Thereisalottoexploreinourbrochure!Tomakenavigatingitalittleeasier,seethe sectionsandwhatpagetofindthemon,inthelistbelow.Ifthereisanyinformation thatyoucan’tfindinourbrochurepleaseemailourEducationteamandtheywillbe abletohelpyouwithyourquery. ABOUT US
MEET THE PRACTITIONERS
VISUAL AND DIGITAL ART WORKSHOPS
POETRY AND SPOKEN WORD WORKSHOPS
MUSIC WORKSHOPS
DRAMA WORKSHOPS
DANCE WORKSHOPS
CULTURE AND HERITAGE WORKSHOPS
MINDFULNESS WORKSHOPS
LANTERN
I am Kayleigh, the Education Officer here at Norden Farm Centre for the Arts, Maidenhead, running the department with Jess. I have enjoyed working with Maidenhead schools for the last 5 years. I’m more than happy to answer any queries and book in your workshops, just drop me a message!
The Farm Out programme for the 2024 - 2025 academic year includes workshops that have been handpicked for you, giving your students the chance to work on large 3D visual arts projects, learn new techniques, use new equipment or instruments and work collaboratively in the classroom.
All of the workshops we offer are led by professional, experienced arts practitioners. They are all experienced in working with school children and are DBS checked.
Don’t miss our special projects which run throughout the year including Lantern Making for the Lantern Parade, the Quest Family Fest Schools Project and Kite Making for the Summer Kite Festival.
I hope that there is something in this brochure which your students and team will enjoy. Seen something you fancy and want to tailor it to your current teaching? Let me know and I can speak to our artists to help make the perfect workshop for you and your students.
If you have any questions about the Farm Out programme, or about what Norden Farm can offer, please get in touch.
Norden Farm is an arts centre, run by the Norden Farm Centre Trust, a registered charity. We’re built on the site of an ancient farm on the outskirts of Maidenhead, near Altwood School. We are a thriving arts centre, averaging 150 events a term, and open 5 days a week
We are passionate about what we do and know that the arts have the power to change lives. We believe that everyone should have the chance to experience and participate in high quality, transformative and life enhancing arts events.
Through our education, participation and outreach programme, we provide a range of opportunities for the whole community We deliver a regular programme of classes and activities for children, young people and adults, produce special projects and support artists and the local creative community to create and present work.
The Farm Out Programme is supported by the Norden Farm Centre Trust and the Spoore, Merry and Rixman Foundation. The programme provides schools with access to professional artists, through workshops and performances
Primary Schools within the Old Borough of Maidenhead are allocated up to a maximum value of £400 to spend on workshops in their school at any point during the 2024/2025 academic year. To participate, schools pay an admin fee of £60 (inc VAT)
If you are unsure whether your school is eligible for the Farm Out allocation, please get in touch
For all bookings, final numbers must be confirmed, and full payment made (if required) at least two weeks before the date of the performance / workshop. No cancellations or amendments may be made after this time.
All prices are correct at the time of issuing th e subject to change.
ForschoolswithintheOldBoroughofMaidenheadaoneoff£60(incVAT) administrationfeewillbechargeduponthefirstbookingreceived
•Eachworkshopcanaccommodateupto30childrenmaximumatanyonetime.
•AllworkshoppricesareexcludingVAT.
•ForschoolswhichfalloutsideoftheOldBoroughofMaidenhead,thereisan additional20%administrationfeeperlistedworkshopprice.
Meet our wonderful team of creative professionals! In the mix we have award winning poets, fine artists, professional dancers and renowned theatre makers. We pride ourselves on offering you and your students the opportunity to engage with, and learn from, artists and practitioners with not only a vast range of skills but a fun and creative approach to learning.
Our brochure is split into the following categories:
Visual and Digital Arts | VDA
Poetry and Spoken Word | PSW
Music | MU
Drama | DR
Dance | DA
Culture and Heritage | CH
Mindfulness | MI
Our team are happy to tailor workshops for you - so if you can’t find what you want, just ask!
You can learn more about each practitioner over the next few pages.
Contact me at kayleigh.robinson@nordenfarm.org or call 01628 682563 and let me know the following: Your Chosen Workshop Suggested Dates Year Group and Number of Classes / Students Page 4
African Activities has been providing high quality, fun and thought-provoking workshops in schools and educational establishments across Britain since 2000. They offer the opportunity to engage with Black and African Culture by sharing superb creative artistic experiences that disrupt preconceptions, create community, drive excellence and break barriers
Nisha has worked on stage, in film and as a presenter on television. She is trained in Mime / physical theatre and studied at Darlington College of the Arts
BerkshirePrintmakershaveovertenyears experienceofrunningsilkscreenprinting workshopforschool,colleges,artcentresand lastyearventuredintorunningt-shirtprintingat festivalsTheyarepassionateaboutallthings silkscreenandtravelovertheSouthofEngland withtheirlargelibraryofplainandpatterned silkscreen,water-basedinksandsqueegees. Theyareinterestedinsustainabilityand incorporatethisintotheirworkshops.
