meditate on each truth-filled devotion and open your heart and mind to His very best for you!

BARBOUR BOOKS barbour b1 - January 2024 Page 4

Barbour Books

9781636098753

Pub Date: 7/1/24

$9.99 USD

Hardcover

192 Pages

Carton Qty: 48

Religion / Christian Living

REL012020

6.5 in H | 4 in W

13.99

The 30-Day Stress Detox Devotional

A Faith-Building Prayer Plan for Women

Summary

Simple, Guided Encouragement Will Help You Experience God's Peace While Detoxing from Daily Stress

The 30-Day Stress Detox Devotional is the perfect place to begin a journey toward a dynamic, peaceful prayer life. This book provides a month’s worth of specific, daily prayer devotions that will draw you closer to your Father God through meaningful conversation. Each day includes a devotion, scripture, questions for consideration, and prayer starters for morning, noon, and night.

These 30 unique days that will help you detox from life's daily stresses—by focusing on themes like

Comfort God's Promises

Courage Contentment and many more!

Barbour Books

9781636098470

Pub Date: 6/1/24

$14.99 USD

Paperback

192 Pages

Carton Qty: 28

Religion / Christian Living

REL012020

9.6 in H | 7.3 in W

20.99

Large Print Devotions: 90 Wisdom-Filled Readings for Women

Summary

Discover True Wisdom Found in God's Word

This large print devotional collection is designed to draw you closer to your heavenly Father’s heart. Featuring 90 inspiring readings combined with scripture and powerful prayers, this lovely book will provide both encouragement and Bible wisdom, as you come to know just how deeply and tenderly God loves you. Here you'll find your faith journey enhanced and strengthened as you experience an intimate connection with the Master Creator.

BARBOUR BOOKS barbour b1 - January 2024 Page 5

Barbour Books 9781636099002

Pub Date: 8/1/24

$19.99 USD

Paperback

384 Pages

Carton Qty: 18

Religion / Christian Living

REL012020

8 in H | 6 in W

27.49

365 Bible Affirmations for Women

Daily Devotions for Morning and Evening

Compiled by Barbour Staff

Summary

DEVO PRAYERS

Begin and End Every Day with a Refreshing Blend of Biblical Truth and Encouragement!

This lovely daily devotional features a positive, uplifting message from God's Word for every morning and evening. These just-right-sized inspirational readings focus on uplifting topics like Faith, Prayer, Encouragement, Love, Joy, and more—and each will speak to your heart, drawing you ever closer to your heavenly Father. As you spend daily quiet time in prayer and study, you’ll experience a refreshing blend of biblical truth and encouragement that will affirm you as the beautiful creation God made you to be!

Barbour Books 9781636098203

Pub Date: 5/1/24

$12.99 USD

Paperback

192 Pages

Carton Qty: 36

Religion / Christian Living

REL012020

7 in H | 5.5 in W

17.99

Pray and Never Give Up Devotions and Prayers for Women

Summary

Blessings Abound for Women Who Pray Persistently

This lovely devotional for women is a beautiful reminder that Jesus tells us to pray and don't give up (Luke 18:1). Each page features an encouraging devotional reading rooted in biblical truth and a heartfelt prayer to help you begin your daily quiet time with the heavenly Father. You will discover all the ways God blesses you every single day as you grow closer to Him and wrap your soul in His unconditional love. This delightful package is a great gift for women of all ages!

BARBOUR BOOKS barbour b1 - January 2024 Page 6

Barbour Books

9781636099033

Pub Date: 8/1/24

$14.99 USD

Paperback

192 Pages

Carton Qty: 28

Religion / Christian Living

REL012020

9.6 in H | 7.3 in W

20.99

A Mustard Seed Faith Large Print

Devotions and Prayers for Women

Compiled by Barbour Staff

Summary

Tiny Faith Can Move Mountains!

Want to increase your faith? . . .This beautiful large print devotional offers just the encouragement, inspiration, and biblical truth you need.

180 full-length devotional readings touch on topics important to you, including:

Prayer

God's faithfulness

God's love

Troubles

Uncertainty

Anxiety

Doubt Trust

And more!

This lovely package will encourage you to bloom and bask in the light of the heavenly Creator, making your quiet time with Him more precious and purposeful.

Barbour Books

9781636096964

Pub Date: 6/1/24

$24.99 USD

Hardcover

384 Pages

Carton Qty: 18

Religion / Christian Living

REL012080

Series: Prayers and Promises

8 in H | 6 in W

34.49

365 Prayers and Promises for Women

Compiled by Barbour Staff

Summary

Daily Devotional Prayers and Bible Promises—Just for You!

Experience a deeper and more meaningful connection to your heavenly Father with 365 Prayers and Promises for Women. Featuring 365 inspiring prayers that touch on topics important to your heart—including beauty, children, forgiveness, patience, self-worth, trust, and wisdom—this practical and encouraging prayer book provides just the hope and help you need for any area of life.

Features:

*Daily Prayers. . .One for Every Day of the Year!

*Bible Promises for Truth and Inspiration

*Brief Devotional Thoughts Accompany Every Prayer

BARBOUR BOOKS barbour b1 - January 2024 Page 7

Barbour Books

9781636099071

Pub Date: 8/1/24

$19.99 USD

Hardcover

384 Pages

Carton Qty: 18

Religion / Christian Living

REL012080

8 in H | 6 in W

27.49

My Daily Prayer Plan: 2025 Edition

An Interactive Prayer Tracker for Women

Summary

Looking for a way to jump-start your prayer life?

PRAYER

My Daily Prayer Plan will help grow a vibrant prayer life while keeping a record of your faith journey throughout 2025. This dated, interactive prayer tracker gives you the perfect place to record your conversations with God throughout the year. Each month opens with a calendar and devotional theme, including God's Love, Freedom, Gratitude, Wisdom, and more! Every day includes a scripture and short devotional prayer starter as well as dedicated areas for personal prayer, daily prayer requests, praises, and answers to prayers. Truly interactive, My Daily Prayer Plan: 2025 Edition will leave you with a lasting record of how God worked in your life all year long.

Barbour Books

9781636098746

Pub Date: 7/1/24

$14.99 USD

Imitation Leather

208 Pages

Carton Qty: 48

Religion / Christian Living

REL012080

7 in H | 5 in W

20.99

200 Prayers to Quiet an Anxious Heart Peace and Comfort for Women

Summary

200 Heartfelt Prayers to Break Free of Anxiety

Seasons of anxious feelings come for many reasons. . .from relationship issues to financial hardship and troubling headlines to loneliness. But God cares deeply about your anxious heart, and in these 200 encouraging prayers, you’ll find His nearness, comfort, and love speaking through His Word.

In these pages, you’ll discover the truth of God’s unending devotion for you—even in the midst of seemingly impossible situations. Each prayer is bite-sized, heartfelt, and paired with a Bible verse that expands the wisdom that comes with resting in Him no matter what.

BARBOUR BOOKS barbour b1 - January 2024 Page 8

Barbour Books

9781636098951

Pub Date: 8/1/24

$12.99 USD

Paperback

192 Pages

Carton Qty: 36

Religion / Christian Living

REL012080

Series: 3-Minute Devotions

7 in H | 5 in W

17.99

180 Prayers for a Peaceful Spirit

3-Minute Prayers to Relieve Stress

Summary

Experience the Peace That Only Comes with

Knowing Jesus

You're guaranteed to find just the encouragement and assurance your heart needs in 180 Prayers for a Peaceful Spirit. This practical book packs a powerful dose of comforting inspiration into 3 short minutes.

FEATURING--

Minute 1: scripture to meditate on

Minute 2: a just-right-sized devotional prayer

Minute 3: a question for further reflection

Each day’s prayer meets you right where you are and is a great way for you to begin or end your day.

Barbour Books

9781636098708

Pub Date: 7/1/24

$7.99 USD

Spiral Bound – Wire-O

176 Pages

Carton Qty: 48

Religion / Christian Living

REL012080

8 in H | 5 in W

10.99

The Prayer Map: When You Don't Know What to Pray

Summary

THE ORIGINAL Prayer Map!

On days when you just can’t find the words, this unique prayer journal is just what your heart needs.

This engaging and creative tool will help guide you into powerful prayer, as each colorful page prompts you to create your very own prayer map—to write specific thoughts, ideas, and lists, which you can follow (from start to finish!) as you talk to God. Each map includes a spot to record the date, so you can look back on your prayers and see how God has worked in your life.

The Prayer Map: When You Don’t Know What to Pray will not only help you find the words to begin a meaningful conversation with the one who loves you most. . .it will also help you build a healthy spiritual habit of continual prayer for life!

This lovely journal, perfect for personal quiet time or small groups, features:

A user-friendly spiral binding—lays flat!

Delightfully designed two-color interior

Space to record the date on each Prayer Map

Prompted sections guide the creation of each Prayer Map—from start to finish

Carefully selected scripture on every spread

BARBOUR BOOKS barbour b1 - January 2024 Page 9

Barbour Books

9781636098944

Pub Date: 8/1/24

$9.99 USD

Spiral Bound – Wire-O

192 Pages

Carton Qty: 48

Religion / Christian Living

REL012020

Series: My Prayer Journal

8 in H | 5.5 in W

13.99

My Prayer Journal: Quiet-Time Prayers for a Woman's Heart

Compiled by Barbour Staff

PRAYER JOURNALS

My Prayer Journal: Quiet-Time Prayers for a Woman's Heart is a lovely devotional prayer collection designed to help you grow deeper in your faith and connect to your heavenly Father’s heart. Dozens of practical and encouraging prayers alongside ample journaling space will help you celebrate the beautiful gift of prayer as you spend time each day talking with God. You will discover a deeper understanding and love for the One who holds the whole world in His hands.

Barbour Books

9781636098234

Pub Date: 5/1/24

$9.99 USD

Spiral Bound – Wire-O

192 Pages

Carton Qty: 48

Religion / Christian Living

REL012080

Series: My Prayer Journal

8 in H | 5.5 in W

13.99

My Prayer Journal: Lord, I Need You

Compiled by Barbour Staff

Summary

Beautiful Are the Prayers of a Hopeful Heart

"For I know the plans I have for you,” declares the Lord, “plans to prosper you and not to harm you, plans to give you hope and a future."

Jeremiah 29:11 NIV

Do you want to grow deeper in your faith? Do you desire an intimate connection to your heavenly Father’s heart? . . . This lovely journal features dozens of practical and encouraging prayers inspired by Jeremiah 29:11 will help you strengthen your heart-connection to the Master Creator. With each turn of the page, you'll develop a deeper understanding and love for the One who holds the whole world in His hands.

BARBOUR BOOKS barbour b1 - January 2024 Page 10

Barbour Books

9781636098487

Pub Date: 6/1/24

$12.99 USD

Paperback

192 Pages

Carton Qty: 36

Religion / Christian Living

REL012020

7.8 in H | 5.7 in W

17.99

Good Morning, God! An Encouraging Prayer Journal for Women

Summary

Good mornings are guaranteed when you start the day off in prayer.

Nearly 200 faith-building devotional prayers are accompanied by inspiring scripture selections and journaling space—just for you.

Featuring just-right-sized readings to fit into your busy morning routine, you’ll start your days off right with Good Morning, God!

Barbour Books

9781636098210

Pub Date: 5/1/24

$12.99 USD

Paperback

192 Pages

Carton Qty: 36

Religion / Christian Living

REL012020

7.8 in H | 5.7 in W

17.99

Raise a Hallelujah Prayer and Praise Journal

Summary

Dozens of Devotions for Your Beautiful Heart. . .

This lovely devotional journal, inspired by Psalm 35:27–28 (". . .I'll tell the world how great and good you are, I'll shout Hallelujah all day, every day") features nearly 200 praise-themed devotions for your beautiful heart. Created to encourage you to "raise a hallelujah" no matter what you're experiencing in life, each devotional reading is complemented by an inspiring scripture selection, prayer starter, and journaling space.

Touching on topics important to you, like Perseverance, Comfort, Prayer, God's Love, Faith, Wisdom, and more. . .with each turn of the page, you will find your soul enveloped in the undeniable love of your heavenly Creator.

BARBOUR BOOKS barbour b1 - January 2024 Page 11

Barbour Books

9781636097503

Pub Date: 6/1/24

$9.99 USD

Hardcover

208 Pages

Carton Qty: 48

Religion / Christian Living

REL012020

6.5 in H | 4 in W

13.99

180 Devotions on Courage for Men

Compiled by Barbour Staff

Summary

Life gets really hard sometimes. But Christian men can face every challenge with courage. This 180-entry devotional builds off the inspired message of 2 Corinthians 12:10: For Christ’s sake, I delight in weaknesses, in insults, in hardships, in persecutions, in difficulties. For when I am weak, then I am strong.

Featuring both contemporary entries and “classics” from figures such as D. L. Moody, Andrew Murray, Charles Spurgeon, and John Wesley, 180 Devotions on Courage for Men promises insight and inspiration for guys of all ages.

Whatever life is throwing at you, you’ll be encouraged to seek your daily strength from God through Jesus Christ. Sure, life can be tough. But with the all-powerful God on your side, how can you be anything but courageous?

