Summer 2016 by Southern Seasons Magazine

E A R LY SUMMER 2016

W EDDINGS

fix ga pets

andeeâ&#x20AC;&#x2122;s

saving lives

amazing army travel:

american art in arkansas

home & design:

magnificent ceilings exceptional

english manor

LUXURY LIFEST Y LES IN THE SOUTH

tropical

JESSICA SINGLETON GOSNELL

summer style

Wedding Singleton-Gosnell

NorthStar Developing High-Value Land and Stately Residential Properties

NorthStar, LLC

404.966.9455

www.NorthStarLLC.us

Two Unique Venues | One Luxury Service

Flourishatlanta.com 404.869.8858

Estateatlanta.com Southern Seasons Magazine

| 1

harrisondesign.com 2

www.southernSeasons.net Atlanta - Los Angeles - New York - St. Simons - Santa Barbara - Shanghai - Washington, DC

Perfect Pairing CONGRATULATIONS JESSICA AND RYAN

A FA M I LY T R A D I T I O N | Serving Atlanta For Over 65 Years

MARIETTA

770.429.1100

MARIETTA 770.429.1100

ED VOYLES

MARIETTA 770.951.2211

edvoylesacura.com 770.452.8800

SMYRNA 770.952.8881

CHAMBLEE

SMYRNA

770.234.7800

770.952.8881

www.edvoyles.com

Southern Seasons Magazine

| 3

Herbert D. Alexander, Jr., M.D. Linda M. Benedict, M.D. Harold J. Brody, M.D. Alia S. Brown, M.D. Elizabeth M. Burns, M.D. Darren L. Casey, M.D. Jerry L. Cooper, M.D. Gregory J. Cox, M.D. Ashley Curtis, M.D. Richard L. Detlefs, M.D. William L. Dobes, M.D. Corrine Erickson, M.D. Rutledge Forney, M.D. Trephina H. Galloway, D.O. Edmond I. Griffin, M.D. Alexander S. Gross, M.D. Tiffani K. Hamilton, M.D. David T. Harvey, M.D.

www.southernSeasons.net

Michelle L. Juneau, M.D. D. Scott Karempelis, M.D. John D. Kayal, M.D. Mark A. Knautz, M.D. J. Ellen Koo, M.D. Stephen J. Kraus, M.D. Katarina Lequeux-Nalovic, M.D. Eileen S. Niren, M.D. David C. Olansky, M.D. Diamondis Papadopoulos, M.D. Anna ParĂŠ, M.D. Joseph R. Payne, M.D. Kirk D. Saddler, M.D. Jason L. Smith, M.D. Richard L. Sturm, M.D. Janice M. Warner, M.D. G. Williamson Wray III, M.D. Sylvia W. Wright, M.D.

PUT YOUR EVENT IN THE SPOTLIGHT.

The food and service are incredible. The space and design are stunning. Naturally, when you host your event here, you can expect a superior experience. The Kessel D. Stelling Ballroom offers the elegance and ambience that are sure to impress both you and your guests. For more information, contact one of our event planners at 770-916-2807 or visit cobbenergycentre.com/perfect.

AT L A N TA , G A F O R T H E P E R F EC T P E R F O R M A N C E Southern Seasons Magazine | 5

M AG A ZI NE

SUMMER

2016

In Every Issue

72 Tom Abrams & Britt Wood 74 Jessica Singleton & Ryan Gosnell 80 Bailey Anders & John Meyne

14 Letter from the Editor 18 Letters to the Editor

society

people & places

86 Parties for a Cause 24 Andee’s Amazing Army 88 On the Horizon 30 Fix Georgia Pets 90 Atlanta Ballet Ball 33 AHS Bow Wow Brunch 91 Swan House Ball 34 Laura Seydel: Saving the Amphibians 92 Cobb Teachers Awards 36 Southern Tales 94 Preservation Gala & Driskell Dinner 38 Dr. Goldstein: Tips to Look Younger 41 Dr. Karin’s Fatherless Daughters book 95 Evening for Children First 96 Around Town with Jenny Pruitt 42 Gallery Views 98 Berkshire Hathaway HomeServices 44 Russian Treasures gifted to GMOA 100 Cause to Celebrate 46 Exhibitions 102 Etcetera 136 Purple Reign: Remembering Prince