StellaisaqualifiedChildren'sCreative MindfulnessPractitioner,sherunscreative sessionsfocusedoncultivatingself-compassion, self-expressionandkindnesstoboostselfesteem.Hersessionscombinecreativeplay,mini mindfulnessmoments,meditationandcraftina funandengagingworkshop.
CultureMix Arts is a steel pan music and carnival arts specialist providing workshops, tasters, demonstrations, talks and performances featuring the steel pan, how it is made, the history and origins and how it relates to British music culture. RASPO - Reading All Steel Percussion Orchestra is the cornerstone of CultureMix Art’s work enabling people of all ages and abilities to experience playing music in an accessible orchestra with a focus on young people who would not normally access music lessons.
Helenisalocalartist.ShehasadegreeinThree DimensionalDesign(Wood,Metal,Ceramicsand Glass)andhasworkedwithawidevarietyof peopleofallabilitiesduringhercareer.Shehas exhibitedbothlocallyandnationally.Helen primarilyworksinclayandhasrecentlybeen runningworkshopsforNordenFarmCentrefor theArts
Desree is a dynamic children's workshop facilitator with a background in drama studies and a passion for empowering individuals through creative expression. She has extensive experience working with diverse groups in schools, corporate settings, and theatres across the UK, delivering workshops that build confidence, enhance literacy, and inspire a love for the arts
Desree has developed wellbeing programs and has led creative writing and drama workshops in schools across the country.
Shannel Joseph, is the founder of Animation Expressions. She has 10 years experience in running workshops for children and has an Animation BA Animation is a great way to combine creative skills with digital learning. It is also a good way of expressing thoughts and ideas in an audio-visual format, ‘taking ART & ICT to infinity and beyond’.
The Little Tanks ethos is ‘building confidence through drama’. They aim to develop a child’s confidence by using drama skills and nurturing them to feel more comfortable when performing as well as in everyday life.
Mandinka Roots have been teaching children and adults about West African culture, both in the UK and abroad, since 2005 Oumar Alex Sagna is originally from Senegal where he worked as an artiste for many years Since coming to the UK in 2005, Oumar Alex has passed on his love of West African culture in a fun and exciting way.
SimonMoleisanacclaimedchildren’spoetand aNationalPoetryDayAmbassadorHehasover nyears’experienceusingrapandpoetryin mmunityandeducationsettings,including ojectswithGreatOrmondStreetHospitaland senalFootballClub.Histutorialvideoson uTubeareusedbyhundredsofthousandsof ildrenandteachersandbeenfeaturedonBBC Bitesize.Hehaspublishedthreepicturebooks.
James Parsons is a bestselling, internationally published cartoonist and the only full-time comic art teacher in the UK. Since 2005 he has delivered thousands of high energy comic art workshops in hundreds of schools around the country, as well as at museums, galleries, libraries and festivals. A dynamic, totally unique, and unforgettable creative experience is guaranteed every time!
Dr Marta Mathea Radwan is a conductor, vocalist, composer, arranger, music director, and workshop leader Marta has a wide education both as a conductor and a singer and holds a doctor of music She has led over a dozen choirs, of up to 100 singers, and also led big band and orchestra. She is also a dedicated educator with experience in teaching music from primary school to university. Her main passion is jazz and vocal improvisation. She led Circle Songs and Vocal Improvisation workshops around Europe and worldwide (online)
Readipop is a music charity based in Reading offer a variety of engaging, creative workshops run by their experienced music leaders. Readipop enable children to learn new instruments, rhythms and how to work as a group.
RolyRichardsonisaprofessionalmagicianand entertainerHehasprovidedentertainmentforover 40years.Hisexperiencewasinitiallygainedin holidayparks,includingButlins,Warnersandmany others.Henowspecialisesinchildren’s entertainmentusingmagicandcomedy.He regularlyprovideshisuniqueformofmagicand comedyforschools,pre-schoolsandMontessori schools.
Award winning poet Coral has published five collections of children’s poetry and a picture book. Coral has contributed to around 200 anthologies, and her work for younger children has been featured many times on CBeebies TV and Radio Michael Rosen has said ‘Rumble has a dash and delight about her work’.
AmandaisanAustralianartistlivingin Maidenhead.ShehasadegreeinVisualArts specialisinginFibreArts,aDiplomainSecondary ArtEducationandaDiplomaofHigherEducation inStitchedTextiles.AmandataughtArtin secondaryschoolsintheUKfortenyearsand nowexhibitsherartworkandrunsworkshopsat NordenFarm.
StreetDanceEnergyoffershigh-energydance andfitnessworkshopsspecificallytailored towardsyoungpeople.DancetutorAlan Cunninghamstartedhiscareerasaperformer over20yearsago,beforetransitioningintohis teachingcareer.Alanhasgreatknowledgeof bothtechnicalstreetdancetechniquesandstreet danceculture.Hebringsvigorousenergy,whilst injectingfun,enthusiasm,andpassionintohis sessions!