Barbour Books

9781636098784

Pub Date: 7/1/24

$14.99 USD

Imitation Leather

208 Pages

Carton Qty: 48

Religion / Christian Living

REL012020

7 in H | 5 in W

20.99

The Great Outdoors Devotional

100 Readings for Guys Who Love God's Creation

Compiled by Barbour Staff

Summary

The earth. . . the animals and plants. . . the sun and the stars. . . all tell of God if we’ll simply listen.

This devotional is perfect for guys who love God’s creation. The 100 readings draw parallels between your Christian faith and all the fascinating features of the outdoors:

mountains wildlife storms oceans birds the night sky and much more

Each encouraging reading is accompanied by a relevant scripture, questions for further thought, and a prayer starter to focus your mind on the God who made the great outdoors and all the wonderful things in it.

BARBOUR BOOKS barbour b1 - January 2024 Page 12
MEN

Barbour Books

9781636099026

Pub Date: 8/1/24

$9.99 USD

Paperback

384 Pages

Carton Qty: 48 Religion / Christian Living

REL012020

6 in H | 4.3 in W

13.99

Bible Encouragement for Every Day: Daily Devotions for Men

Compiled by Barbour Staff

Summary

Bible Encouragement for Every Day. . . for Men

For a full twelve months, Bible Encouragement for Every Day provides you with a concise, easy-to-read devotion on the most important, intriguing, and hope-filled passages of scripture. From the Bible's profound opening words (“In the beginning, God. . .”) to the final prayer of scripture (“Even so, come, Lord Jesus”), this book will enhance your biblical knowledge and boost your courage. Each day you’ll encounter an enlightening devotion on one of the great passages of scripture. It covers many topics important to men, such as

Courage Purpose Blessings

God’s Promises Salvation Wisdom and much more!

Appropriate for men of all ages, Bible Encouragement for Every Day covers the breadth of scripture from Genesis 1:1 to Revelation 22:20!

BARBOUR BOOKS barbour b1 - January 2024 Page 13

180 Devotions Help Teens Grow a Courageous Faith

• Bestselling 3-Minute Devotions Series Has Sold More Than 4 Million Copies

• 3 Minutes: Scripture, Devotion, Prayer

• Just-Right-Sized Inspiration for Busy 13–18-Year-Olds

This delightful new devotional encourages teens ages 13–18 to take a few moments of their day to quiet their spirits, think on God’s amazing love for them, and to choose courage in their thoughts, words, and actions. Dozens of just-right-sized readings pack a powerful dose of comfort, encouragement, and inspiration and are designed to meet teens right where they are in life. Minute 1: meditate on a scripture selection; Minute 2: read through a devotional thought; Minute 3: read a prayer designed to help jump-start a conversation with God. In only 3 short minutes, young hearts will be on their way to a courageous faith!

NOTES

June 2024

3-MINUTE DEVOTIONS

BISAC: Young Adult Nonfiction / Religious / Christian / Devotional & Prayer

CHOOSE COURAGE: FOR TEEN GIRLS by Renae Brumbaugh Green 9781636098586

CHOOSE STRONG: FOR TEEN GUYS by Elijah Adkins 9781636098517

$8.49 each

Paperback

4.25" x 6" 192 pages

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
................................................................................................................................ ................................................................................................................................ ................................................................................................................................
SCRIPTURE VERSION(S): ESV, NASB, NIV, RSV, AMP TEENS

Biblical Wisdom and Truth Offer Real Help for Teens Suffering from Anxiety and Depression

• 180 Devotions and Prayers Offer Biblical Wisdom and Support for Overcoming Anxiety and Depression

• A Fantastic Tool for Teenagers (and Parents) When They Don’t Know Where to Turn for Encouragement

• Featuring Important Topics like Finding God’s Peace, Coping with Negative Emotions, The Power of Prayer, and Resting in God’s Word

Anxiety and depression are on the rise in our teenagers. And many adults are at a loss for how to help them manage their overwhelming feelings and frustrations. When teens—and parents—don’t know where in the world to turn, God’s Word can help. Teens ages 13 and up will encounter just what their anxious souls need in this wisdom-filled devotional that offers biblical encouragement and support for life’s difficult days. With each turn of the page, they’ll discover the truth and tools they need to better manage their feelings of anxiety and depression. . .and will come to trust they’re never alone and always loved.

DEVOTIONS AND PRAYERS FOR MANAGING ANXIETY AND DEPRESSION by

BISAC: Young Adult Nonfiction / Religious / Christian / Devotional & Prayer For Teen Boys 9781636098272

For Teen Girls 9781636098289

$9.99 each Paperback

4.2" x 6.75"

192 pages

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
May 2024
................................................................................................................................ ................................................................................................................................
NOTES SCRIPTURE VERSION(S): NLT, MSG

Your Thoughts and Actions Today Determine Your Future—So Choose Wisely

• Brand-New 100-Entry Devotional for Teens

• Fresh, Fun Writing and Solid Biblical Teaching Encourage Good Decision-Making

• Topics Include Relationships, Priorities, Church, Thought Life, Money, and Things

Here are 100 practical and encouraging devotions to guide teens on the path to a “no regrets” life. This book touches on topics 13–18-year-olds care about and tackles issues they face daily: from popularity to money and possessions; from communication (including social media) to relationships with family, friends, and the opposite sex; and from priorities to knowing God. Fresh, fun writing and solid biblical teaching encourage good decision-making. With each turn of the page, readers will see the incredible freedom God has given them—to make choices that either lead to regret or to a life of fulfillment and happiness.

NOTES

July 2024

DEVOTIONS & PRAYERS FOR A "NO REGRETS" LIFE Inspiration and Encouragement for Teens

BISAC: Young Adult Nonfiction / Religious / Christian / Devotional & Prayer

For Teen Boys by Paul Kent 9781636098791

For Teen Girls by MariLee Parish 9781636098807

$17.99 each Paperback

5" x 7"

208 pages

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
................................................................................................................................ ................................................................................................................................
SCRIPTURE VERSION(S): NLV. SKJV, NIV, NLT

Barbour Young Adult 9781636099101

Pub Date: 8/1/24

$12.99 USD Paperback

192 Pages

Carton Qty: 36

Ages 13 to 18

Young Adult Nonfiction / Religious YAN048020

7 in H | 5.5 in W

17.99

God Calls You Courageous, Girl

180 Devotions and Prayers for Teens

Summary

In a culture that fills your head and heart with lies about your value in the world. . .there is One who calls you courageous.

And He can be trusted. His Word is truth.

This delightful devotional--created just for you--will encourage and inspire your young soul with deeply rooted truths from God's Word. Each devotional reading and heartfelt prayer will assure you that you are truly courageous--because God says so. . .and His Word is unchanging! Each of the 180 readings in God Calls You Courageous, Girl will help you to grow in your faith and increase your self-confidence as you become the strong and capable young woman the heavenly Creator intended you to be!

BARBOUR YOUNG ADULT barbour c1 - January 2024 Page 1

Make It Real for the New Generation

• Brand-New Preschooler Bible from Barbour

KIDS

August 2024

MY FIRST REAL BIBLE King James Version

BISAC: Bibles / King James Version / Children

• Complete King James Text with 36 Colorful Tip-in Pages Featuring Bible Characters

• Features Two-Column Design, 8.3-Point Bible Type

Many “Bibles” for young children aren’t actually Bibles but storybooks. Here’s a real Bible for preschool kids, ages 3 to 5, featuring the complete text of the King James Version plus 36 cute and colorful tip-in highlighting important Bible characters. Kids will enjoy thumbing through their first real Bible and carrying it to church. Parents will love the fact that their children are actually handling scripture, developing an early comfort level with the printed Word of God. And, of course, parents can always read the text to their kids! Presented in a cute, flexible cover especially for kids, My First Real Bible: KJV makes an ideal gift.

Blue Lion 9781636098968

Pink Duck 9781636098975

$27.49 each

Flex 5" x 7" 1156 pages

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
................................................................................................................................ ................................................................................................................................ ................................................................................................................................
NOTES BIBLE TYPE SIZE: 8.3POINT 2-COLUMN LAYOUT SCRIPTURE VERSION(S): KJV

June 2024

FAITH MAPS

PRAY BY NUMBER

A Doodle and Draw Prayer Map for Kids

BISAC: Juvenile Nonfiction / Religious / Christian / Inspirational

for Boys

9781636098432

for Girls

9781636098425

$17.99 each Spiral 7.5" x 9.5" 176 pages

Pray by Number. . .a Delightful, Interactive Prayer Map for Boys & Girls!

• A Fun Way for Kids Ages 4 and Up to Learn the Basics of Prayer

• Barbour’s Prayer Maps. . .Over 600,000 Copies Sold!

• Steps, Numbered 1 through 10, Create a Simple-to-Follow “Prayer Map” for Kids!

• Features Fun, Four-Color Interior Design in a Lay-Flat Spiral Binding

What’sa“PraybyNumber”prayer?It’safun,interactivedoodlinganddrawing activity that helps kids, ages 4 and up, connect with God as they learn the basics of prayer. Each “Pray by Number” prayer features numbered steps (1 through 10) and simple prompts that encourage kids to record (in doodles or drawings) what they want to share with God. Once they’ve completed the numbered steps, kids can use their own drawings or doodles as a guide to talk to God about their day or express things like their worries, thankful thoughts, and so much more. Step #10 in every “Pray by Number” prayer is an easy-to-understand scripture selection to help little ones grow in their faith and commit God’s Word to their hearts! Pray by Number: A Doodle & Draw Prayer Map is a fantastic resource for home or Sunday school activities. It’s also a great way for kids and parents to bond as they discuss the importance and power of prayer!

NOTES

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024

Start Young Readers on a Personal Devotional Habit

• Brand-New Books for 5-to-8-Year-Old Kids

• 20 Entries Feature Biblical Stories and Simple, Personal Lessons

• Small Package Fits Kids’ Hands; Designed to Encourage Them to Read for Themselves

This brand-new devotional for 5–8-year-olds covers the life and lessons of Moses—special baby, chosen leader, man of miracles, and friend of God.

And Mary--a chosen girl, a brave mom, a follower of Jesus, an example for all.

Designed to be read by the kids themselves, these fresh, ageappropriate books introduce readers to an important Bible figure, highlighting similarities between his/her life and theirs but also encouraging them to aspire to his/her good example.

June 2024

DEVOTIONS FOR BOYS & GIRLS

by Glenn Hascall & Trisha Priebe

BISAC: Juvenile Non iction / Religious / Christian / Devotional & Prayer Moses & Me 9781636098524

Mary & Me

9781636098579

$9.99 each

Paperback

5" x 7"

96 pages

PREVIOUS:

Esther & Me Devotions for Girls 978-1-63609-620-9 / $9.99

David & Me Devotions for Boys 978-1-63609-624-7 / $9.99

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
................................................................................................................................ ................................................................................................................................ ................................................................................................................................ SCRIPTURE VERSION(S): NLV, SKJV

Barbour Kidz

9781636098326

Pub Date: 5/1/24

$9.99 USD Paperback

112 Pages

Carton Qty: 60

Ages 4 to 8

Juvenile Nonfiction / Religious

JNF049220

8 in H | 8 in W

13.99

Stories and Puzzles for Courageous Girls

World-Changing Stories and Word Searches from 24 Great Women of Faith!

Compiled by Barbour Staff

Summary

Barbour Kidz

9781636098739

Pub Date: 7/1/24

$12.99 USD

Spiral Bound – Wire-O

176 Pages

Carton Qty: 34

Ages 8 to 12

Juvenile Nonfiction / Religious

JNF049120

9 in H | 6.5 in W

17.99

Here are 24 fantastic, fun word search puzzles for your girl's enjoyment! Grab a pencil, , ,and get ready to begin a 2-in-1 story AND word search journey!

Girls, ages 4 to 8, will be prompted to read through the stories of courageous women of faith—including Esther, Hannah, Lottie Moon, Helen Keller, Clara Barton, Fanny Crosby, and more!

As they read, they'll notice bold words throughout each Bible story. These are the words they'll be searching for in each puzzle. If they get stuck, answer key pages are in the back of the book!

Girls will be delighted and entertained as they solve simple word search puzzles and learn about extraordinary women who have made a difference in our world!

Full-colour

How to Be a Courageous Girl of God

An Interactive Journal and Sketchbook

Compiled by Barbour Staff

Summary

ages 4-8 ages 8-12

Encourage the girls in your life to become courageous girls of God!

Featuring brief descriptions of dozens of Bible women, your girls, ages 8 and up, will be inspired to become courageous, too, as they learn from the examples of strong women of faith--including Abigail, Anna, Deborah, Dorcas, Elizabeth, Mary, and dozens more! Each section prompts girls to read the complete story in their own Bible, draw a related picture, journal their thoughts about courageous women of the Bible, and think about how they, too, can be a courageous girl! This delightful journal makes a great standalone or companion to 100 Extraordinary Stories for Courageous Girls and The Bible for Courageous Girls

BARBOUR KIDZ barbour e1 - January 2024 Page 1

Barbour Kidz

9781636098999

Pub Date: 8/1/24

$6.99 USD Paperback

192 Pages

Carton Qty: 48

Ages 8 to 12

Juvenile Nonfiction / Religious JNF049120

6.9 in H | 4.2 in W

9.99

Sports Devotions for Kids

What the Games We Love Teach Us about God and Life

Tracy M. Sumner

Summary

What is a “can of corn” in baseball?