HOME & DESIGN

48 Design Finds 50 Raise the Roof: Stunning Ceilings 56 Magnificent English Manor

STYLE

64 Cruise those Blues: Accessories 66 Summer’s Tropical Pop 68 Lovely Shades of Rose Quartz

WEDDING

70 Say “I do” to Pants

CALENDAR

104 Performing Arts 108 Fun Around Town

travel

116 Art Mecca: Bentonville, Arkansas

dining

122 Food for Thought 124 Cape Dutch Restaurant Review 128 Dining Guide: Best Bites in Town 133 In the Kitchen: Cook Books

COVER CREDITS

42 116

www.southernSeasons.net

EARLY SUMMER COVER: bride jessica singleton. photo by Katherine Rose. hair/makeup by Jennifer Nieman. SUMMER COVER: celebrity tHERAPY DOG CHLOE hubal. SPECIAL EDITION COVER: andee’s army. standing: elaine carlos and lisa kennedy. seated: keltin devoe and andee poulos. photo by kim link.

30 AMAZING ARMY 24 ANDEE’S Youth Brain & Spinal Cord Foundation mobilizes support at Evening of Hope Sept. 16.

74 67

OF THE PACK 30 LEADER Therapy dog Chloe Hubal joins Fix Georgia Pets at fall

fête to support rescue efforts.

HEIGHT OF DESIGN 50 THE Stunning ceilings showcase the dramatic impact of this

inspiring architectural element.

124 50

WEDDINGS 74 SOUTHERN Jessica Singleton and Ryan Gosnell celebrate their big day

their way at Barnsley Gardens.

Southern Seasons Magazine

| 7

17th through early 20th Century Fine European Antiques 1192A Huff Road • Atlanta GA 30318 • 404.351.1217

provenanceantiquesatlanta.com

www.southernSeasons.net

Southern Seasons Magazine

| 9

Eproperties xtraordinary require extraordinary marketing

4274 Olde Mill Lane Atlanta Georgia offered at

$1,399,000

As one of Coldwell Banker’s Top Previews International® Luxury Property Specialists, I showcase Atlanta’s magnificent luxury residences to an affluent global audience in search of multimillion-dollar lifestyle opportunities. It’s no surprise that Coldwell Banker Previews International closed over $8.8 Billion in sales last year leading the next brand by 40%. For exceptional service that delivers proven results, give Marc a call today.

Discover the exceptional service and proven results that comes from listing with Marc Castillo.

MARC CASTILLO Previews Property Specialist Marc@MarcCastillo.com

2385 Gates Chapel Rd Ellijay, Georgia

Office

404.262.1234 x9

Mobile

offered at

$2,495,000

404.449.6862 ColdwellBankerPreviews.com

©2016 Coldwell Banker Real Estate LLC. Coldwell Banker is a registered service mark licensed to Coldwell Banker Real Estate LLC. An Equal Opportunity Company. Equal Housing Opportunity. Operated by a subsidiary of NRT LLC. www.southernSeasons.net

Portrait by renowned illustrator Joseph Adolphe.

WILMINGTON TRUST RENOWNED INSIGHT

“A serious threat to your investment objectives? Lack of diversification.”

Tony M. Roth M.A., J.D., LL.M. (Tax) Chief Investment Officer Tony brings his extensive knowledge and more than 20 years of experience to bear on client portfolios each and every day. He is responsible for strategic direction and providing quality risk management and comprehensive investment solutions. He is part of a seasoned team of professionals who exemplify Wilmington Trust’s 113-year heritage of successfully advising business owners. For access to knowledgeable professionals like Tony and the rest of our team, contact Jack Sawyer at 404-736-1089.

Investing used to be a whole lot

based on proven portfolio construction

simpler. Traditionally, if stocks were

principles. A plan will also provide

outperforming, bonds were not. Therefore, as long as your portfolio

ongoing discipline to maintain a steady hand amid volatile markets or asset

had a healthy mix of each, you’d be

class bubbles.

poised to prosper. This isn’t necessarily the case anymore, as dealing with finances has grown more complicated in recent years. When the financial crisis hit the U.S., the recessionary effects were felt around the world. Today, the U.S. economy is still recovering, and central banks in Europe and Japan grapple with ways to reinvigorate their economies. The crisis taught us that portfolios composed solely of stocks and bonds (for instance, large caps and government debt) were vulnerable to loss. Having a truly diversified portfolio, with a robust blend of investments across and within different asset classes – including public and private investments – offers the best chance at reaping the highest possible return while managing volatility. So what’s an investor to do? Develop a plan. To get where you want to go, you need a map with clear goals and a carefully designed route