10
Srishti are an independent Indian classical dance and music organisation They have vast experience of delivering Indian Dance workshops in Bharatanatyam and Kathak dance forms which are suitable for students of primary and secondary schools. They have vast experience of delivering Indian dance workshops in Bharatanatyam and Kathak dance forms, as well as Karnatik music.
Kalamandalam Vijayakumar and Kalamandalam Barbara Vijayakumar are the only Kathakali specialists in the country. They met whilst studying Kathakali at the Kerala Kalamandalam in Kerala, India in 1975 and decided to bring Kathakali to the UK in 1987. Since then, they have developed workshops in educational settings suitable for KS2 and above. They strive to work with schools to design activities that increase awareness, enjoyment and understanding of Asian theatre and culture as a celebration of cultural diversity.
TonsofSoundsbelievemusichasthecapabilityto empowertheyouthoftoday.Theynotonlygive studentsaninsightintothemusicindustry,but theyalloweachstudenttofeelwhatit’slikebehind thedecksandletsthembeincontrolofthe music/environmentbygivingthemareal understandingintowhatittakestobeasuccessful DJ.
Led by Amanda Schenk
EYFS | KS1 | SEN
Half Day £180 | Whole Day £280 (plus materials)
Students explore the making of a map in small groups, designing their own town or country, using a range of art materials. This flexible workshop is a wonderful blend of Art, Geography and D&T.
‘[Our Town Map] enhanced our project on Journeys and helped us to make links to the children’s community and home Excellent collaboration and all children engaged and confident to join in A fantastic opportunity for our children - thank you’
Furze Platt Infant School
LedbyAmandaSchenk KS2
HalfDay£180|WholeDay£280 (plusmaterials)
InspiredbytheSurrealistdrawinggameExquisiteCorpse. Participantswilldesigncrazycharactersthatcanbeintegrated togetherTheseartworkscouldbeusedtoinspirecreative writing
Led by Amanda Schenk
KS2
Half Day £180 | Whole Day £280 (plus materials)
Inspired by the amazing glass artist Dale Chihuly, students will decorate coffee filters which will be used by Amanda to form a mobile or wall display. This workshop aids topics around light, colour or the sea.
‘As usual, the children had an amazing time with Amanda. She is so calm and patient as well as inspiring the children's creativity. They were fascinated to watch videos of the Dale Chihuly creating his glass sculpture's and then to be part of a collaboration to make their own display’
Wessex Primary School
Led by Amanda Schenk
EYFS | KS1 | SEN
Half Day £180 | Whole Day £280 (plus materials)
Students will create block printing during an exciting session. Block prints can form a gigantic posters a treasured class book or be printed on fabric depending on your class needs.
Led by Amanda Schenk KS2
Half Day £180 | Whole Day £280 (plus materials)
This is an energetic workshop where participants are choreographed to move around a massive painting making splotches and shapes into a beautiful garden or a Town Map. Suitable for KS1.
‘The workshop was great and the children have been inspired. James was very engaging and encouraged all the children. They were inspired to use their imaginations and all of them achieved something of which they were very proud’
Cookham Dean CE Primary School
Led by James Parsons
KS1 | KS2 | KS3 | KS4 | SEN
In Person Half Day £275 | In Person Whole Day £375 Online Half Day: £175 | Online Whole Day: £275 (plus materials)
Design and create amazing characters! Learn the secret storytelling and cartooning tricks used by professionals. Discover how to tell a brilliant story using a sequence of words and pictures. These fast-moving workshops cover all the essentials of creating an effective comic strip, including character creation, setting, plot, expression, sound effects, movement, speech and thought.
LedbyJamesParsons
KS1|KS2|KS3|KS4|SEN
InPersonHalfDay£275|InPersonWholeDay£375
OnlineHalfDay:£175|OnlineWholeDay:£275 (plusmaterials)
Learnaboutthismega-popularJapanesecomicartstyle,its history,whatmakesitunique.Createyourownkawaiiandchibi characters,andexploresecrettechniquesusedbythe professionals!Aseverthisisaflexibleworkshopwhichcanbe adaptedtoyourlearningoutcomes!
Led by Roly Richardson
KS1 | KS2 | KS3
Half Day £250 | Whole Day £350
Roly teaches magic to children of all ages. He has taught magic in schools, holiday clubs and for many foreign exchange students.
He provides all the props and guidance needed to allow youngsters a peep into the art of magic and conjuring.
‘Our boys and girls in Year 1 thoroughly enjoyed their Magic workshop this morning. The children were amazed by the tricks. There was evening disappearing paint’
Boyne Hill CE infant and Nursery School
Led by CultureMix Arts
KS2
Half Day £575 | Whole Day £805 (plus materials)
Make your very own Carnival Head Dress and become a Carnival Masquerader. Your carnival tutor will give you plenty of ideas on how to create a fabulous head dress like no other without the use of glitter or feathers.
Sessions include 2 experienced tutors with some materials provided. Book for a half day or a full school day. Ideal for class groups.
‘This workshop helped to fulfil computing curriculum with excellent resources and expert. Thank you, we loved creating our own animations and using exciting technology!’