Why are there turkeys at the bowling alley?

ages 8-12

Who kicks a squib, joins a peloton, or does the Fosbury flop?

You’ll find answers to these questions, and many more, in Sports Devotions for Kids: What the Games We Love Teach Us about God and Life!

Whether you enjoy baseball basketball football hockey soccer bowling surfing equestrian tennis track or many other types of competition

Barbour Kidz

9781636098173

Pub Date: 5/1/24

$9.99 USD Trade Paperback

256 Pages

Carton Qty: 48

Ages 8 to 12

Juvenile Nonfiction / Religious JNF049220

8 in H | 5.2 in W

13.99

Jumbo Bible Summer Word Games

Compiled by Barbour Staff

Summary

Jumbo Bible Summer Word Games

ages 8-12

Perfect for kids ages 8 to 12, this book is jam-packed with Bible-based pencil-and-paper games to challenge and amuse, entertain and educate.

Here are scores of crosswords, word searches, acrostics, word scrambles, and more, each one based on a Bible passage or theme.

Looking for something fun to do? Sharpen your pencil and tackle Jumbo Bible Summer Word Games!

BARBOUR KIDZ barbour e1 - January 2024 Page 2

Daily Wisdom. . .a Great Motivator for Kids to Spend Time in the Heavenly Father’s Presence!

• Daily Devotions Designed to Draw Kids Ages 8 to 12 Closer to the Master Creator

• Barbour’s Daily Wisdom Devotional Collections Have Sold Upwards of 1 Million Copies!

• Features Two-Color Interior, Ribbon Marker, and Bonus Scripture Index

The Daily Wisdom devotional collections are perennial bestsellers—selling upwards of one million copies. And now a Daily Wisdom devotional is available just for kids! With an engaging devotion and related scripture selection for every day of the year, each reading is designed to draw kids closer to their heavenly Creator. Daily Wisdom will provide both encouragement and faith-building inspiration as readers come to know God loves and cares about them—no matter what. This daily devotional is a great way to inspire kids to grow up God’s way! NOTES

August 2024

DAILY WISDOM

365 Encouraging Devotions and Prayers

BISAC: Juvenile Non iction / Religious / Christian / Devotional & Prayer

For Boys

9781636099057

For Girls

9781636099040

$23.49 each

Flex

5" x 7"

384 pages

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
................................................................................................................................ ................................................................................................................................ SCRIPTURE VERSION(S): NIV, NLT, KJV, MSG, CEV, NLV, NCV, NKJV, AMP

Make God’s Word Personal for 8–12-Year-Old Girls

• Brand-New Girls’ Edition of Barbour’s Simplifi ed KJV Featuring Updated Verb Forms, Punctuation, and Paragraphing

• Type Size Approximately 8 Point in Single-Column Setting

• 40 Bonus Writing Pages Encourage Girls to Engage with Scripture

• Features Words of Christ in Red, Presentation Page, and Ribbon Marker

The Barbour Simplified KJV builds off the familiarity and trustworthiness of the King James Bible while updating antiquated language, punctuation, and style—making it a perfect option for younger readers. Keeping all the original translation work of the 1611 Bible, the SKJV offers greater comprehension in Bible reading. And now this edition, packaged especially for 8–12-year-old girls, also encourages readers to engage with scripture through 40 bonus writing pages featuring thought-provoking prompts. With its fun, fresh cover, My Bible SKJV for Girls is a Bible they’ll enjoy using—and makes a perfect gift for any occasion

May 2024

MY BIBLE SKJV FOR GIRLS

Simplified King James Version

BISAC: Bibles / Other Translations / Children Floral Giraffe 9781636098197

Pink & Gold Florals 9781636098180

$47.99 each

Hardcover 6" x 8" 1288 pages

Type Size: Approximately 8 point

SCRIPTURE VERSION(S): SKJV

Barbour Publishing, Inc. | www.barbourbooks.com | Summer 2024 / Fall 2024
42%

FaithWords

9781546029199

Pub Date: 8/6/24

$17.99 USD

Paperback

160 Pages

Carton Qty: 20

Religion / Christian Living

REL012040

8 in H | 5.3 in W

23.99

The Answer to Anxiety

How to Break Free from the Tyranny of Anxious Thoughts and Worry

Summary

Now in paperback

Renowned Bible teacher and #1 New York Times bestselling author Joyce Meyer teaches readers how to overcome anxiety by giving their worries to God.

We all feel anxious, worried, or concerned at times; these feelings are common responses to stressful situations. But what if there was a way to put a stop to your worrying before it steals your peace of mind?

In The Answer to Anxiety, renowned Bible teacher and #1 New York Times bestselling author Joyce Meyer reveals truth from God’s Word that shows us how to focus on God when we’re feeling anxious or unsettled. She also teaches readers practical steps based on Scripture that we can take when we need to face our fears and resolve all of our anxieties.

God doesn’t want you to live with worry and anxiety. And when you understand that He has a good plan for you, you can experience the life-changing peace He offers. Join Joyce on this journey to overcome anxiety and discover how you can have a God-centered, peace-filled life you enjoy every day

FaithWords

9781546046950

Pub Date: 6/4/24

$12.00 USD

Hardcover Paper over boards

144 Pages

Carton Qty: 20

Religion / Christian Living

REL012070

6.3 in H | 4.5 in W

16.00

The Joy of an Uncluttered Life

Summary

Condensed version of 100 Ways to Simplify Your Life

Battle burnout, simplify your life, and change your thinking with #1 New York Times bestselling author and renowned Bible teacher Joyce Meyer.

Many of us understand how easy it is for life to become hectic, stressful, and busy. We are overcommitted, have no free time, and feel trapped in the daily demands of life. But there is good news—you don’t have to live this way!

In The Joy of an Uncluttered Life, you will find relief from burnout and unnecessary stress with 100 ways to simplify your life. These doable tips will teach you to set boundaries, stay positive, clear out clutter in your life, deal with other people in healthy ways, and more. Even the smallest things we do in a day have the power to bring about more peace, and this book will empower you to make lasting changes in your life.

Discover a life beyond stress and frustration and develop a mindset of simplicity and peace!

Derived from material previously published in 100 Ways to Simplify Your Life.

FAITHWORDS faithwords a1 - January 2024 Page 1
42%

WorthyKids

9781546012498

Pub Date: 6/4/24

$8.99 USD

Board Book

26 Pages

Carton Qty: 48

Ages 2 to 5, Grades P to K

Juvenile Fiction / Religious

JUV033090

7 in H | 7 in W | 0.6 in T

11.99

Uniquely You

Summary

Now in a board book: ages 2-5

KIDS

Encourage little ones to embrace the God-given gifts that make them unique with this sweetly inspiring book from #1 New York Times bestselling author Joyce Meyer.

Like adults, children often struggle with insecurities and doubts. Maybe they wish they looked like someone else, or were better at soccer or painting, or simply wonder if they measure up to their peers. This book reminds children of an incredible truth––God made them the way they are for a reason, and they are amazing! They are beautiful and talented in their own unique ways, and they are exactly who God wants them to be. Renowned Bible teacher Joyce Meyer invites children to joyfully embrace their unique identities and to celebrate the unique identities of others.

Worthy Books

9781546003410

Pub Date: 6/18/24

$27.00 USD

Hardcover

224 Pages

Carton Qty: 20

Religion / Christian Living

REL012120

8.3 in H | 5.5 in W

35.00

Why I Believe

A Psychologist's Thoughts on Suffering, Miracles, and Faith Dr. Henry

Summary

ADULT

What gives our lives meaning and allows us to rise above pain and disappointment to live with compassion, kindness, and love?

World-renowned psychologist and leadership expert Henry Cloud has changed millions of lives through his groundbreaking books and through his work coaching leaders of the most influential organizations in the world. But few people know the details of his own story and how he became one of the most beloved and respected psychologists and faith influencers in America.

In this indelibly personal and vulnerable book, Dr Cloud leads us through his early struggles with illness and depression and the miracles that healed him and led him to his calling as a healer of others. Through masterful storytelling combined with a deeply nuanced understanding of the human mind, Dr. Cloud invites readers to inhabit the spaces of suffering and elation that make us most human and to walk alongside of him as he ponders the great questions we are so often afraid to ask but which also give life meaning.

Written in the vein of such groundbreaking books as An Unquiet Mind, When Breath Becomes Air

WORTHYKIDS worthy1 - January 2024 Page 1
memoir
45%

NEW RELEASES

spring 2024

Life has a way of weakening us. God has a way of strengthening us. Life is full of strength-stealers situations, experiences, or relationships that rob us of our courage and passion. Lindsay Roberts shows how you can exchange life’s strength-stealers for strength-builders by discovering how strong women in Christ think and act, listen and speak, respond, and thrive as they fulfill their God-given purposes.

Discover Your True Strength Trade Paper | 979-8-88769-221-0

$18.99 US | $25.99 CAN

Host of Make Your Day Count

Deep inside the heart of every woman is a diva just waiting to be released. Shining a spotlight on women of the Bible who displayed diva-tude, Michelle McKinney Hammond offers solid, practical advice for women to get their head, heart, life, and act together so that they will emerge happy and victorious—divas in the best sense of the word.

The Diva Principle (repack) Trade Paper | 979-8-88769-223-4

$16.99 US | $23.49 CAN

Prev. bk: When Shift Happens

The Pilgrim’s Progress Illustrated Adventure for Kids Trade Paper | 979-8-88769-240-1 | $12.99 US | $17.99 CAN

John Bunyan’s beloved allegory The Pilgrim’s Progress is one of the greatest literary masterpieces in the world. Author/illustrator Phil Smouse’s The Pilgrim’s Progress Illustrated Adventure for Kids combines some of Bunyan’s original words with simple, clever phrasing to make the tale understandable for readers of all ages. His whimsical, full-color illustrations will delight both children and adults.

ages 8-11

42%

The CHOSEN DVD

$40.99 DVD $47.99 BluRay

The Chosen is the #1 crowdfunded media project in entertainment history and the first multi-season show about the life of Jesus Christ and His disciples. Each DVD set features all episodes of the season. English and Spanish subtitles. Approx. 379 min each.

SEASON 4

cover not final

SEASON 4

0810141690165 DVD 0810141690172 BluRay
May
SEASON 4
4

FEATURES:

•High-grade faux leather exterior provides durability and exquisite tactile appeal.

•Heat debossing; foil finishing touches

•Built-in stand creates its own display

• Full-color interior

Prayers & Promises Perpetual Calendar

You can take great joy in knowing that God made you for a purpose and He desires a close relationship with you.

Flip through pages of encouragement every day of the year with this inspirational perpetual calendar. Themed Scriptures and heartfelt prayers help you start your day the right way—filled with wisdom and peace!

Be strengthened as you dwell on the goodness and faithfulness of God.

SAMPLE ONLY

•Uncoated, wood-free paper of premium quality and thickness lends itself to long-lasting vivid coloration and durability.

VITAL INFORMATION

$24.99 each

For Men: 9781424568529

For Women: 9781424567980

Faux leather

5 x 4

Available: Aug. 6, 2024

BISAC Categories:

• RELIGION / Christian Living / Inspirational

• RELIGION / Christian Living / Prayer

• RFERENCE / Planners

CONTENT BENEFITS

A year of inspiration through daily themes that help men & women find wisdom for daily challenges, peace in uncertainty, gratitude for life’s many blessings, and strength to persevere in hardship.

22

SPECIAL FEATURES:

Bible Word Search Devotionals

100 Days of Worship in the Psalms & Proverbs

Are you looking for spiritual inspiration and intellectual stimulation in the same place? Do you need activities that reduce stress and boost your mental health? Look no further! These devotions, Scriptures, and puzzles will encourage your spirit and engage your mind in the many promises and blessings of God. Soak in the unchanging love & faithfulness, and wisdom of your Creator, beautifully captured in the books of Psalms & Proverbs.

ThisBibleWordSearchDevotional offers:

• 100 word search puzzles coupled with inspiring devotions,

• an easy-to-read, large print font that reduces eye strain,

• puzzles known for keeping the brain sharp and memory in tact,

• stress-relieving activities for calming your mind, body, and soul,

• memorization practice for important Scripture passages, and

• answer pages so you can check your work!

When depression and anxiety threaten to steal your hope and joy, open this book and be reminded of the peace, protection, and goodness your heavenly Father has waiting in abundance for you.

•Gloss applied in specific places on the cover illuminates design elements and provides added texture.

•Uncoated, wood-free paper is of premium quality and thickness, allowing you to write without concern of ink bleedthrough

VITAL INFORMATION

$17.99 each

Psalms 9781424568932

Proverbs 9781424568949

Coilbound softcover

7.5" x 9"

224 pages

Available: July 2, 2024

BISAC Categories:

• RELIGION / Christian Living / Devotional

• GAMES & ACTIVITIES / Word & Word Searches

• GAMES & ACTIVITIES / Activity Book

CONTENT BENEFITS

Engaging word search puzzles are derived from thought-provoking devotions for an intellectually stimulating and spiritually inspiring experience.