A DIVERSIFIED PORTFOLIO EARNED

60% MORE THAN A STOCK-ONLY PORTFOLIO OVER 15 YEARS Source: Wilmington Trust

Don’t go it alone. To create that plan, you need a trusted advisor. That’s where Wilmington Trust comes in. A fiduciary culture is at the heart of who we are, which means it’s a duty and a privilege to always put our clients’ interests first. Since 1903, we have preserved, enhanced, and transferred wealth in a way that reflects what our clients hold dear. And we can do the same for you. For insight into how having a welldiversified portfolio today can best help you secure a prosperous tomorrow, visit wilmingtontrust.com/diversification.

FIDUCIARY SERVICES | WEALTH PLANNING | INVESTMENT MANAGEMENT | PRIVATE BANKING

This article is for informational purposes only and is not intended as an offer or solicitation for the sale of any financial product or service. This article is not designed or intended to provide financial, tax, legal, accounting, or other professional advice since such advice always requires consideration of individual circumstances. If professional advice is needed, the services of your professional advisor should be sought. Private Banking is the marketing name for an offering of M&T Bank deposit and loan products and services. Investments: • Are NOT FDIC-Insured • Have NO Bank Guarantee • May Lose Value Past performance is no guarantee of future results. Asset allocation/diversification does not guarantee a profit or protect against a loss. Wilmington Trust is a registered service mark. Wilmington Trust Corporation is a wholly owned subsidiary of M&T Bank Corporation (M&T). Investment management and fiduciary services are provided by Wilmington Trust Company, operating in Delaware only, and Wilmington Trust, N.A., a national bank. Loans, retail and business deposits, and other personal and business banking services and products are offered by M&T Bank, member FDIC. Wilmington Trust Investment Advisors, Inc., a subsidiary of M&T Bank, is a SEC-registered investment advisor providing investment management services to Wilmington Trust and M&T affiliates and clients. ©2016 Wilmington Trust Corporation and its affiliates. All rights reserved. Southern Seasons Magazine

| 11

IVE ME FIVE One in five children in America struggles with hunger. Support Share Our Strength’s No Kid Hungry campaign.

JOIN US FOR OUR 10 YEAR OF this highly anticipated benefit featuring an exclusive five-course dinner with hand selected wine pairings. Together, we can make No Kid Hungry a reality. TH

Sunday, August 14 PIEDMONT DRIVING CLUB 1215 Pi edmo n t Ave, Atl a n ta , G A 3 0 3 0 9

5 P M - C O C K TA I L R E C E P T I O N 6 P M - D I N N EC R A L E B H O P K I N S Atlas

CHEFS

M AG A ZINE SUMMER 2016

VOLUME 11

NUMBER 2

PUBLISHER & EDITOR Eileen Gordon Associate editor Ginger Strejcek

PRODUCTION MANAGER Pamela White

travel editor Vivian Holley

ECO EDITOR Laura Turner Seydel

DINING EDITOR Jennifer Bradley Franklin

STYLE EDITOR Gail O’Neill

CONTRIBUTING EDITORS Monica Kaufman Pearson Dr. Karin Luise Dr. Ronald Goldstein Advertising executive Lisa Fuller contributing PhotographerS

Jim Fitts Ross Henderson Kim Link Ben Rose

office manager Gail Lanier

JAY YA R B R O U G H , C H E F C H A I R

Executive Chef Piedmont Driving Club

N I C K A N D E R S O N Rathbun’s C H R I STO P H E R G R O S S M A N Atlas P I E R O P R E M O L I Pricci W E S L E Y T R U E The Optimist

SOMMELIERS G I L KU L E R S , S O M M E L I E R C H A I R

Sommelier Piedmont Driving Club C L A R K E A N D E R S O N No. 246 C A L E B H O P K I N S Atlas J O O N L I M Kevin Rathbun Steak L I N DA TO R R E S The Ritz-Carlton Buckhead Purchase tickets at GiveMeFiveDinner.org 100% of proceeds benefit the work of Share Our Strength’s No Kid Hungry campaign to end childhood hunger in America. THE BILLI MARCUS FOUNDATION

Web site Design Pamela White Ginger Strejcek BOARD OF ADVISORS

Elizabeth and Carl Allen Jack Sawyer Dr. Bill Torres Cindy and Bill Voyles

founder of southern seasons magazine: Bob Brown REPRINTS: No portion of this issue may be reproduced in any manner whatsoever without prior consent of the publisher. CONTRIBUTIONS: The editors are not responsible for return of any unsolicited materials. RESPONSIBILITY: The publisher and editors are not responsible for any changes in dates of events after the deadline.