Riverside Primary School
Led by Shannel Joseph
KS2 | KS3 | KS4
Half Day: £300 | Whole Day: £450
Using tablets to create their designs, all children play a special role in the making process to bring the animation to life. After each exciting workshop, their wonderful animations will be presented to the school and uploaded to Norden Farm’s social media. A fantastic memory to be shared with the family and friends to watch over and over again.
All equipment is provided, only require a standard sized classroom and creative class.
Led
by Shannel Joseph
KS1 | KS2
Half Day £250 | Whole Day £550
Using paper cut outs, all children play a special role in the making process to bring the animation to life. After each exciting workshop, their wonderful animations will be presented to the school and uploaded to Norden Farm’s social media. A fantastic memory to be shared with family and friends to watch over and over again.
All equipment is provided and the workshop can be held in a standard sized classroom.
‘The workshop linked so well with the other curriculum learning, it tied everything together. It was great because the children were able to see their DT models come to life with a stop motion animation experience’
Boyne Hill CE Infant and Nursey School
Led by Nisha Anil
KS2 | KS3
Half Day: £275 | Whole Day: £550
Learn the basics of puppetry (Bunraku-style paper-puppets) in solo and group-work focusing on transitional skills (collaboration, team-work, listening and presentation).
Led by Mandinka Roots
KS1 | KS2
Half Day £350 | Whole Day £450
Andinkra is a cotton cloth produced in Ghana and Côte d'Ivoire which has traditional Akan symbols stamped upon it. The Adinkra symbols represent popular proverbs and maims, record historical events, express particular attitudes or behaviour related to abstract shapes. It is one of several traditional clothes produced in the region. Students will create their own Adrinka symbol cloth print. Work can be produced on white paper instead of cloth if preferred.
Brilliant art session our pupils were able to enjoy. Students received an opportunity to learn a new type of art work and express their creativity outside of their usual classroom environment’
Manor Green School
Led by African Activities
KS1 | KS2
Half Day: £595 | Whole Day: £695
Plus materials at £1 per student
Turn milk bottles into fantastic masks! Students will explore the importance of masks to the Dogon, Fon, Ashanti and Gonga. The practitioners will explain how masks are often used to commune with ancestors during festivals and explain these traditions. This workshop encourages children to be creative in making their own masks and not to copy existing designs.
KS2 I SEN
Whole Day (For up to 30 students. Please note, larger groups may need to be split into smaller groups) £500 + £2 per student for organic cotton bags. Slogan and/or school name can be printed on the bags at an additional cost.
Design a bag for life. Printing on 100% organic cotton tote bags, the students will create and print their own designs using water based inks. By the end of the day, they will have a unique bag they have hand-printed to take home and reuse time and time again. As well as learning about the silkscreen printing process, we will cover environmental issues of the fashion industry and the importance of reuse and recycling.
Whole Day (For up to 30 students. Please note, larger groups may need to be split into smaller groups) £500
Learn the art of silkscreen printing. This workshop can be tailored to your classroom topic whether it is The Vikings, Pop Art, Diwali or wildlife and nature. Printing on A3 paper the students will create paper stencils to reflect the chosen theme. They will then use these to create their print using one of our plain or patterned screens. The students will learn about foreground and background, complimentary, hot and cold colours, as well as how to use a squeegee!
Led by Berkshire Printmakers
KS2 I SEN
Whole Day £500 + £5 per student for an organic cotton t-shirt. Alternatively, students can bring in a preloved t-shirt from home or source their own plain t-shirt.
Be a fashion designer for the day. This is a fun workshop using paper stencils and a library of plain and patterned screens to produce a unique t-shirt print. The students take part in the whole design process. They will learn about colours, templates, positive and negative and colour mixing, as well as learning how to silkscreen.
This workshop is a full day workshop for up to 30 students. Please note, larger groups may need to be split into smaller groups.
Led by Helen D Evans KS2 / SEN
Half Day £175 I Whole Day £275 (plus materials use of tools and firing)
Students will look into the age-old art of making coil pots and apply decoration inspired by specific countries such as Egypt, Greece, Roman, West Africa or China to suit your curriculum needs. Work will be fired and then returned to the school.
‘It is such a fabulous experience for children to make items out of clay. This is in a socioeconomic area where things are challenging, so to have an opportunity like this is amazing. The class loved every minute of it - so did I’
Larchfield Primary and Nursery School
Led by Helen D Evans
KS1 / KS2 / SEN
Half Day £175 I Whole Day £275 (plus materials use of tools and firing)
Let your fictional characters come to life! Children can choose to make a specific character from their favourite book. Clay monsters/animals can be based on fictional characters or created from their own imagination. The choices are limitless! You will be given the opportunity to draw and make your character out of clay. Work will be fired and then returned to the school ready to be painted.
‘Agreatexperiencetotrysomethingnew,manyofourstudentshadneverusedclay before Ourstudentsreallyenjoyedthisandwouldlovetobeabletodoitmoreoften They can'twaittogettheircreationbackandafewhavealreadyaskedifwecoulddoitagain’
Led by Amanda Schenk
EYFS | KS1 | SEN
Half Day £180 | Whole Day £280 (plus materials)
In this workshop, children will create a book structure that can then be used by the classroom teacher to support their writing in any subject. Amanda will work with a lead teacher at your school to design the workshop, to suit the needs and abilities of your children.