22

Belle City Gifts 9781424568895

Pub Date: 5/7/24

$19.99 USD

Spiral Bound – Wire-O

224 Pages

Carton Qty: 0

Religion / Christian Living

REL012040

8 in H | 6 in W

A Time for Everything

Weekly Devotional Journal for Women

Belle City Gifts

Summary

DEVO JOURNALS

This beautifully designed devotional journal for women features meditations, thought-provoking prompts and questions, and encouraging quotes and Scriptures that will help your weekly devotional life to be focused and intentional.

Pray with a heart full of gratitude and hope, confident that the Father is ever near, listening with a tender heart of compassion.

Reflect on the promises of God, delight in his goodness, and express your thoughts, prayers, and praise in the space provided.

Features

Pearlescent hardcover with special debossing.

Metallic foil finishing touches are elegantly placed to enhance certain features, capturing attention and adding class for an aesthetic appeal.

Spiral bound journal creates durability and allows pages to lay flat when open.

Maximize writing space by flipping pages to one side.

Uncoated, wood-free, premium quality paper allows you to capture your thoughts without concern of ink bleed-through.

Beautifully designed full-color interior.

Belle City Gifts

9781424568901

Pub Date: 5/7/24

$19.99 USD

Spiral Bound – Wire-O

224 Pages

Carton Qty: 0

Religion / Christian Living

REL012040

8 in H | 6 in W

Be Still and Know

Weekly Devotional Journal for Women

Belle City Gifts

Summary

This beautifully designed devotional journal for women features meditations, thought-provoking prompts and questions, and encouraging quotes and Scriptures that will help your weekly devotional life to be focused and intentional.

Pray with a heart full of gratitude and hope, confident that the Father is ever near, listening with a tender heart of compassion.

Reflect on the promises of God, delight in his goodness, and express your thoughts, prayers, and praise in the space provided.

Features

Pearlescent hardcover with special debossing.

Metallic foil finishing touches are elegantly placed to enhance certain features, capturing attention and adding class for an aesthetic appeal.

Spiral bound journal creates durability and allows pages to lay flat when open.

Maximize writing space by flipping pages to one side.

Uncoated, wood-free, premium quality paper allows you to capture your thoughts without concern of ink bleed-through.

Beautifully designed full-color interior.

BELLE CITY GIFTS broadstreet12 - January 2024 Page 1
27.49 27.49

Majestic Expressions

9781424565764

Pub Date: 6/4/24

$9.99 USD

Paperback

128 Pages

Carton Qty: 30

Religion / Christian Living

REL012040

Series: Majestic Expressions

11 in H | 8.5 in W

13.99

When God Thinks of You He Smiles Coloring Book

BroadStreet Publishing Group LLC

Summary

Book/Back Cover Description:

Life is full of demands. Appointments, deadlines, obligations, and constant digital chatter occupy every moment and build a mountain of unhealthy stress and tension. Coloring is an effective stress reducer, but true rest and peace are found in God.

When God Thinks of You, He Smiles is full of inspiring Scriptures and illustrations. Spend time reflecting on the truth of God’s Word and be filled with his joy and peace. Express your creativity freely as you fill the intricate images with the beauty of color.

Take a break from your busy schedule and the stress that accompanies it. The worries of life can wait.

Features:

soft-touch matte laminated cover raised round embossed cover treatment with metallic foil touches beautiful hand-drawn illustrations encouraging Scriptures and quotes high quality, acid-free paper for coloring perforated pages for easy removal

BroadStreet Publishing Group, LLC

9781424566990

Pub Date: 5/7/24

$17.99 USD

Imitation Leather

384 Pages

Carton Qty: 40

Religion / Christian Living

REL012020

6.5 in H | 4.5 in W

365 Power Prayers for Men

BroadStreet Publishing Group LLC

Summary

“The earth and sky will wear out and fade away before one word I speak loses its power or fails to accomplish its purpose.” Matthew 24:35 TPT

This is one of the many promises God has spoken over you. His promises are for every situation and for all time. They reflect his character and confirm his purpose for your life.

This book of prayers will help you gain confidence in the never-ending love and mercy of God. When you need encouragement or a reminder of who God is, turn to his Word and pray it over your situation. God’s Word is living and active and as relevant today as it was when it was written.

As you reflect on these daily entries, grab hold of God’s promises, speak them over your life, and discover his unlimited grace and strength for your every need.

Features:

•High-grade faux leather provides durability and exquisite tactile appeal.

•Heat debossing on faux leather darkens its color, giving the cover a two-tone appearance and creating indentation which shows off the intricate design and varied texture.

•Metallic and matte foil finishing touches are elegantly placed to enhance...

broadstreet12 - January 2024 Page 2
24.99 DEVOS

BroadStreet Publishing Group, LLC

9781424566693

Pub Date: 6/4/24

$19.99 USD

Imitation Leather

384 Pages

Carton Qty: 20

Religion / Christian Living

REL012040

8 in H | 6 in W

Be Strong and Courageous

BroadStreet Publishing Group LLC

Summary

Courage isn’t something that comes naturally to most. The only way to truly be strong is to walk in the confidence that comes from knowing God and relying on him to be your strength. When you spend time with him, he will fill you with peace and hope for the future. When you finally see yourself as God sees you, you will recognize the talents and abilities you have been blessed with and start operating in the fullness of those gifts.

Be encouraged with truth as you spend time with God, reflecting on these devotions, scriptures, and prayers. Let him show you that you are radiant, you are strong, and you were created with a purpose. Take courage in God’s love for you and be ready to conquer each day!

Features:

•High-grade faux leather provides durability and exquisite tactile appeal.

•Heat debossing on faux leather darkens its color, giving the cover a two-tone appearance and creating indentation which shows off the intricate design and varied texture.

•Metallic and matte foil finishing touches are elegantly placed to enhance certain features, capturing attention and adding class for an a...

BroadStreet Publishing Group, LLC

9781424566679

Pub Date: 6/4/24

$19.99 USD

Imitation Leather

384 Pages

Carton Qty: 0

Religion / Christian Living

REL012020

8 in H | 6 in W

Amazing Grace

365 Daily Devotions

BroadStreet Publishing Group LLC

Summary

The circumstances of life may leave you feeling overwhelmed, frustrated, discouraged, or confused. God’s love for you is unchanging and his promises are true! Choose to believe in the steady outpouring of his grace from the minute you wake up to the moment you lay down to sleep.

As you reflect on these devotional entries, Scriptures, and prayers, find the hope, joy, and strength that is abundant in God. Claim his grace over your life and continue to believe that your Creator loves you deeply no matter what comes your way.

Features:

•High-grade faux leather provides durability and exquisite tactile appeal.

•Heat debossing on faux leather darkens its color, giving the cover a two-tone appearance and creating indentation which shows off the intricate design and varied texture.

•Metallic and matte foil finishing touches are elegantly placed to enhance certain features, capturing attention and adding class for an aesthetic appeal.

•High-quality sturdy Smyth-sewn binding stitches book signatures together creating durability and allowing pages to lay flat when open. Decorative head and foot b...

BROADSTREET PUBLISHING GROUP, LLC broadstreet12 - January 2024 Page 3
27.49 27.49

BroadStreet

9781424567874

Pub Date: 4/2/24

$17.99 USD

Imitation Leather

384 Pages

Carton Qty: 0

Religion / Christian Living

REL012020

6.5 in H | 4.5 in W

24.99

Mornings with Nana

365 Days of Love and Encouragement

Summary

Start your day with love and prayer from grandma!

Whether we’re facing challenges or feeling lost, we all need a little guidance from time to time. And who better to turn to than a grandmother, whose knowledge and experience can lead us through the ups and downs of life.

In Mornings with Nana, Marietta Terry shares inspiring life lessons passed down through generations. Weaving together God's truth with heartening wisdom, comforting messages, and uplifting prayers, Mornings with Nana will encourage you to

find reassurance in Christ’s redeeming love, nurture and guard your heart in every season, and stand steadfast in your faith and convictions.

Let Mornings with Nana call you back home, where love and support abound no matter what waits at the doorsteps of life.

BroadStreet

9781424567225

Pub Date: 5/7/24

$21.99 USD

Imitation Leather

384 Pages

Carton Qty: 0

Religion / Christian Living

REL012020

8 in H | 6 in W

30.49

Day by Day and Night by Night

365 Daily Devotions for Leaders

Summary

Lead with God by your side.

Moses had too many responsibilities, King David faced opposition, and Paul felt alone, but leaning into God’s guidance, these biblical leaders rallied people toward a better future. You, too, can tackle any challenge and move forward with vision however the Lord has called you to lead.

Imparting principles from God’s Word and his own experiences, Ronnie Floyd will inspire you to lead with confidence in this 365-day devotional. Each day contains a Scripture passage, a morning devotion with a daily declaration, and an evening devotion with a prayer. Day by Day and Night by Night will help you

listen for spiritual direction, make decisions with insight and humility, stand firm during change and trials, grow in your life and leadership, and trust Jesus every step of the way.

Become a leader empowered by God’s continuous presence day by day and night by night.

Publishing Group, LLC
Publishing Group, LLC
BROADSTREET PUBLISHING GROUP, LLC broadstreet12 - January 2024 Page 4

BroadStreet Publishing Group, LLC

9781424567928

Pub Date: 6/4/24

$24.99 USD

Imitation Leather

480 Pages

Carton Qty: 0

Religion / Christian Living

REL012020

8 in H | 5.4 in W

34.49

Five Psalms and a Proverb

A 31-Day Devotional

Summary

Fill your heart with God's love and wisdom.

The books of Psalms and Proverbs contain a wealth of guidance and instruction from the omniscient and omnipresent God. His poetic words are brimming with divine knowledge, filling you with the power of his presence in every season.

This powerful devotional features thirty-one devotions based on five selected psalms and a proverb, inspiring you to connect deeply with the passionate heart and encouraging counsel of God. Including Scripture from The Passion Translation®, this devotional invites you to come to God as you are and daily walk the path of wisdom for his glory.

BroadStreet Publishing Group, LLC

9781424568154

Pub Date: 8/6/24

$16.99 USD

Imitation Leather

176 Pages

Carton Qty: 0

Religion / Christian Living

REL012020

6.5 in H | 4.5 in W

23.49

Strength for My Path

52 Devotions from the Hiking Trail

Summary

Step into the wonder of God's creation. Escaping from the stress of daily life to a rugged cliff or the depths of a forest offers time for peaceful thought. In Strength for My Path, Maureen E. Wise shares fifty-two devotions to ponder on your next hike. Featuring daily Scripture and prayer, these reflections from the trail will provide hiking tips and nature facts, encourage responsible creation care, heighten your wonder in the world around you, and deepen your love of creation and the Creator.

Whether you’re on a day hike or only have a few minutes to spare before work, Strength for My Path is the perfect companion for quality time with your heavenly Father in the wonderful world he has made.

BROADSTREET PUBLISHING GROUP, LLC broadstreet12 - January 2024 Page 5
45%

The Good Book Company

9781784989842

Pub Date: 5/1/24

$19.99 USD

Hardcover Picture Book

208 Pages

Carton Qty: 0

Ages 1 to 3

Juvenile Nonfiction / Religion

JNF049040

Series: Little Me, Big God

6.7 in H | 6.7 in W | 0.5 in T | 0.9 lb Wt

27.49

Little Me, Big God: Stories about Jesus

Eight True Stories from the Bible

Steph Williams

KIDS

ages 1-3

A hardback collection of eight engaging, faithful, fun stories about Jesus for 2-4s. Includes the Lord's Prayer, feeding the 5,000, the first Easter.

Summary

How many people did Jesus feed with one boy's lunch?

Why did a dad run down a road?

What happened when Jesus's disciples stopped some children who wanted to talk to him?

And why did Jesus die on a cross?

Enjoy reading eight Gospel stories, retold in a faithful and fun way for kids. Toddlers and preschoolers will love the colorful, exciting illustrations, and older ones can get to grips with the "extra bits" that go deeper into each story

This hardback collection of eight stories from the "Little Me, Big God" series is a great addition to any young child's bookshelf or children's ministry range.

The Good Book Company

9781784989699

Pub Date: 6/1/24

$14.99 USD

Hardcover Picture Book

32 Pages

Carton Qty: 0

Ages 3 to 7

Juvenile Nonfiction / Religious

JNF049260

Series: Training Young Hearts

8.3 in H | 8.3 in W | 0.4 in T | 0.7 lb Wt

20.99

Your Amazing Hands

A Training Young Hearts Rhyming Book

ages 3-7

A charming rhyming book that celebrates God’s good design for our hands, motivating children aged 3+ to use their hands to glorify God.

Summary

This charming rhyming book celebrates God’s good design for our hands, motivating children aged 3+ to use their hands to glorify God.

Children will be inspired by all the creative and interesting things their hands can do—they can even use them to bring comfort and joy to others! They’ll discover that Jesus had hands just like ours and that he always used his hands in the most amazing ways, including to save us.

Not only that: the way that Jesus used his hands means that we can be forgiven when we use our hands in the wrong way. Children are invited to pray for forgiveness when they make mistakes, and for help to use their hands in the ways God intends. The book’s fun rhyming style and colorful illustrations make it easy to engage with this life-altering message of repentance, forgiveness, and grace-fueled obedience.