For advertising information please call 404/459-7002 Southern Seasons Acquisition, LLC dba SOUTHERN SEASONS MAGAZINE 7155 Roswell Road, Unit 56 · Atlanta, GA 30328 Fax 770.673.0693 · E-mail: info@southernseasons.net

The subscription rate is $18 for one year; $30 for two years; $42 for three years. Price includes state sales tax.

Subscribe Online www.southernseasons.net

www.southernSeasons.net

Absolute perfection in Brookhaven

3914 Club Drive | Offered for $3,595,000

One-of-a-kind luxury in Sandy Springs

8200 Jett Ferry Road | Offered for $5,750,000

travis reed a n d a s s o c i a t e s 404-874-0083 | 404-233-4142 | travis.reed@me.com Buckhead Office-532 East Paces Ferry Road, Atlanta, GA 30305. harrynorman.com Betsy Franks - Broker. The above information is believed to be accurate but not warranted. Offer subject to errors, changes, omissions, prior sales and withdrawals without notice. Equal Housing Opportunity. Southern Seasons Magazine | 13

letter from the editor

Summer Buzz

ere we are in the summer of ‘16 in the midst of the presidential campaign, which bears a striking resemblance to “The Hunger Games” or perhaps “Jurassic World,” providing shock-politics entertainment! Competing with this national event, we offer an escape with a kinder, gentler look at the beautiful southern world in our stunning summer issue – just resplendent with rich visuals and stories of luxury lifestyles and the triumphs of incredible people. Among the hundreds of charitable organizations in the city, we are honored to focus on Andee’s Army, whose Evening of Hope benefit will be held Sept. 16 at Flourish. The foundation was created by the friends and family of Andee Poulos, who was stricken with a neurological injury as a young teen, but has survived and thrived with the love and determination of her family and community. Fix Georgia Pets is working hand in hand with the Atlanta Humane Society to solve the crisis of overpopulation of dogs and cats in Georgia through incredible fundraising efforts to support EILEEN GORDON SUPPORTING ATLANTA HUMANE SOCIETY spay and neuter initiatives. Our congratulations to the remarkable FUNDRAISER. Ginny Millner, co-founder of FGP, who was just honored with AHS’s Anne Cox Chambers Humanitarian Award for her passionate determination to save precious lives. Our Home & Design feature simply raises the bar – and the roof – on the most stunning ceilings in the South. The dramatic impact of this sensational architectural element is sure to inspire your next home or renovation. We also showcase a magnificent English manor home, among the most historically relevant styles of estate homes worldwide. This stellar estate was developed by NorthStar, a new major player in the luxury homes market. The romantic tales of three delightful couples are featured in our wedding coverage, including the breathtaking nuptials of cover girl Jessica Singleton and Ryan Gosnell. Atlanta designer and stylist Rex Westin inspired our feature on rose quartz gowns – the amazing Pantone color of the year. Southern Seasons style editor Gail O’Neill presents a provocative take on the 21st century option of brides saying “I do” to pants. Gail’s brilliant prose and soulful heart have also gone into a welldeserved farewell tribute to musical icon Prince, whose last public performance was at Atlanta’s Fox Theatre. Dr. Ronald Goldstein provides priceless advice on maintaining a youthful look, including eliminating bad habits that can age your appearance. It’s a must-read for women who want to always look their best! If you are inspired by great American art, enjoy the stellar accomplishment of Alice Walton (daughter of Walmart founder Sam Walton), the creator of the Crystal Bridges Museum of American Art in Bentonville, Arkansas – the perfect place for a family vacation. Join us for a wonderful summer read!