Page 21
LedbySimonMole KS1IKS2
ay£250IWholeDay£400 dingPDFsessionplanandsupportmaterials)
ntswillexplorerhythm,rhymeandotherpoetic sastheyworkingroupstocreateawholezoofullof characters,whichtheythenintroduceinoriginalraps. eativeoutcomesaregreatstartingpointsfor performance-basedassembliesorclassdisplays.
Led by Simon Mole KS2
Half Day £250 I Whole Day £400 (including PDF session plan and support materials)
Simon uses fun (and quite silly) games to build skills and confidence before the group are guided through a step-by-step process to write their very own poetry spells. The outcomes will be both heartfelt and hilarious, as the young people pen magic words to bring about the change they want in the world! Enchanting young word wizards and more reluctant writers alike!
‘ItwasarealtreatforourchildrentoworkcollaborativelywithSimonMole!Theywereinspiredto bringpoetryaliveandshowcasetheirimaginationswhenwritingtheirownpoems.Theygreatly enjoyedperformingthesetotheirfamilieswhovisitedourschoollaterintheweek’
Cookham Dean CE Primary School
Led by African Activities
KS1 I KS2
Half Day £595 I Whole Day £695
Storytelling can come as an assembly session where children are actively engaged in the story, or as workshops where children can listen to stories and then work on creating their own. The practitioners will be happy to work with your learning objectives and bring real life artefacts to help bring the stories to life.
Led by Desree KS2
Half Day £250 I Whole Day £360
Discover the Everyday Magic all around us in this joyful poetry workshop! Through playful activities and creative writing, students will explore the wonders of gratitude, self-discovery and selfexpression. From the beauty of a raindrop to the kindness of a friend, they’ll find inspiration in the little moments that make their lives special. Using words and imagination to create poems that celebrate who we are and the world around us, unlocking the magic within each of us!
‘The author was really engaging and inspiring and the children were excited to do the task. Norden farm workshops are always amazing. The children are always engaged and excited by the activities’
Alwyn Infant School
LedbyDesree
KS1IKS2
HalfDay£250IWholeDay£360
Thiscreativeworkshopinvitesstudentstoexploreclimatechange throughthepowerofpoetryUsingimaginationandfeelingstocreate poemsthatspeakforthetrees,oceans,andanimals,helpingto understandhowtheyareaffectedbychangesinourworldThrough funactivitiesandplayfulwritingexercises,they'lllearnhowtoexpress theirthoughtsanddreamsforahealthierplanet,allwhilebecominga youngpoetwithapowerfulmessage!
Led by Simon Mole
KS2 I KS3
Half Day £250 I Whole Day £400
After a whistle-stop tour through 400 years of this tiny but mighty poetic form, professional poet Simon Mole will equip your class with all they need to write their own miniature master-pieces in a haiku style!
As well as creating a collection of poems to publish or display, this session builds some important writing skills that can be applied across the curriculum – such as creating vivid imagery, and editing your ideas.
‘A really positive day where the children in year 5 left with great feeling of success which was shared with the whole school. It was a fantastic experience and one that we can't wait to have again in the not too distant future’
All Saints Primary School
LedbyCoralRumble
Thechildrenwillgoonawhistlestoptourofwhatmakesa poemapoem,astheyengageinanumberoffunactivities.
LedbySimonMole
ay£250IWholeDay£400 dingPDFsessionplanandsupportmaterials)
orkshopisafunintroductiontospokenwordor‘slam bringingwordstolifeinyourclassroomPupilswillusea ofpoetictechniquesanddevicestowriteandperformtheir desaboutthingsthattheyreally,reallylove.
LedbyCoralRumble
Coralwilltakethechildrenonexcitingadventures,throughthemagicofpoetry.Theywilllearn aboutpoetryandstorytellingontheway.
Led
by Srishti
KS1 I KS2
1 hour £175 I Whole Day (5 hours) £750 (Plus travel expenses)
Karnatik music (also called Carnatic music) is a form of classical Indian music practiced in South India. Most compositions are written to be sung, and even when played on instruments, they are meant to be performed in singing style. Karnatik music is usually performed by a small ensemble of musicians, consisting of a principal performer (usually a vocalist), a melodic accompaniment (usually a violin), and a rhythm accompaniment (usually a mridangam).
Suitable for all ages, pupils will learn vocal and rhythmic exercises and will be introduced to some of the principles of the classical Indian music genre. The workshops can either focus on vocal music, or if participants play their own instrument, our workshops can facilitate the creation of simple compositional work.
‘It was a great chance for the boys to play around musically and build skills and confidence’
Desborough College
Led by Readipop
KS1 I SEN
Half Day £250 I Whole Day £475
Make music using objects that you would usually find around the house or classroom. Create a song from unusual instruments and learn that music can be found anywhere. Ideal for Years 1 - 3.