Your Amazing Hands is part of the Training Young Hearts series, which consists of board books for toddlers as well as rhyming books for children over 3. All the books in the series train young hearts through the gospel, both by showing Jesus as an example and by explain...

THE GOOD BOOK COMPANY TGBC - January 2024 Page 1

The Good Book Company

9781784989644

Pub Date: 6/1/2024

$23.49

Hardcover Picture Book

32 Pages

Ages 3 to 6

Juvenile Nonfiction / Religion JNF049040

Series: Tales that Tell the Truth

10.2 in H | 8.7 in W | 0.4 in T | 1 lb Wt

Status:FORTHCOMING

The Man in the Tree and the Brand New Start

A True Story about Zacchaeus and the Difference Meeting Jesus Makes Carl Laferton, Catalina Echeverri

ages 3-6

Key Selling Points

•Written by the author of The Garden, the Curtain and the Cross •Shows children what real repentance looks like •Stunning artwork by award-winning illustrator Catalina Echeverri

Teach children that genuine repentance and faith in Jesus leads to a transformed life.

Summary

Zacchaeus was very short, very rich and not very happy, but his encounter with Jesus changed everything.

In response to the grace Jesus showed him, Zacchaeus was transformed from the inside out. He repented, treasured Jesus above everything else, and showed kindness and generosity to others like never before.

Use this story to teach children that only following Jesus will make them truly happy and fulfilled, and that genuine repentance and faith is demonstrated by loving others.

Contributor Bio

Carl is Editorial Director at The Good Book Company and is a member of Grace Church Worcester Park, London. He is the best-selling author of The Garden, the Curtain and the Cross and God's Big Promises Bible Storybook, and also serves as series editor of the God's Word for You series. Before joining TGBC, he worked as a journalist and then as a teacher, and pastored a congregation in Hull. Carl is married to Lizzie, and they have two children. He studied history at Oxford University.

Illustrations

The Good Book Company 9781784989804

Pub Date: 5/1/2024

$23.49

Hardcover Picture Book

32 Pages

Ages 3 to 7

Juvenile Nonfiction / Religious JNF049210

9.4 in H | 8.5 in W | 0.4 in T | 0.9 lb Wt

Status:FORTHCOMING

It's Good to Be a Girl

A Celebration of All That God Made You to Be Jen Oshman,

Key Selling Points

-Joyful, celebratory tone inspires young girls

ages 3-7

-Avoids stereotypes while affirming a careful biblical view of what God designed women to be and do

-Full of real-life examples of women from the Bible and later history

-Beautiful illustrations bring to life how amazing it is that God made girls

Celebrates that God made girls in his image and explores all the wonderful things he designed them to be and to do.

Summary

This beautifully illustrated book celebrates that God made girls in his image and explores all the wonderful things he designed them to be and to do.

Girls aged 3-7 will learn that they are good and necessary, how God calls different women to do different things, and how trusting in Jesus is the key to help us love and serve others wherever we are.

Follow along as a little girl learns from her mother all about real women from the Bible and later history. Together they imagine lots of different ways in which we can reflect God's character and help those around us today, whether that's through being a mum or a missionary, a truck driver or a teacher!

Young girls will learn that they have been carefully designed by God and that whatever they do in life, they can reflect who God is by following Jesus.

Contributor Bio

Jen Oshman is a writer, podcaster, pastor's wife, and mom of four daughters. She has served as a missionary and church planter for over two decades on three continents. She currently resides in Colorado, where she is the Director of Women's Ministry at Redemption Parker

llustrations

The Good Book Company 9781784989828

Pub Date: 7/1/2024

$20.99

Hardcover Picture Book

32 Pages

Ages 4 to 7

Juvenile Nonfiction / Religion

JNF049140

Series: Jesus Moments

10.6 in H | 8.5 in W | 0.3 in T | 1 lb Wt

Status:FORTHCOMING

Previous:

Jesus Moments: Moses Finding Jesus in the Story of Moses

Alison Mitchell, Noah Warnes

Key Selling Points

•Engaging retelling of the story of Moses

ages 4-7

•Hidden bulrushes in the illustrations help children learn how to look for "Jesus moments" in Old Testament stories

•Stunning full-color artwork by Noah Warnes

•Second in the new "Jesus Moments" series

Help 4-7s learn how events in the life of Moses point to Jesus with this beautifully illustrated Old Testament Bible story

Summary

Help 4-7s learn how Moses points to Jesus with this beautifully illustrated Old Testament storybook from Alison Mitchell, the award-winning author of Jesus and the Lions’ Den and The One O’Clock Miracle.

Moments in Moses’ story when something in the story is a little bit like Jesus are signposted with symbols that children need to spot, helping them to understand the relationship between the Old and New Testaments.

This fun, interactive resource will give children skills to read the Bible as they connect the stories and learn that the whole Bible is about Jesus. Great for parents or grandparents to give children aged 4-7. Can also be used as a homeschool resource or for children’s ministry in church.

Contributor Bio

Alison Mitchell is a senior editor at The Good Book Company, where she has worked on a range of products including Bible-reading notes for children and families, and the Christianity Explored range of resources. She is the author of the award-winning Jesus and the Lions' Den and The One O'Clock Miracle.

The Good Book Company

9781784989750

Pub Date: 4/1/24

$14.99 USD

Hardcover Picture Book

32 Pages

Carton Qty: 0

Ages 4 to 7

Juvenile Nonfiction / Religious JNF049180

Series: Do Great Things For God

9.4 in H | 7.7 in W | 0.3 in T | 0.7 lb Wt

20.99

Susannah Spurgeon

The Pastor’s Wife Who Didn’t Let Sickness Stop Her Mary Mohler, Cecilia Messinaages 4-7

#11 in series

ages 4-7

Inspiring children's biography of Susannah Spurgeon, whose poor health did not stop her from serving.

Summary

Read the true story of Susannah Spurgeon, the wife of British pastor Charles Spurgeon.

Susannah was married to a very gifted and busy preacher, who could not have done all he did without her support. Susie experienced poor health for much of her life, but she did not let that stop her from serving. One key way that she served the wider church was by creating the Book Fund, which gave free copies of Charles' books to poor pastors who could not afford to buy them.

This beautifully illustrated children's biography of Susannah Spurgeon (1832-1903) features stylish illustrations and extra facts at the back, including a biographical timeline with historical photos. It is part of a series designed to show kids that God uses ordinary people to do extraordinary things.

The Good Book Company

9781784988982

Pub Date: 6/1/24

$15.99 USD

B-format Paperback

208 Pages

Carton Qty: 0

Ages 7 to 11

Juvenile Fiction / Religious

JUV033120

Series: Abigail

7.8 in H | 5.1 in W | 0.6 in T | 0.5 lb Wt

21.99

Abigail and the Big Start Over

Switch Schools. Make Friends. Fix All the Mess!

#1 Abigail (chapter book) ages 7-11

Fun, absorbing novel that helps kids aged 7+ to engage with the Bible as they explore what God’s grace looks like in their everyday lives.

Summary

New house. New school. New problems!

Like many kids, adventurous and creative 9-year-old Abigail experiences lots of ups and downs when it comes to school life, making friends and getting on with parents and siblings. Through both the humorous and serious challenges that arise, Abigail finds herself in one new mess after another. But as she learns all about how Jesus forgave Peter when he messed up again and again, she sees how Jesus can forgive her too.

Readers will explore the Bible alongside Abigail and learn that God’s love for us and his grace to us never run out. So we can start over again and again!

This fun, exciting novel for kids aged 7+ features short chapters with illustrations that really bring the story to life. It explains grace in a kid-friendly way that is relevant to their lives, and it provides a great way for kids to engage with the Bible.

This is the first book in a fictional series for readers aged 7 and up that follows the adventures of 9-year-old Abigail as she figures out what faith means for her everyday life. Young readers are inspired to read the Bible, talk t...

THE GOOD BOOK COMPANY TGBC - January 2024 Page 2

The Good Book Company

9781784989873

Pub Date: 4/1/24

$7.99 USD

A-format Paperback

96 Pages

Carton Qty: 0

Religion / Christian Living

REL012080

Series: 5 Things

7 in H | 4.3 in W | 0.4 in T | 0.2 lb Wt

10.99

5 Things to Pray for a Suffering Friend Prayers That Change Things for Friends or Family Who Are Walking through Trials

Help to pray for people dealing with grief, illness, emotional distress, mental-health issues or difficult circumstances.

Summary

It can sometimes be hard to know how best to help friends, family or fellow church members who are struggling through pain and suffering. But one guaranteed way to love them well is to commit to pray for them regularly. Whether someone you know is dealing with grief, illness, emotional distress, mental-health issues or difficult circumstances, this guide will help you to pray for them with compassion and purpose.

Each of the 21 prayer themes in this book takes a passage of Scripture and suggests five things to pray for your struggling friend—relevant for whatever their troubles may be. You can use this book in any number of ways: work through it as part of your daily quiet time or pick it up whenever you want to pray for your friend.

Previous in series:

5 Things to Pray For Your Kids " " " Spouse " " " Church

The Good Book Company

9781784989859

Pub Date: 4/1/24

$16.99 USD

Trade Paperback

176 Pages

Carton Qty: 0

Religion / Christian Living

REL012120

8.5 in H | 5.3 in W | 0.4 in T

| 0.5 lb Wt

23.49

Peace over Perfection

Enjoying a Good God When You Feel You're Never Good Enough

Help for those struggling with perfectionism and guilt in their Christian walk.

Summary

Many Christians, often without even realizing it, struggle with a type of Christian perfectionism. We strive to please God but are plagued with anxiety about making mistakes. We want to do God’s will but live with a self-berating inner voice even as we seek to serve him. We sincerely believe the gospel and love Jesus but struggle with never feeling good enough before God.

How can Christians wholeheartedly pursue God without an undercurrent of guilt, fear or anxiety? How can imperfect people experience God's peace while seeking to obey his perfect standards?

Author Faith Chang addresses the struggles of her fellow "Christian perfectionists" through meditations on God’s character. With nuance and care, she writes for those who seek to grow in Christ and live for God’s glory yet live in fear of failure. She explores the Bible to show that as God deals with us as in-process people, he is far more merciful, righteous and patient than we may have imagined. As we consider how he interacts bountifully with us, the weary and scrupulous Christian perfectionist will be freed to pursue God while e...

THE GOOD BOOK COMPANY TGBC - January 2024 Page 4

The Good Book Company 9781784989781

Pub Date: 7/1/24

$19.99 USD

Hardcover

208 Pages

Carton Qty: 0

Religion / Christian Living

REL012080

7.5 in H | 5.3 in W | 0.5 in T | 0.7 lb Wt

27.49

In His Hands

Prayers for Your Child or Baby in a Medical Crisis

Help when your child or unborn baby is seriously ill and you don’t know what to pray.

Summary

When your child or unborn baby is facing serious medical problems, it can be hard to know what to pray. The shock, uncertainty and fear can mean that even though you want to cry out to God in prayer, your words just dry up.

That’s where this book can help, with prayers that use Scripture to help you communicate with the Lord. Whether you need to cry out honestly to the Lord in grief, to pray boldly for healing and help or simply to process what is happening, you'll find words to help you talk with the God who loves you and weeps with you—the God who can do all things.

Authors Eric Schumacher and Jessika Sanders both know what it’s like to face a family medical crisis, and they are passionate about helping others in the most difficult situations. Eric is the author of Ours: Biblical Comfort for Men Grieving Miscarriage. He is on the Board of Directors for Walk With You, a bereavement counselling organization. Jessika is the founder and president of Praying Through Ministries, which provides support for parents whose children have been hospitalized and families who have experienced chil...

The Good Book Company

9781784989736

Pub Date: 5/1/24

$15.99 USD

B-format Paperback

160 Pages

Carton Qty: 0

Religion / Christian Living

REL012120

7.8 in H | 5.1 in W | 0.3 in T

| 0.4 lb Wt

21.99

Beautiful Freedom

How the Bible Shapes Your View of Appearance, Food, and Fitness

Stacy Reaoch

Explore God’s priorities for the way you live, eat and exercise.

Summary

Every day we are exposed to messages about health, food, exercise and looking good. It's hard not to get swept along with it all; in fact, it’s easy to end up caring too much about these things and even to feel trapped trying to live up to the ideals that we see in the media.

Author Stacy Reaoch points you to the Bible to find freedom! The Bible tells us that our physical selves do matter. But it also invites us to think about our bodies in a God-centered way—helping us to reset and find a balanced approach that is grounded in our faith.

Beautiful Freedom is an invitation to love the body God gave you and to explore his priorities for the ways in which you live, eat and exercise.

This book will help you find freedom from damaging narratives about weight, fitness, appearance and ageing. Even better, it will turn your gaze towards Jesus and help you love him more and more.

Reflection questions at the end of each chapter are useful both for personal reflection and group study.

THE GOOD BOOK COMPANY TGBC - January 2024 Page 5
42%

THE ACTION BIBLE: FAITH IN ACTION EDITION

SERGIO CARIELLO

This engaging reimagining of the mega-selling book The Action Bible combines 230 epic stories of biblical heroes with vibrant comic book–style illustrations and an immersive online experience. Young readers will explore seven dynamic attributes of God’s story, earn Faith in Action Badges representing those qualities, and discover even more through a QR code in every story that takes them to a safe online adventure of games, videos, spiritual activities, and more.