Eileen Gordon Publisher & Editor

www.southernSeasons.net

pewter

brass ∧ pewter

stone ∧ pewter

brass

brass ∧ pewter

stone ∧ brass

pewter ∧ stone∧ wood

FRANCOISANDCO.COM 888.313.3237 Southern Seasons Magazine

| 15

MAKING DREAM SMILES

A REALITY goldstein garber & salama

ot everyone wants an attractive, celebrity smile that radiates confidence and charm ... but most people do! However, making a patient’s dream smile a reality isn’t quite that simple. There are many factors that should be considered when creating that optimal smile, including the individual’s facial features, personality, oral health status and more. At their world-renowned esthetic dental practice, Drs. Ronald Goldstein, David Garber and Maurice Salama have the combined technical skills and technology to create dream smiles for their patients. Utilizing an in-house, cross-disciplinary approach, the doctors determine the treatment sequence needed to create not only beautiful, but healthy smiles designed to meet and exceed the desires and needs of each patient. Combining the skills of all the in-house specialists, a coordinated, interdisciplinary smile design can be completed within their office.

www.southernSeasons.net Ronald Goldstein, DDS

Maurice Salama, DMD

David Garber, DMD

TIPS FOR PATIENTS SEEKING TO REJUVENATE THEIR SMILES • Before their appointment, patients should make notes on what they would like to see in their smiles and then review them with their dental team. • Patients shouldn’t be afraid to ask questions, especially whether or not the concept would be the right choice for their new smiles. • Patients should bring celebrity pictures or photos of themselves at younger ages that demonstrate smiles they desire. • Being open to all possibilities is important - experienced cosmetic dentists usually have several treatment alternatives to help patients accomplish the smile of their dreams. • The quickest method to transform a smile isn’t always the best. Many times, the best technique can be a combination of various specialties to provide the longest lasting result, but may need a little more time.

BEFORE

AFTER

Debbie’s gum line was slanted and her previous crowns and teeth were discolored.

The gum line has been restored to an even appearance with cosmetic gum contouring, and the entire smile improved with new all-ceramic crowns and porcelain veneers.

Before

After

Recognizing their educational legacy and innovative clinical approaches to dentistry, Goldstein, Garber & Salama was featured as the cover story of the September 2014 Dentistry Today – the most highly circulated dental periodical for dental professionals in North America, with a circulation of over 200,000. The publication features information and education on a wide range of dental topics from the industry’s top clinicians and leaders, and is one of the most utilized dental information sources. To view the article, visit our website!

One Day, One Location!

Dental Implants

www.OneDayImplants.com

With One Day dental implants, there is no need to visit several different specialists to complete your restoration. Our committed, multi-doctor team will partner with you to create the ideal, functioning smile you need and deserve-all in one location for one affordable fee.

RONALD GOLDSTEIN, DDS General and Cosmetic Dentistry

Dr. Goldstein is the author of the best-selling book, Change Your Smile, which is now in it’s fourth edition and has been read by millions worldwide. In addition, he is a Clinical Professor at the Georgia Regents University School of Dentistry, and an Adjunct Clinical Professor at both Boston University and the University of Texas.

DAVID GARBER, DMD

Prosthodontics and Periodontics

Dr. Garber has a dual degree in both Periodontics and Prosthodontics, a rare and valuable combination for a dentist. Dr. Garber is a Clinical Professor in the Department of Periodontics at the Georgia Regents University School of Dentistry, and serves as a visiting Professor in the Department of Prosthodontics at Louisiana State University.

600 Galleria Parkway SE, Suite 800 Atlanta, GA 30339

GoldsteinGarber.com

Find us on:

MAURICE SALAMA, DMD

Periodontics, Orthodontics and Implantology

Dr. Salama has a dual degree in both Periodontics and Orthodontics, and a wealth of experience and expertise in Invisalign, implants and periodontal surgery. In addition, Dr. Salama is on the faculties of the University of Pennsylvania and Georgia Regents University School of Dentistry as Clinical Assistant Professor of Periodontics. The doctors have been featured in over 1,200 publications and networks such as: CNN, CBS, ABC, 20/20, NBC Today Show, Fox, PBS, Discovery Health, Vogue, Elle, Allure, New Beauty, People, InStyle, Glamour, Town & Country, Redbook, Cosmopolitan, Men’s Health, Prevention, Forbes, Robb Report, Time, Wall Street Journal, USA Today, and many others.

Southern Seasons Magazine

ADVM11701

404.907-1526

| 17

Letters to the editor

I am still basking in the latest Southern Seasons issue! Your 10th anniversary has certainly been celebrated in style! It hardly seems possible that 10 years have passed since you and your team began this adventure! With endless ideas, limitless creativity and tireless energy, you and your staff raised the bar for all publications in this region! Sassy, arty, entertaining and lovely! Thank you for consistently transporting your readers to a world beyond! Here’s to the next decade. I can’t wait!