Led by Readipop
KS1 I KS2 I SEN
Half Day £250 I Whole Day £475
Readipop are here to show you how this little instrument is accessible to all involved! With a bit of guidance, your class will soon be playing along and composing their own songs.
by
KS2 I KS3
2 hours £150 I Additional hours £75 per hour
Additional DJ stations £50 (Plus travel and setup costs)
Sessions are tailored to all skill levels from beginners right through to advanced students who are interested in trying something new or want to pursue DJing as a full time career. The session covers everything from switching, mixing and even trying some cool effects.
‘The workshops gave children an incredible view across a variety of arts and creative topics, it inspired them to have a go and try again, and gave them a wider experience than we would be able to on our own. The children left the majority of workshops beaming from ear to ear, and were so excited to share everything they have learned!’
A Maidenhead Primary School
Led by Readipop
KS2 I SEN
Half Day £250 I Whole Day £475
Use the drums to make exciting samba sounds and rhythms that come straight from Brazil! In this session, you’ll learn how to work together to form a drumming group and show off your new skills when you perform together. Ideal for Year 5 and 6.
Led by Readipop
KS1 I KS2 I SEN
Half Day £250 I Whole Day £475
Learn and create traditional and new African rhythms using Djembe drums as a class. Your group will quickly be playing together, with the chance to perform a drum solo.
‘It worked really well and engaged all the children for over 40 minutes - no mean feat with 4 year olds! It left the children buzzing with excitement and was something totally different to what we are normally able to offer them for music’
Burchett’s Green Primary School
Led by CultureMix Arts
KS2 I SEN
Half Day £600 I Whole Day £950
Create a steel pan band in your class! Taster workshops are an ideal way to introduce steel pan music to your students through a series of hands on music workshops with tutors and a full set of instruments provided. Programmed to suit your school timetable each workshop covers the history and origins of the steel pan instrument, basic playing techniques and learning a simple song to play together.
Full day covers the whole school day with up to 6 workshops.
Led by Marta Marthea Radwan
KS1 | KS2 | KS3 | KS4 | SEN
Half Day £275 I Whole Day £500
Circle Song is a form of creating music on the spot. No sheet music or rehearsal required. Just a pure fun of singing and making music together regardless of age or musical experience. Led by the leader musical circle is a great ‘team building’ experience.
‘I loved seeing how the facilitators built up the music and taught the different parts so effectively - it really sounded great! The workshop leaders had high aspirations for the children and it was incredible to see and hear how much they achieved in an hour. It gave the children an opportunity to take part in a new activity, from a different culture’
Cookham Rise Primary School
Led by Readipop
KS2 I SEN
Half Day £250 I Whole Day £475
Learn to make and programme your own beats, rhythms and recognisable tunes using Readipop’s historically significant synthesisers and drum machines. Lots of strange and interesting sounds can be explored. A fun workshop for all abilities.
‘This was amazing the students loved the session. They enjoyed it being interactive, having a team approach so each person got a turn. They paced it right and engaged all students and staff’ Manor Green School
KS1 | KS2 | KS3 | KS4 | SEN
Half Day £275 I Whole Day £500
Singing Improvisation is a great way to express yourself and explore music creativity. Through funny exercises children learn how to make their own music and own songs. It helps build confidence in creating and performing. Lots of fun and laughter whilst building key skills in music.
Led by Little Tanks
KS1 | KS2 | KS3 | SEN
Half Day £200 | Whole Day £400 (plus materials)
Bring to life a book, short story or play in your classroom. Bring new meaning to your story through drama that your pupils will remember forever! Please provide Little Tanks with the story of your choice at least two weeks in advance of your workshop.
Led by Nisha Anil
KS1 | KS2 | KS3
Half Day £200 | Whole Day £400
Explore the emotions and the elements to help find a character. Students will use their imaginations to create their own character and story through play and movement. Build confidence, try out ideas and invent something new.
Led by Nisha Anil
KS1 | KS2 | KS3
Half Day £200 | Whole Day £400
Pick a story, tell a summary of it, turn it into a song, turn the song into a dance, then turn the dance into a new story. A new story is created with each activity without having to be written down.
Led by Nisha Anil
KS1 | KS2 | KS3
Half Day £300 | Whole Day £600
Learn the basics of Acting, Camera Operating, Directing and Presenting* through games, tasks and film-making exercises.
*Presenting skills basics can be covered but this could run as a separate workshop.
‘It’s always excellent seeing students work with an outside professional. The students were engaged and thoroughly enjoyed the workshop. It gave them a space to be creative and work with others’
Furze Platt Senior
Led by Little Tanks
KS3 | KS4
Half Day £200 | Whole Day £400 (plus materials)
This interactive and immersive workshop is designed to guide participants through the creative process of devising theatre based on a theme. Through collaborative exercises, participants will discover various storytelling techniques, develop original material, and create a deeper understanding on the theme. The workshop aims to harness the collective creativity of the group, encourage innovation, teamwork, and personal expression.
Please provide Little Tanks with a theme of your choice with at least two weeks in advance of your workshop.