Since its release in 2010, The Action Bible has received widespread acclaim for its high-energy, engaging graphics and more than 230 spiritually transformative Bible stories. Introducing the Faith in Action program, which reinvents the bestselling comic book–style Bible with a systematic approach to experiencing the Word of God for the next generation.

In addition to a complete interior color redesign, this exciting edition includes these all-new features:

• The Faith in Action system, which gives young readers an easy-to-navigate and engaging experience for exploring the Bible through themes that connect directly to their felt needs.

• A Faith in Action Badge for each story that corresponds with one of seven biblical attributes: Courage, Faith, Hope, Love, Service, Trust, and Wisdom.

• A discoverable QR code in every story that takes readers to a safe online experience to explore engaging content such as videos, games, a digital Scripture index, prayers, Bible facts, devotions, playlists, reading plans, interactive maps, Bible study sessions, and more.

• A reading challenge chart to spur young readers on to discover God's Word.

With all the intrigue of a graphic novel and all the truth of God’s Word, The Action Bible: Faith in Action Edition satisfies the curious minds and adventurous hearts of today’s young learners, guiding them to connect more deeply with God’s story, develop a richer relationship with their Savior, and grow in their compassion for the world around them.

SPECS

Format Hardback | Retail $50.99 | Trim 6.625 x 10.125

Pages 832 | ISBN 978-0-8307-8700-5 | Pub Date February 6, 2024

Category Juvenile Nonfiction/Religion/Bible Stories/General Selling Territory Worldwide

ABOUT THE ILLUSTRATOR

Born in Brazil, SergioCariello has loved drawing since childhood. He has worked for Marvel Comics and DC Comics, and has illustrated Batman, Spider-Man, Superman, Iron Man, Wonder Woman, and dozens more characters. Sergio loves flying drones and attending comic book conventions to stay connected with his peers and fans, but he especially enjoys telling people about Jesus through his illustrations and teaching God’s Word when he travels.

Summer 2024 NEW RELEASES
UP CLOSE header shelftalker 159245 2' x 3' floor display ISBN-13 SHORT ITEM # PRODUCT THIS ENDCAP CAN HOLD: SLEEVE QTY 9780830787005 157429The Action Bible: Faith in Action Edition 3 9780830777440 146992The Action Bible 3 9780830782932 152531The Action Bible: Heroes and Villains 8 9780830772544 144641The NIV Action Study Bible 3 9780830785292 154311The NIV Action Study Bible – Premium Edition Repack 3 9781434708717 134131The Action Bible Study Bible ESV 3 9780781412964 134937 The Action Bible Study Bible ESV – Gray 3 9781434709080 134936The Action Bible Study Bible ESV – Lavender 3 9780830782918 152530The Action Bible New Testament 8 9780781407274 107597 The Action Bible Devotional 6 9780830778980 149325The Action Bible Anytime Devotions 8 9780781414203 137415The Action Storybook Bible 6 9780830784172 152884The Action Bible Spanish Expanded Edition 3 9780830784660 153360The Action Bible Easter 12 9780830784646 153359 The Action Bible Christmas 12
shelftalker
159243 -
header IN-STORE DISPLAY
159244 -

ABOUT THE AUTHOR

HORSES AND FRIENDS SERIES

MIRALEE FERRELL

The Horses and Friends series invites girls into the world of 13-year-old Kate Ferris, where wholesome values always shine bright as Kate and her friends train horses, solve mysteries, and learn to live out their faith.

Rebel Horse Rescue: The fifth book in Miralee Ferrell’s popular Horses and Friends series, Rebel Horse Rescue takes readers on a hunt to figure out why one new horse arrived at the stable unexpectedly—while others are mysteriously disappearing.

Ideal for girls who love horses, God, and fun adventures, this engaging chapter book celebrates the unique ways God made us. Rebel Horse Rescue includes author insights, a story-based recipe, and discussion questions to help young readers live out their faith.

Trouble on the Trail: The sixth book in the Horses and Friends series by Miralee Ferrell offers young readers adventures on the trail as Kate and her friends must stop thieves from taking a hermit’s secret gold in the Cascade Mountains.

Another great adventure for girls who love horses, Trouble on the Trail includes author insights, a story-based recipe, and discussion questions to help young readers make wise choices and build strong relationships.

SPECS

Format Paperback | Retail $13.99 | Trim 5.25 x 7.5

Pages 224 | Pub Date June 4, 2024

Category Juvenile Fiction/Religious/Christian/Friendship

Selling Territory Worldwide

Format Paperback | Retail $13.99 | Trim 5.25 x 7.5

Pages 204 | Pub Date June 4, 2024

Category Juvenile Fiction/Religious/Christian/Friendship

Selling Territory Worldwide

Rebel Horse Rescue #5

ISBN 978-0-8307-8768-5

Miralee Ferrell is the award-winning author of more than twenty-five books for children and adults, several of which are now television movies. Miralee and her husband live on eleven acres near the Columbia River Gorge in Washington State, where she loves horseback riding and hiking on wooded trails near her home.

for girls ages 9-13

Trouble on The Trail #6

ISBN 978-0-8307-8770-8

OTHER TITLES INCLUDE:

A Horse for Kate #1 Silver Spurs #2 Mystery Rider #3 Blue Ribbon Trail Ride #4

God Made Sounds Soft and Loud

Previous:

ABOUT THE AUTHOR

A mother of two humans plus a Weimaraner, Laura Derico has been writing and editing children’s and adult books for more than twenty-five years. She loves creating books to delight the youngest readers and lead them closer to God.

GOD MADE ALL OF ME SERIES LAURA DERICO

These two vibrant additions to the God Made All of Me board book series highlight color, sound, and the joy of new discoveries.

The latest charming board books in the God Made All of Me series celebrate color, noise, and every child’s unique experience of the world. Snuggle up with little ones to enjoy:

God Made Colors Oh So Bright: Apple red, sky blue, grass green, or snowy white—God made every color in sight!

God Made Sounds Soft and Loud: From loud crashes to quiet whooshes, God made every sound to hear!

The companion books to the popular titles God Made Stop and Go and God Made Happy, Sad, and Mad, these new additions to the God Made All of Me series are a fun way to teach babies and preschoolers how God shows His love everywhere!

SPECS

Format Board Book | Retail $12.49 | Trim 6 x 6

Pages 16 | Pub Date July 2, 2024

Category Juvenile Nonfiction/Religious/Christian/Learning Concepts

Selling Territory Worldwide

God Made Sounds

Soft and Loud

ISBN 978-0-8307-8433-2

God Made Colors

Oh So Bright

ISBN 978-0-8307-8434-9

Derico Illustrated by Anita Schmidt
Laura
42%

7 x 9.5 Paperback / 112 pages

ISBN: 978-0-8024-2243-9 / $20.99 CAN Kids / Juvenile / Non-Fiction

ESTHER: Becoming a Girl of Purpose -- True Girl Bible Study --

If you’ve ever felt inadequate or pushed into circumstances that are overwhelming, the book of Esther is for you.

Esther was given one of the world’s hardest assignments: to protect God’s special people from an evil plan. But it wasn’t because she was extra-brave or super-extraordinary. In fact, other than her beauty, she was a normal girl. But her life reminds us that every True Girl has a purpose and that it sometimes takes great patience to live it out.

So, what’s YOUR purpose? (You didn’t come with an instruction tag!) Well, if you’re a Christian… the Bible helps you understand what God wants you to do in life. It’s our instruction manual! And there’s no better place to begin to understand your calling than by studying the life of Esther who lived her purpose out so very well.

Esther: Becoming a Girl of Purpose (4th in series)

PRIMARY AUDIENCE

Girls ages 8-12

NOTABLE FEATURES

- An in-depth Bible study of Esther for girls to learn the character qualities that define being a true girl after God’s heart

-Fourth release in a set of four by Dannah Gresh, host of the True Girl podcast

PREVIOUS IN SERIES:

MIRIAM 978-0-8024-2241-5

$19.49

DANNAH GRESH is the best-selling author, speaker, and creator of True Girl, America’s most popular tween stage show for moms and daughters. She is considered one of the leading experts on the subjects of sexual purity, modesty, and parenting tweens and teens. More than 20,000 leaders and 100,000 moms have taught her curriculum and over 350,000 people have attended her live shows and retreats. Dannah has recently begun a new partnership with Nancy DeMoss Wolgemuth through Revive Our Hearts, often serving as a co-host on ROH’s radio broadcast and collaborating on other initiatives. She’s been a guest on CNN, Fox News, and the 700 Club and is a frequent guest on Focus on the Family and Family Life. She lives in State College, Pennsylvania with her husband, Bob, and is a recent new grandma of twin baby girls.

AUGUST 2024
MARY 978-0-8024-2242-2 $20.99 RUTH 978-0-8024-2222-4 $19.49

Moody Publishers 9780802432803

Pub Date: 6/4/24

$9.99 USD Trade Paperback

160 Pages

Carton Qty: 84

Ages 8 to 12

Juvenile Fiction / Religious

JUV033240

Series: The Ben Washington

Series

7.5 in H | 5.5 in W | 0.4 in T | 0.4 lb Wt

13.99

Ben Washington is the Newbie on the Block

Moody Publishers

9780802432193

Pub Date: 5/7/24

$12.99 USD

Trade Paperback

128 Pages

Carton Qty: 76

Religion / Christian

Education

REL091000

9 in H | 6 in W | 0.3 in T |

0.5 lb Wt

17.99

KIDS

Ben’s life has been upended. He’s leaving Atlanta. His mom’s having a baby. He desperately wants a dog. Who said being twelve is easy?

Meet Ben Washington. He’s about to leave the place he loves for a new town—population: near nothing. Sixth grade is univer...

ages 8-12

Summary

Ben’s life has been upended. He’s leaving Atlanta. His mom’s having a baby. He desperately wants a dog. Who said being twelve is easy?

Meet Ben Washington. He’s about to leave the place he loves for a new town—population: near nothing. Sixth grade is universally bumpy. And starting school in a pocket-sized town where no one looks like you is going to be an even bigger challenge.

Is there a friend for Ben in Radnor Falls? What is he going to do about the trio of bullies who seem far too old to still be in middle school? And what about the mystery of “Spooky Fred,” the town outsider? What has Fred done, and what will Ben do when he finds out? Will Ben come to love the slime green house with creaky floors and attic bedroom? Read this story of friendship, faith, and finding God in the hard spaces of life to find out.

Nicole C Mullen's daughter

God Is For Us

A Kids Bible Study on Belonging to Christ (Romans 8)

ages 8-12

God is for me—the most important truth to ever capture your kid’s heart.

It’s important that our kids know what’s true about God and themselves . . . to know what God has done and is doing for them. Focusing on Romans 8—one of the most studied and beloved chapters of the Bible—God is For Us cements ...

Summary

Helping kids fall in love with God and His Word as they study the Bible for themselves.

God is for me—the most important truth to ever capture your kid’s heart.

We often encourage kids to learn algebra, science, instruments, and athletics. These are all noble and good things. But what’s most important is that our kids know what’s true about God and themselves . . . to know what God has done and is doing for them. What happens when a child believes that God is for me? It’s no understatement to say that your child will be changed through this all-important truth.

Focusing on Romans 8—one of the most studied and beloved chapters of the Bible—God is For Us cements kids in God’s most precious, life-changing promises. Kids discover:

MOODY PUBLISHERS moody a - January 2024 Page 1

Northfield Publishing

9780802432995

Pub Date: 8/6/24

$12.99 USD

Trade Paperback

128 Pages

Carton Qty: 92

Religion / Christian Living

REL012000

9.5 in H | 7 in W | 0.3 in T | 0.4 lb Wt

17.99

God Speaks Your Love Language Workbook

The essential companion book for God Speaks Your Love Language

Do you want to feel God’s love more personally?

ADULT

These ten lessons—created to strengthen and deepen your relationship with God and others—provide workable strategies for applying the principles of God Speaks Your Love Language.

This workbo...

Summary

The essential companion book for God Speaks Your Love Language

Do you want to feel God’s love more personally?

These ten lessons—created to strengthen and deepen your relationship with God and others—provide workable strategies for applying the principles of God Speaks Your Love Language

This workbook includes interactive questions, quizzes, charts, and diagrams—all aimed at helping you better experience love, express love, and identify areas for development. Whether you’re working with this book as an individual, a couple, or in a small group, let patience, grace, and humor be your companions.

As you begin to identify the variety of languages God uses to communicate love to you and others, you can learn to lovingly respond to God and to those around you. No matter what love language you prefer, you will become more deeply connected with God. And you will see this bond transform all your relationships.

This interactive workbook helps you take the joy-filled insights of God Speaks Your Love Language and put them into practice!

Northfield Publishing

9780802433046

Pub Date: 8/6/24

$12.99 USD

Trade Paperback

128 Pages

Carton Qty: 92

Religion / Christian Living

REL012070

9.5 in H | 7 in W | 0.3 in T |

0.4 lb Wt

17.99

The 5 Love Languages Singles Edition Workbook

The essential companion book for The 5 Love Languages® Singles Edition

You want to be able to love effectively and truly feel loved in return. The 5 Love Languages®Singles Edition Workbook provides the sure steps to meaningful, relational connection.