Thank you so very much for the wonderful coverage of the Legendary Ball. I so appreciate it! And, the coverage and gorgeous pictures of the ball at Flourish brought back some wonderful memories. You nailed it when you described Tony [Conway] as having “remarkable vision”! Your 10th anniversary edition is beautiful…so colorful, the fabulous models, clothes, jewelry, purses… and not to mention the $48,000,000 home. Well done! Cindy Fowler, Presenting Atlanta

Jacque DiGieso, phd, co-FOUNDER OF THE COTTAGE SCHOOL

I got home last night to the most amazing surprise: my face on the cover of a magazine…and a six-page spread! You did a wonderful job! It’s absolutely stunning. I am so excited, I can’t stop smiling. Thank you! kelly quinn magnotta

Just a quick note to say thank you! The magazine looks so awesome! I’m very pleased, honored and excited to be on your cover :) You all did a wonderful job! KHALILAH BIRDSONG

We are so grateful for the beautiful coverage of both the Swan House Ball and the Spring Luncheon in your latest issue. This is a momentous year for the Atlanta History Center as we celebrate our 90th birthday with physical and programmatic expansions, Souper Jenny moving to our campus, new exhibition openings, and the start of construction on the Cyclorama addition. We’re so appreciative of your sharing our events with a greater audience. Thanks again. Katherine Hoogerwerf, Atlanta History Center Director of Development Events

Sassy, arty,

entertaining and

lovely! Thank you for transporting your readers to a world beyond!

The magazine looks terrific. I can’t thank you enough for the beautiful placement of Pickett’s Press. JOni Cohen

The spring issue of Southern Seasons was so outstanding. You just get better and better. Proud of you! MARTHA JO KATZ

Thank you for the nice coverage of Ann Taylor’s new Pashmina scarf that supports the empowerment of women on a global level. Ashley Julian, Krupp Kommunications

Can’t believe it has been ten years! Congratulations, Southern Seasons! Elizabeth Morgan Spiegel

got a comment? give us a call at 404/459-7002 or e-mail us at info@southernseasons.net 18

www.southernSeasons.net

BUSINESS

•

OCCASIONS

•

WEDDINGS

•

MITZVAHS

shades of summer

Chamilia’s “In Bloom” sterling silver charm (above) from the Pop Picnic collection captures the radiance of the sun with padparadscha, tangerine and topaz Swarovski crystals. $60. chamilia.com

To plan your next event, contact one of our event specialists: Sophie Berger (sberger@buckheadrestaurants.com) or Leslie Bahr (lbahr@buckheadrestaurants.com)

103 West Paces Ferry Road Atlanta, GA 30305 404.233. 5993 | 103west.com For vintage charm with a French twist, Ben Busko’s whimsically illustrated glass decoupage trays and crystal paperweights are both practical and pretty. Handcrafted in the New York studio of Ben’s Garden, the bent-glass trays are food safe and suitable for hanging. The paperweights are made with French crystal that produces a brilliant sparkling effect. Emilie Pink Magnolia tray, $78, 8”x8.” Pink Himalayan Butterfly paperweight, $34. bensgarden.com

Private Dining also available at: Atlanta Fish Market 404. 601 .1 333 Bistro Niko 404 . 261 . 6456 Chops Lobster Bar 404. 262 . 2675 Kyma 404. 528. 2895 Pricci 404. 528. 2895

buckheadrestaurants.com

Southern Seasons Magazine

| 19

Montecello: A Grand Country Home

Travis Reed invites history enthusiasts and those interested in a magnificent country home, so near to Atlanta, to step back in time to Montecello. This elegant home was built in 1890, during the Gilded Age, by an aristocratic Georgia family in what is now historic Covington. While retaining the fine woodwork and architectural integrity of its 19th century era, the home is complete with modern high-level finishes. The entry foyer boasts two formal parlors with original fireplaces and stained glass windows. The redesigned kitchen features all stainless steel appliances, double ovens, wine fridge, and a view to the family room. A spacious dining room connects to a sunlit breakfast or reading room. Alfresco entertaining is ideal around a beautiful pool and outdoor kitchen. Monticello is offered at $1,750,000 by Travis Reed of Harry Norman, Realtors.