Led by Little Tanks
KS1 | KS2
Half Day £200 | Whole Day £400 (plus materials)
This enchanting workshop invites participants to dive into the magical world of fairytales through the dynamic and collaborative medium of drama. Participants will explore classic fairytales and create their own stories, bringing them to life through improvisation, role-play, and creative storytelling techniques. The workshop encourages imagination, teamwork, and a deeper understanding of narrative structures.
Led by Desree KS2
Half Day £250 | Whole Day £360
Get ready to unleash your imagination in It’s Not a Shoe! — a dynamic drama workshop where anything can become anything! Through fun improvisation games and creative challenges, student will transform ordinary objects into extraordinary things while building stories and characters on the spot. This workshop helps children develop teamwork, idea building, and oral skills, while boosting confidence in speaking and listening. Whether they’re pretending a shoe is a telephone or a spaceship, they’ll learn how to think on their feet, support each other’s ideas, and create unforgettable moments together!
Led by Street Dance Energy
KS2 | KS3
2 hour workshop £250
Available Tuesdays and Thursdays
Explore street dance by learning breaking, locking, body popping and some cool street dance footwork.
‘Students fully engaged and enjoyed the session. They enjoyed the telling of the story through dance. Students found the music relaxing and expressions very interesting. They were all intrigued by the dance form’
Manor Green School
Led by Kalamandalam Vijayakumar and Kalamandalam
Barbara Vijayakumar
KS2 | SEN
10.30am - 11.30am Workshop and 1.30pm - 3pm solo performance and talk £550
One drama based workshop session in the morning followed by a one and a half hour talk, demonstration and solo performance in the hall. Engage more children through a Kathakali solo performance and an introduction talk illustrated with images. A chance for children to see the skills studied in the workshop performed by an expert. The story illustrates the courage required to ‘Say No’.
Led by Srishti
KS1 | KS2
1 hour £175 | Whole Day (5 hours) £750 (plus travel expenses)
This dance workshop is an introduction to Bharatanatyam, an Indian classical dance style that originated in the temples of southern India. Characterised by its strong lines, geometry and symmetry, as well as its highly expressive mime, it is probably the most popular and versatile classical Indian dance style worldwide.
Suitable for all ages, pupils will learn a simple routine including hand gestures, footwork, facial expressions and rhythms used in Bharatanatyam.
‘Workshop leader was excellent and very motivating. An excellent morning!’
Burchett’s Green School
Led by Mandinka Roots
KS1 | KS2
Half Day £350 | Whole Day £450
This workshop gives children of all ages and abilities the opportunity to experience this wonderful, vibrant and diverse culture whilst learning some of the traditional dance moves. Children leave with a spring in their step but also a broad understanding of cultural diversity.
Led by Srishti
KS1 | KS2
1 hour £175 | Whole Day (5 hours) £750 (plus travel expenses)
This dance workshop is an introduction to Kathak, an Indian classical dance style that comes from north India. Its origins began from the art of story telling evolving into an intricate style of its own. Influenced by the ancient Hindu temples and Mughal court traditions, Kathak is now one of the most popular Indian dances in the world.
Its vast repertoire and fluid style aid in forming a great base for any dance form, A beautiful confluence of footwork, pirouettes, graceful poses and expressive narration form a typical kathak performance.
Suitable for all ages, pupils will learn basic hand gestures, foot movements, body and spatial awareness, vocabulary and movement used in Kathak.
‘The children and adults absolutely loved learning the different dance moves and listening to the tutor who is such a brilliant storyteller! She was fantastic and the children thoroughly enjoyed themselves’
Cookham Dean Primary School
‘The varied workshops gave all of our children the opportunity to be inspired and creative, it was a fantastic week! It was a brilliant week, full of lots of creativity and fantastic art. It was amazing to be inspired by so many different artists and thinking about topics in a different way’
Lowbrook Primary School (Referencing an Activity Week)
Led by Srishti
KS1 I KS2
1 hour £175 I Whole Day (5 hours) £750 (plus travel expenses)
Srishti will bring to life Diwali, the Indian Festival of Lights. This will be delivered in the form of an interactive workshop led by an experienced dancer / teacher who will engage students through storytelling, incorporating graceful hand gestures, feet movements and facial expressions, often used in Indian dance.
Led by Srishti
KS1 I KS2
1 hour £175 I Whole Day (5 hours) £750 (plus travel expenses)
This will be an interactive workshop based on the theme of the vibrant and colourful festival of Holi celebrated in India. The workshop leader will use props to capture students' imagination and will offer them an opportunity to experience the vast culture of India and promote understanding of diversity and cohesion.
‘We learned about Diwali in a much more creative way than we'd have been able to teach it in the classroom. We really enjoyed watching the ladies dance and hear the stories of Diwali. They made the stories come alive with their clever facial expressions and actions’ Maidenhead Primary School
Led by Animation Expressions
KS3 | KS4 | SEN
Half Day £350 | Whole Day £550
6 Week Course - 1 Hour Each Week | £720
This workshop can be booked as a stand alone session or as a 6 week course. Wellbeing Animation would be best suited to a smaller group of select students.