These ten lessons—created to strengthen and deepen...

Summary

The essential companion book for The 5 Love Languages® Singles Edition

You want to be able to love effectively and truly feel loved in return. The 5 Love Languages®Singles Edition Workbook provides the sure steps to meaningful, relational connection.

These ten lessons—created to strengthen and deepen your relationship with God and others—provide workable strategies for applying the principles of The 5 Love Languages Singles Edition.

This workbook includes interactive questions, quizzes, charts, and diagrams—all aimed at helping you better experience love, express love, and identify areas for development. Whether you want to be closer to your parents, reach out more to your friends, or give dating another try, this workbook gives you the confidence to love well.

This companion book—designed for individuals or small groups—helps you take the joy-filled insights of The 5 Love Languages Singles Edition and put them into practice.

NORTHFIELD PUBLISHING moody a - January 2024 Page 2

Northfield Publishing

9780802418401

Pub Date: 1/1/19

$17.99 USD

Trade Paperback

256 Pages

Carton Qty: 56

Business & Economics / Leadership

BUS071000

8.5 in H | 5.5 in W | 0.5 in T | 0.6 lb Wt

24.99

The 5 Languages of Appreciation in the Workplace

Empowering Organizations by Encouraging People

The 5 Languages of Appreciation in the Workplace: Empowering Organizations by Encouraging People, by Gary Chapman and Paul White, brings the love language concept to the workplace. This book will teach you how to improve job satisfaction, create more positive relationships between managers and emplo...

Summary

OVER 450,000 COPIES SOLD!

Based on the #1 New York Times bestseller The 5 Love Languages®(over 12 million copies sold), Dramatically improve workplace relationships simply by learning your coworkers’ language of appreciation.

This book will give you the tools to improve staff morale, create a more positive workplace, and increase employee engagement. How? By teaching you to effectively communicate authentic appreciation and encouragement to employees, co-workers, and leaders. Most relational problems in organizations flow from this question: do people feel appreciated? This book will help you answer “Yes!”

A bestseller—having sold over 450,000 copies and translated into 16 languages—this book has proven to be effective and valuable in diverse settings. Its principles about human behavior have helped businesses, non-profits, hospitals, schools, government agencies, and organizations with remote workers.

PLUS! Each book contains a free access code for taking the online Motivating By Appreciation (MBA) Inventory (does not apply to purchases of used books). The assessment identifies a person’...

Northfield Publishing

9780802412706

Pub Date: 1/1/15

$16.99 USD

Trade Paperback

208 Pages

Carton Qty: 72

Family & Relationships / Marriage & Long-Term Relationships

FAM030000

8.5 in H | 5.5 in W | 0.4 in T | 0.5 lb Wt

23.49

The 5 Love Languages

The Secret

to

Love that Lasts

Over 20 million copies sold!

New coverwill have this new logo

A perennial New York Times bestseller for over a decade.

Falling in love is easy. Staying in love—that’s the challenge! How can you keep your relationship fresh and growing amid the demands and conflicts and just plain boredom of everyday life?

In the #1 New York Times best...

Summary

Over 20 million copies sold!

A perennial New York Times bestseller for over a decade!

Falling in love is easy. Staying in love—that’s the challenge. How can you keep your relationship fresh and growing amid the demands, conflicts, and just plain boredom of everyday life?

In the #1 New York Times international bestseller The 5 Love Languages®, you’ll discover the secret that has transformed millions of relationships worldwide. Whether your relationship is flourishing or failing, Dr. Gary Chapman’s proven approach to showing and receiving love will help you experience deeper and richer levels of intimacy with your partner—starting today.

The 5 Love Languages® is as practical as it is insightful. Updated to reflect the complexities of relationships today, this new edition reveals intrinsic truths and applies relevant, actionable wisdom in ways that work.

Includes the Love Language assessment so you can discover your love language and that of your loved one.

NORTHFIELD PUBLISHING
Updated

Northfield Publishing

9780802412843

Pub Date: 5/1/16

$15.99 USD

Trade Paperback

304 Pages

Carton Qty: 56

Family & Relationships / Parenting

FAM034000

8.5 in H | 5.5 in W | 0.6 in T | 0.7 lb Wt

21.99

The 5 Love Languages of Teenagers

The Secret to Loving Teens Effectively

Over 600,000 copies sold!

New coverwill have this new logo

Socially, mentally, and spiritually, teenagers face a variety of pressures and stresses each day. Despite these pressures, it is still parents who can influence teens the most, and The 5 Love Languages of Teenagers parents to make the most of that opportunity.

In this ...

Summary

Over 600,000 copies sold! Socially, mentally, and spiritually, teenagers face a variety of pressures and stresses each day. Despite these pressures, it is still parents who can influence teens the most, and Languages of Teenagers equips parents to make the most of that opportunity.

In this adaptation of the #1 New York Times bestseller The 5 Love Languages® (more than 20 million copies sold), Dr. Gary Chapman explores the world in which teenagers live, explains their developmental changes, and gives tools to help you identify and appropriately communicate in your teen's love language.

Get practical tips for how to:

Express love to your teen effectively

Navigate the key issues in your teen’s life, including anger and independence

Set boundaries that are enforced with discipline and consequences

Support and love your teen when he or she fails

Get ready to discover how the principles of the five love languages can really work in the life of your teenage and family.

Moody Publishers

9780802432186

Pub Date: 5/7/24

$15.99 USD

Trade Paperback

160 Pages

Carton Qty: 72

Religion / Christian Living

REL012040

8.5 in H | 5.5 in W | 0.4 in T

| 0.4 lb Wt

21.99

Loneliness

Don't Hate it or Waste it. Redeem it.

How the gospel of Jesus empowers us to redeem the deep ache of loneliness.

For years, Steve DeWitt was the only never married megachurch pastor in the United States. Over some 8,000 days as an adult single, and now eleven years of marriage, Pastor Steve has a unique perspective on solitude and alonen...

Summary

How the gospel of Jesus empowers us to redeem the deep ache of loneliness.

For years, Steve DeWitt was the only never married megachurch pastor in the United States. This put him in proximity to thousands of people, yet he lived his daily life alone. Over some 8,000 days as an adult single, and now eleven years of marriage, Pastor Steve has a unique perspective on solitude and aloneness. Loneliness addresses this pervasive ache from his personal experience and pastoral viewpoint.

In a time when loneliness is at an all-time high, this book—rich with biblical truth and practical help—speaks to all hearts. DeWitt explores the invitation of Jesus when our hearts feel alone and isolated. Writing on topics that affect us and the ones we love—such as loneliness and the gospel, loneliness and singleness, loneliness and marriage, and loneliness and leadership—he shows us the way out of our pain and into relational flourishing with God and others.

Is there a sweetness or a blessing offered in the valley of loneliness? DeWitt has discovered that there absolutely is. Loneliness doesn’t have to be o...

NORTHFIELD PUBLISHING moody a - January 2024 Page 4
45%

IVP Kids

9781514006696

Pub Date: 3/12/24

$18.00 USD

Hardcover

32 Pages

Carton Qty: 40

Ages 4 to 8

Juvenile Fiction / Social

Themes

JUV039070

9 in H | 9 in W | 0.4 in T | 0.8 lb Wt

24.99

Zion Learns to See Opening Our Eyes to Homelessness

ages 4-8

KIDS

When Zion joins her dad at work, she discovers that a day at the community center brings new and wonderful people into her life. Inspired by real events, this children's book allows kids and adults to learn with Zion about people experiencing homelessness and see how she is moved to respond as she r...

Summary

Every person matters to God. And that means every person should matter to us.

Zion has no idea what she's getting into when she decides to join her dad at his work on Saturday. But she quickly discovers that a day at the community center brings new and wonderful people into her life. Join Zion as she learns about people experiencing homelessness, and see how she is moved to respond as she recognizes that all people matter to God.

Inspired by real-life events, this story written by Terence Lester and Zion Lester, and illustrated by Subi Bosa, will be enjoyed by children and the adults who read with them. Also included is a note from the author to encourage further conversation about the content.

Discover IVP Kids and share with children the things that matter to God!

IVP Kids

9781514007952

Pub Date: 5/7/24

$16.00 USD

Hardcover

32 Pages

Carton Qty: 40

Ages 4 to 8

Juvenile Fiction / Religious JUV033090

9 in H | 9 in W | 1.5 lb Wt

21.99

Not Finished Yet Trusting God with All My Feelings

ages 4-8

Gran's art studio is a special place. Not only is it where Wren and Gran paint, but it's also where they talk about all the good and hard stuff of life—to each other, and to God. In this gentle story by Sharon Garlough Brown, young readers will join Wren as she explores her feelings and discovers th...

Summary

Sometimes, you see, Wren and Gran didn't paint flowers or clouds or birds or trees. Sometimes they painted their feelings. She and Gran called it "painting prayers."

Gran's art studio is one of Wren's favorite places in the world. Not only is it where Wren and Gran paint, but it's also where they talk about all the good and hard stuff of life—to each other, and to God. Join young Wren as she explores her feelings and discovers that God welcomes our honest prayers.

This gentle story by bestselling Christian novelist Sharon Garlough Brown, paired with exquisite illustrations from Jessica Linn Evans, will be enjoyed by children as well as the adults who read with them. Also included is a note from the author to encourage further conversation about the content.

Discover IVP Kids and share with children the things that matter to God!

IVP KIDS ivp1 - January 2024 Page 1
42%

My Toddler Bible

Timeless Stories for Little Ones

Cecilie Fodor; illustrated by Jennifer Davison

A perfect Bible for little hands

illed with rich and colorful illustrations and simple text faithful to the Bible, My is perfect for children ages 1 to 3. The twenty-eight Bible stories include Scripture references and are taken equally from both the Old and New Testaments to form a complete arc

Toddlers will love the built-in handle to carry their Bible with them everywhere—including church! And parents and grandparents will love that its compact form and bright pictures will inspire their little ones to engage with Scripture from an early age.

is an editor at Scandinavia Publishing House and the author of Parables of

Jennifer Davison is a children’s book illustrator from Ireland who has worked on over forty picture books for publishers around the world.

• God’s story from creation to Pentecost

• Built-in handle sized for toddlers’ hands

• All twenty-eight stories include Scripture references

978-0-8254-4866-9 • $17.99 Board Book

6.25 x 6.25 • 32 pages

JUVENILE NONFICTION / Religion / Bible Stories / General

February 20, 2024

www.kregel.com

RELATED T ITLES UNIQUE SELLING POINTS My God Loves Me Bible 978-0-8254-4632-0 • $17.99
4 5 WHEN GOD MADE IT ALL Genesis 1-2 In the beginning, God created everything. He made the blue skies and the wavy seas. He made tall trees and tiny flowers. He made strong elephants and fluttering butterflies, and then He made Adam and Eve. THE DAY EVERYTHING CHANGED Genesis 3 At first, everything was good. Adam and Eve loved God, and God loved them. But Adam and Eve wanted to do things their own way instead of God’s way. They sinned against God. God still loved them, but He had to send them away. 20 21 JESUS IS BAPTIZED Luke 3:15-22 When Jesus grew up, He got baptized in a big river. A light came from heaven, God’s Spirit came down like a dove, and everyone heard God say, “Jesus is My Son and I love Him. He is the perfect One!” JESUS CHOOSES TWELVE FRIENDS Luke 6:12-16 Jesus chose twelve men to be His disciples. Jesus’ disciples followed Him everywhere, and He taught them about God and what it means to be a child of God. Jesus loved His disciples, and they loved Him.
Candle Bible for Toddlers 978-0-8254-4684-9 • $24.99

My Bigger Search and Find Bible

Jacob Vium-Olesen; illustrated by Pamela Mariel-Barbieri

Fun-filled way for kids to learn how BIG the love

rom the very first page, this fun book is designed to help kids ages 4 to 6 understand that God’s love for us is bigger than we can imagine!

Each page expands to four times its size. And in every colorful Bible scene, a child can search and find Bible friends, animals, and other items for even more interac-

Packed with cheerful illustrations and a world of play, children will want to come back to this unique Bible over and over, fostering a love of God’s Word and a new understanding of his expansive love.

Jacob Vium-Olesen is the CEO of Scandinavia Publishing House and has authored several children’s books, including My First Memory Verse Bible and Good

Pamela Mariel-Barbieri is a freelance illustrator based out of a suburb of Buenos Aires, Argentina. She has collaborated with several publishers in her career and loves to draw outdoor scenes, all kinds of cute animals, and playful kids.