Pest & Termite Control

For Your Peace of Mind

404-596-4179 20

www.southernSeasons.net

Farm Star Living’s Mary Blackmon

Online shopping for farm-friendly goods Embracing the farm-to-everything movement, Farm Star Living has just added an online store. Shoppers can peruse a plethora of hand-selected products at the digital marketplace (dubbed “Harvest”), from indigo dyed scarves, botanical candles and analog marble watches to White Oak Pastures’ grass-fed beef, lamb and goat. For composting, there’s the Noaway countertop walnut bin. For exfoliating, an organic coffee scrub. “It was a natural progression for us to take that farm lifestyle into products,” said founder Mary Blackmon, who works with fellow farmers to curate information on farm-fresh foods, nutrition, recipes and more. “There are so many options for those who want to embody this lifestyle head to toe and Farm Star Living is the onestop shop for these consumers.” The marketplace offers items that are eco-friendly, handmade, organic, fair trade, socially responsible, all-natural and healthy. farmstarlivingshop.com

co-chairs jen ansley and jessica thorne (speaking) with their children Beau Ansley, Grayson Thorne, Maclain Thorne and Blakely Ansley, students of the Atlanta Speech School.

A model showcases the latest LOOKS from Neiman Marcus.

let us nurture your furs

ross henderson photography

Luncheon

The Atlanta Speech School’s Language and Literacy Luncheon was presented this spring at Neiman Marcus Atlanta, where 150 attendees enjoyed a gourmet lunch and fashion show, while learning about the school’s expert services. A raffle was held for a luxury prize package with items donated by sponsor Neiman Marcus, as well as SPANX, St. Cecilia Atlanta, The Ritz-Carlton Buckhead, Twine & Twig and Lucy’s Market. The luncheon supports the Atlanta Speech School Guild’s largest annual fundraiser, the Language and Literacy Gala, held in November. Founded in 1969, the 400-member guild provides the Atlanta Speech School with classroom volunteers and financial aid support, and generates community interest in the school and its services.

• Storage • Cleaning & Glazing • Alterations • Custom design • Repair • concierge Pick-up & delivery

All major credit cards and layaway accepted 4355 Cobb Parkway S.E. Suite 141 Atlanta, GA 30339

404.659.2257

www.HelenFrushtickFurs.com Southern Seasons Magazine

photography by richie arpino

Language & Literacy

| 21

Left: Pablo Picasso, Chouette, 1969, ed. 350, partially glazed and engraved ceramic vase, 11.2 inches high. Right: Pablo Picasso, Tête de femme couronnée de fleurs, 1954, ed. 100, partially glazed ceramic pitcher, 8.9 inches high.

Photography by Pricilla Wannamaker

Robert Long Flora & Event Design

Setting the Stage for Romance www.robertlongfloradesign.com

www.southernSeasons.net

PABLO PICASSO’S PRIZED CERAMICS At the end of the 1940s, Pablo Picasso (Spanish, 1881–1973) started creating ceramic works. At the time, Picasso spent his summers on the Cote d’Azur in the South of France. Following earlier trips to the Riviera, where he was inspired by the clarity of the light and the bright Mediterranean colors, the artist visited Vallauris for the annual pottery exhibition in 1946. Impressed by the quality of the Madoura works, he was introduced to the owners, Suzanne and Georges Ramié, who welcomed him into their workshop, and gave him access to all the tools and resources he needed to express his creativity with ceramics. In exchange, the Ramié family would produce and sell his ceramic work. This collaboration with the local ceramicists spanned 25 years. Over the past 10 years, the market for Picasso ceramics has steadily grown, with seasoned collectors and new buyers alike vying for Picasso’s editioned and unique ceramics at auction. According to auction-tracking firm Artnet, the average lot price for the Spaniard’s ceramics soared to $35,300 in 2015 from $16,100 in 2012. An edition of Tête de femme couronnée de fleurs realized $37,000 in 2012. Chouette went for over $43,000 at auction last year. Select Picasso ceramics are now available at Kendall Fine Art. For more information and pricing, contact matt@kendallfineart.com.

Easily Share Health Updates Using CaringBridge.org CaringBridge free personal websites allow people to quickly connect, share updates and receive strength and love during an illness or injury.

Graham 3 years old, Retinoblastoma, Super Kid

More than 2 billion visits to 600,000 sites since being founded in 1997. Every 7 minutes a new CaringBridge site is created for someone in need. We are funded by the people who have experienced the power of CaringBridge firsthand. Please consider a donation to make sure that families never have to go without that vital connection. Thank you to the Russell family and Southern Seasons Magazine for donating the space for this ad.

www.CaringBridge.org Southern Seasons Magazine

| 23

MISSION Keltin DeVoe of Flowery Branch and Andee Poulos of Sandy Springs made inspirational recoveries from their brain injuries, with the support of Andeeâ&#x20AC;&#x2122;s Army, a nonprofit foundation named after Andee.