Students will have the opportunity to work as a team, learn new skills and turn their stories into an inspiration through animation. This workshop can be part of a PSHE, ART or ICT lesson.
These workshops are a great benefit to students who may be suffering from loneliness, anxiety, low self esteem, SEN or those who may simply want to experience something new. The students will create stories based on true experiences and think of ways to overcome negative inner thoughts and turn them into positive ones. The animation technique is called rotoscope which is a simple yet effective form of animation for any ability. The participants will create a story around the topic ‘thoughts inside of me’, enabling them to explore their emotions and express their thoughts creatively.
Creative Mindfulness
Led by Stella Chenery
KS1 I KS2
1 hour £60 (plus materials)
Through creative activities, art, sound, stories, meditations, visualisations and discussion, children will learn to recognise, understand and express feelings, thoughts and emotions. Children will learn to relax and calm their minds and bodies, cultivating kindness and compassion towards themselves and others.
School Lantern Making Workshops
Led by Same Sky
KS2 | SEN
Nov and Dec 2024 | In your school
A contribution towards the cost of a full day workshop in your school (final prices TBC)
(For schools in the Old Borough of Maidenhead: Your Farm Out Funding cannot to be used for booking this workshops)
With the help of professional visual artists Same Sky, students learn how to weave willow to create large centrepieces and individual lanterns which are inspired by the animals of the world.
Norden Farm’s annual community lantern parade will take place on Saturday 7 December 2024
Assembling at around 4.15pm outside Maidenhead Town Hall, the Parade departs at 5pm, Celebratory Concert from 5.45pm – 6.15pm (all times to be confirmed).
Schools Visual Arts Project
KS2 | SEN
Spring Term 2025 | In your school
A contribution towards the cost of a full day workshop in your school (final prices TBC)
(For schools in the Old Borough of Maidenhead: Your Farm Out Funding cannot be used for booking this workshop)
Working with professional practitioners to create work as part of Norden Farm’s annual Quest Family Arts Festival which runs throughout the Easter holiday Last year’s project was a book installation along with animations to create a sensory exhibition. The work created is displayed at Norden Farm during the festival.
Final workshop content will be announced by December 2024 A limited number of workshops are available to book for this project, so to register your interest please get in touch: education@nordenfarm.org
School Kite Making Workshops
KS2 | SEN Summer Term 2025 | In your school
A contribution towards the cost of a full day workshop in your school (final prices TBC)
(For schools in the Old Borough of Maidenhead: Your Farm Out Funding can be used for booking this workshop)
Working with professional visual artists from Community Kite Project learn to design and create a kite ready for our annual Kite Festival in September 2024
A limited number of school workshops are available to book for this project, so to register your interest please get in touch: education@nordenfarm.org
Why not hire the Courtyard Theatre or Studio for your school’s summer production? For enquiries and bookings, please contact the Venue Hire Team.
Tel / 01628 682555
Email / venuehire@nordenfarm.org
Dates to be confirmed
Led by And Circus. A week of learning incredible circus skills and performing. Learn to walk on stilts, ride a unicycle, walk the tightrope and perform on a trapeze!
Suitable for ages 7 - 13 years.
Dates to be confirmed
Led by Art Adventure. Join Lucy Wright for an Art Adventure! Combining art, movement and play to provide a stimulating and creative week of fun. With a sensational exhibition at the end of the week!
Suitable for ages 8 - 11 years.
Dates to be confirmed
Led by Sideways Drama. Make a Play in 4 Days! Come along and dive into the world of theatre, writing, directing and star in a brand new play!
Suitable for ages 8 - 14 years.
ADVANTAGE CARD SAVINGS! more details online
Term 1
Sun 1 Sept 2024 I Kite Festival I Norden Farm Event
Wed 25 Sept 2024 I National Comic Book Day
Oct 2024 I Black History Month
Thur 3 Oct 2024 I National Poetry Day
Term 2
Oct and Nov 2024 I Lantern Parade Schools Project I Norden Farm Event
Mon 11 Nov 2024 I Remembrance Day
Thur 31 Oct- Fri 1 Nov 2024 I Diwali
Sat 7 Dec 2024 I Lantern Parade I Norden Farm Event
Term 3
Jan 2025 I International Creativity Month
Mon 27 Jan | Holocaust Memorial Day
Term 4
Mar 2024 I Women’s History Month
Thur 7 Mar 2024 I World Book Day
Fri 8 Mar 2024 I International Women’s Day
Mon 25 Mar 2024 I Holi Festival
Apr 2024 I Quest Family Festival School Project I Norden Farm Event
Term 5
Mon 22 Apr 2024 I Earth Day
Tues 23 Apr 2024 I Shakespeare Day
Mon 29 Apr 2024 I International Dance Day
Tues 30 Apr 2024 I International Jazz Day
Term 6
Wed 5 Jun 2024 I World Environment Day
Fri 21 Jun 2024 I World Day of Music / Make Music Day
Summer 2024 I Summer at The Farm I Norden Farm Event
Sun 31 Aug 2025 I Kite Festival I Norden Farm Event