God’s Love in a Nutshell 978-0-8254-4802-7 • $20.99

Made Us Just Right 978-0-8254-4663-4 • $16.49

• Fun, expansive design unfolds to four times it s size

• Playful, colorful illustrations catch the eye

• A perfec t gift for kids who love seekand-find puzzles

978-0-8254-4847-8 • $17.99 Board Book

8 x 8 • JUVENILE NONFICTION / Religion / Bible Stories / General

February 20, 2024

www.kregel.com
RELATED TITLES UNIQUE SELLING POINTS God

I Dream a Dream for You

Bob Hostetler; illustrated by Benedetta Capriotti

Read-aloud bedtime book for toddlers

With its sweet bedtime rhymes , I Dream a Dream for You resembles the classic title The Going to Bed Book by Sandra Boynton. A family of red pandas make their home in the forest. When it’s time for bed, Mom and Dad tuck in their three kiddos, and as they all drift to sleep, dreams come to life through the vibrant pictures and story. Parents or grandparents will enjoy reading this sweet bedtime rhyme, filled with dreams and aspirations for their little ones. With amazing, colorful illustrations, this read-to-me story richly shows the love of a faith-filled family with creative, interesting scenes that kids will love to see over and over—and those who read it to them will experience the blessing of God’s love, which is meant to be shown and shared with families. Bob Hostetler is an award-winning author, literary agent, and international speaker. His first children’s book, Don’t Close Your Eyes, and its subsequent success, was a dream come true for him. His fifty other books include the award-winning Don’t Check Your Brains at the Door (co-authored with Josh McDowell) and The Bard and the Bible: A Shakespeare Devotional . He has won two Gold Medallion Awards, four Ohio Associated Press awards, and a Selah “Book of the Year” honor. He and his wife make their home in Nevada.

Benedetta Capriotti was born in Italy, in a seaside town of the central region Marche. Since she was a child, she has had a great passion for drawing and art. In high school she would draw on Greek and Latin books, so she chose to attend a professional School of Fashion and Technical Drawing. Afterward she joined the Illustration class at the International School of Comics in Rome. In addition to drawing, she likes reading, traveling, and animals, and would like to live in the English countryside.

• Animal family is relatable and inclusive to readers

• This read-to-me inspires readers to dream big dreams for their family

• Examples of kindness, sharing, and faith-based themes

978-0-8254-4858-4

• $16.49

Padded Board Book

7 x 7 • 20 pages

JUVENILE FICTION / Religious / Christian / Bedtime & Dreams

June 18, 2024

kregel.com
RELATE
D TITLES
UNIQU E SELLING POINTS My Bedtime Bible Prayers 978-0-8254-4633-7 • $14.99 When God Tucks in the Day 978-0-8254-5524-7 • $17.99 ages 3-6

Can You Find Me in the Bible?

Andrew Newton; illustrated by Mario Gushiken

Kids six and up will enjoy this search-and-find challenge!

This fun seek-and-find book includes twelve Bible scenes from the Old and New Testaments and introduces children to some of the most well-known Bible stories and characters. In a fun twist, children will not only be looking for important objects in the scenes, but also for misplaced people! Each story is told by a famous Bible character from another story that somehow ended up in the wrong place. This makes for fun moments as the characters (and readers) try to figure out where they are.

Andrew Newton is a secondary English teacher and freelance editor/proofreader who has been writing in various forms for over a decade. He lives in Michigan with his wife and child, where he draws inspiration from the people and natural beauty around him.

Mario Gushiken is a digital artist from São Paulo, Brazil. He grew up drawing, watching animated TV series from Cartoon Network, and playing video games. These animations and games inspired him to start drawing in a cartoon style.

ages 6+

• Popular seek-and-find format on every spread

• Challenges readers beyond just recognizing each Bible story

• Spurs interactions between children and adults

978-0-8254-4848-5 • $16.49

Hardcover

8.5 x 11 • 32 pages JUVENILE NONFICTION / Religion / Bible Stories / General

April 16, 2024

kregel.com
D TITLES
E
RELATE
UNIQU
SELLING POINTS
Big God, Little Me Activity Book Ages 4-7 978-0-8254-4642-9 • $21.99 Big God, Little Me Activity Book Ages 7+ 978-0-8254-4643-6 • $
21.99

Kregel Publications

9780825442988

Pub Date: 4/16/24

$8.99 USD

Paperback

160 Pages

Carton Qty: 0

Grades 3 to 6

Juvenile Fiction / Religious

JUV033010

Series: Goldtown Adventures

8.5 in | 5.5 in

12.49

Valley of Treasure

Summary

The hunt for the lost gold is on!

#5 Goldtown Adventures

Kregel Publications

9780825442995

Pub Date: 4/16/24

$8.99 USD

Paperback

168 Pages

Carton Qty: 0

Grades 3 to 6

Juvenile Fiction / Religious

JUV033010

Series: Goldtown Adventures

8.5 in | 5.5 in

12.49

Jem Coulter and his friends celebrate the end of the Civil War in their town with firecrackers, parades, and anticipation for a bear-and-bull fight. But chaos ensues when a bull breaks loose, causing wood and metal to rain down and break his cousin Nathan's legs. With Nathan's parents unable to afford a San Francisco surgeon, the friends devise a plan to raise money. Jem, Strike-It-Rich Sam, and his little sister Ellie embark on a quest to recover lost gold. Will they find their treasure in the valley, or will they have to strike more gold in order to help Nathan?

Ocean of No Escape

Summary

#6 Goldtown Adventures

ages 8-12 ages 8-12

Is escape even possible when you've been shanghaied?

Jem Coulter, his family, and Strike-It-Rich Sam journey to San Francisco with the newfound gold to see if surgery can fix Nathan's broken legs. The uncertainty of Nathan's recovery leaves Jem bored and worried, so he goes to explore the waterfront. The merchant ships look exciting--where could they be going?

A sailor's invitation turns into an unexpected kidnapping that forces Jem into the life of a cabin boy. Forced to eat awful food and filled with a fear he'll never see his family again, Jem wonders if he should jump ship. Join Jem on the deck as he navigates the rough seas.

KREGEL PUBLICATIONS kregel 1 - January 2024 Page 1

Kregel Publications

9780825447983

Pub Date: 1/16/24

$17.99 USD

Paperback

200 Pages

Carton Qty: 0

5.5 in | 8.5 in

24.99

Once Upon a Divorce Walking with God After "The End"

Summary

CHRISTIAN LIVING

What happens when the author of happily-ever-after romances gets divorced?

As a divorce survivor and single mom, Betsy St. Amant Haddox-known for her charming rom-coms-shares her own raw, unfiltered story of what happens after the fairy tale ends. Complete with plenty of what-not-to-do tales, Once Upon a Divorce features what she learned on her bumbling journey to wholeness.

In her humorous, vulnerable, and authentic way, Betsy recounts how she navigated her ex-husband's abandonment and the seeming silence from heaven that followed. She takes readers through the thorny path of figuring out life as a single mother, healing from loss, and finding God to be faithful through it all. Once Upon a Divorce proves that the end of a marriage isn't the end of the story.

Christian women will embrace this book because it helps them feel seen and validated amid their own relationship storms. And they will appreciate the biblical perspective Betsy brings as she tackles divorce and its aftermath from a Christian perspective, not a "girl power" one.

Join Betsy as she shares heartfelt advice for the "now ...

Kregel Publications

9780825448188

Pub Date: 2/13/24

$19.99 USD

Paperback

256 Pages

Carton Qty: 0

Religion / Christian Living

REL012080

5.5 in | 8.5 in

27.49

Praying Personalities

Finding Your Natural Prayer Style

Summary

Discover the particular way God designed you to connect with prayer

You should pray in the morning. You should write out your prayers. You should make prayer lists and pray through them every day. You should pray with others or out loud. We've all heard the "you shoulds" of prayer from pulpits, presenters, and well-meaning friends. But when none of these ways to pray feel natural, what's next?

Janet Holm McHenry has studied prayer extensively, and the one thing she knows for sure is that there's no one-size-fits-all way to pray. Instead, there are different styles of prayer-and by discovering the style most instinctive to each individual personality, staying in touch with God throughout the day becomes simple and all the more joyful.

In this book, the author helps readers determine their particular praying personality by examining the praying styles of biblical people, spiritual gifts, and various ideas about personality, including the classic temperaments, the Enneagram, and more. McHenry includes scores of bulleted suggestions for developing a praying lifestyle that works for individu...

KREGEL PUBLICATIONS kregel 1 - January 2024 Page 7
42%
40%

E4884 9781684344888

Coloring Activity Books

Easter / ages 2-4

E4885 9781684344895

Coloring Activity Books

Easter / ages 5-7 / NIV

E4886 9781684344901

Coloring Activity Books

Easter / ages 8-10 / NIV

E4888 9781684345168

Coloring Activity Books

General / ages 2-4

E4889 9781684345175

Coloring Activity Books / General / ages 5-7

E4890 9781684345182

Coloring Activity Books

General / ages 8-10 / NIV

Coloring & Activity Books for Kids $3.99 each Fill in the blanks with the missing words. Then write them in the grid where they belong. Palm Sunday is the first day of Holy Week. When Jesus arrived in Jerusalem, He fulfilled an Old Testament prophecy. greatly, Zion! Daughter Jerusalem! See, your comes to you. and victorious, and on a on a the of a donkey. ZECHARIAH 9:9 NIV 13 The Sower (Mark 4:1–20) A farmer’s seed grows in good soil. Our lives will grow good things when we plant God’s Word in our hearts. 16 2024 Warner Press, nc All rights reserved E4884 Jesus is living in heaven now. If we believe in Him, we will live in heaven too! Color the picture. 2 nc All rights reserved E4885 T= R= M= W= K= A= H= I= O= S= Y= U= E= P= D= N= L= Some Jewish leaders met to talk about Jesus. “Jesus is doing many miracles. If we let this go on, everyone will believe in Him,” they said. What did the leaders fear would happen next? Use the code to find out. From John 11:48 (NIV) 14 An Angel Strengthens Jesus (Luke 22:39–44) After the Last Supper with His disciples, Jesus went to the garden to pray. Jesus knew He soon would die for the sins of everyone in the world. An angel came to Jesus and strengthened Him. 4 Paul said, “Our struggle is not against flesh and blood, but against the rulers, against the authorities, against the powers of this dark world and against the spiritualforces of evil in the heavenlyrealms.” (Ephesians 6:12 NIV) Circle the underlined words in the word search. Words may be hidden forwards, backwards, up, down, or diagonally. C L M K G B Y L E M E R G Q A C P N L Y N P V J A F K P U X J O C F M U L O J C A T K O J G I B E L S Y P Y G H D U J W S V P Y O H Y Y G O S R H C I L V N F E U J R R A K R S U L P O K A E Z F I I S Y B F S E M W V F T T M Y M R F C O R I E U D T I U S N O P F O Q A N D E A E I G O U K K L E M L L P K S T Z S K H M S G S Y H J E L B B O E G D G R Q Z V B U U O C U L X M Y E P I E B J R R R E H T C L L K N O T O Y Y E N M K R U N F S W U G H K S M L A E R
40%

9781684345199

9781684345212

E4887

9781684345205

Kids and Family Ministry: Spring/Summer 2024
9781684344918 Itty Bitty PACK 6 Easter / NIV $21.49 / Pk 6 (=$3.59 ea.)
Graduation Devotional Booklet PACK 6 $21.49 / Pk 6 (=$3.59 ea.)
Study
Bible
$24.99
Kids Affirmations PACK 6 $21.49 / Pk 6 (=$3.59 ea.) 3 The Search for Jesus John 11:54–57 Q P P A D D S C T R O P E R H X D V J G E P R J R W L U O U B U C L Z Z E F O F F R X K Z E R E V O S S A P R B P B E B E Q N J A Y R T N U O C U J L W S G X S U G C N N V S V N B S J E E T J L D T I O Y S S U S E J A K G R I T E H L H I L L I S I X H L K G D V A K E I O G N E S N Q G D E B G H A V L S P Y G Z E L Q G X U M T G T L E P E L H Z N S J P Q A F N A X M N G C L D R F A T X M M B O R H W B A Y Z E E A R S R O E V J R C L L W L D A A N W T U K T G K Z L B F E L A H E A D M U G O Q E Y U P U P L A N O M E R E C R V P A L W N C S E L P C S D U JESUS PUBLICLY PEOPLE JUDEA WITHDREW REGION WILDERNESS VILLAGE EPHRAIM DISCIPLES PASSOVER COUNTRY JERUSALEM CEREMONIAL CLEANSING TEMPLE COURTS FESTIVAL REPORT ARREST 2 The Plot to Kill Jesus John 11:47–53 C B P E R F O R M N G S N A M O R V H Q Q D E R E T T A C S L E P T N R E E J A R R U N R D E H N A S E Y F E W Q E H K X K E S W A Q C B F P L M F T B B N X S D V T S H N P W K A P T P W M K K E A X E X L M S V T E E M R E F I L L H L I O H P Q I B D C R V I S B S B D P T L E C C E G C Q K I E E K A R D T A X E N N N R N L F H S Q S E H E Z A I A B R O P Y S P J E H N T D Y B R T A H S Y J U O H L W O W Y S B S U X C U R F R A P S Q G E F M L O Z N G A S E P G M R M X Z M K A N N L L W P E V D E G R P H A R S E E S A F M J E T B T V H G N T E E M T B D M CHIEF PRIESTS PHARISEES MEETING SANHEDRIN JESUS PERFORMING SIGNS EVERYONE BELIEVE ROMANS TEMPLE NATION CAIAPHAS BETTER PERISH PROPHESIED SCATTERED CHILDREN PLOTTED LIFE

Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.