Photo by Kim Link

www.southernSeasons.net

POSSIBLE for Andee’s Amazing Army BY LISA KENNEDY

With the motto “Inspired by one, supporting many,” Andee’s Army continues to make strides in its mission to help children with brain injuries. Since its inception five years ago, the nonprofit Youth Brain & Spinal Cord Foundation has provided financial assistance to over 100 patients for uninsured medical expenses and related costs for their individual recovery.

t all started with a 14-year-old girl named Andee. In 2011, Andee Poulos of Sandy Springs had just returned to school from holiday break when a severe headache turned out to be internal bleeding from an extremely rare acquired brain injury called an arteriovenous malformation (AVM). As typical with non-traumatic acquired brain injuries, the AVM went undetected until a rupture caused sudden internal bleeding within the brain. Although Andee couldn’t walk, talk or eat and could barely see, she began an inspiring journey of recovery with a determination and faith that amazed everyone. Four years later, she regained her ability to walk and talk, and returned to school as a straight A student. Building AN Army With the same steadfast resolve as Andee, a wide circle of friends and family formed Andee’s Army Inc. in 2011 to identify and help families of children with non-traumatic acquired brain injuries who are most in need of resources not covered by medical insurance or related expenses. In 2014, Andee’s Army expanded its scope to include all neurological injuries, in order to support more youth facing

“

similar devastating life-altering challenges. Eligible expenses considered for their personal recovery and rehabilitation include therapies, doctors and related specialists, home health aids, durable equipment, assistive technology equipment and basic home modifications. TEAM WORK Andee’s Army has strengthened its partnerships with Shepherd Center and Children’s Healthcare of Atlanta, offering every resource possible to restore and rehabilitate each child and adolescent. It has additionally established a multi-year endowment fund administered through Shepherd Center to support rehabilitative medical treatment and home care needs not typically covered by insurance or other compensation sources. COMMUNITY SUPPORT Andee’s Army hosts several fundraisers each year, including the annual Evening of Hope on Sept. 16 at Flourish in Atlanta. Proceeds provide grant programs for financial assistance to children and youth during all phases of in-patient hospital care, rehabilitation care and home environment care.

As a lifelong friend of the Poulos family, I was truly grieved to learn that Andee had suffered a devastating AVM and was fighting for her life. I wanted to help, as did scores of other friends. Andee’s Army was born out of our love and compassion for this child, and our commitment to help her ‘come back’ and live her life as fully and as independently as possible. As a result of Andee’s success, we have learned that we can make a difference! All it takes is for a child to feel that others believe in his or her chance for a recovery, a committed army of family and friends, and, of course, money to provide the needed professional care.” – John A. Carlos, chairman of Andee’s Army Southern Seasons Magazine

| 25

@KPKinteractive for Andee’s Army

Stories of Hope “We know her quick recovery from her injury has been a result of her hard work ethic, the outstanding Shepherd Center & Pathways Team, and the support of Andee’s Army! Without their support, we don’t know where we’d be today.” – EMILY’S PARENTS

E With the support of Andee’s Army, Keltin made remarkable progress in Shepherd Center’s Beyond Therapy program. “We are eternally grateful,” said Keltin’s mother, Kelly Hall.

eltin DeVoe, a 20-year-old college baseball player from Flowery Branch, Ga., suffered a hemorrhagic stroke in April of 2015 as a result of a bleed from an arteriovenous malformation (AVM) in the brain. The stroke caused damage to his temporal, parietal and occipital lobes, resulting in difficulties with word finding, reading, writing and comprehension. The AVM swelled massively, and doctors had to remove a piece of his skull while they waited to safely remove the AVM. Twenty-four hour care was required for months due to concern with falls and the possibility of another bleed because of the still active AVM. Once the doctors were able, they removed the AVM and returned the bone to his skull. He continued his therapy in earnest. With the assistance of Andee’s Army, Keltin was able to utilize the services at Shepherd Center Beyond Therapy to help him regain his agility, balance and physical fitness, with improvements in speech and reading skills as well. Keltin’s goal is to return to college and he is looking towards the future with hope.

www.southernSeasons.net

mily is a 17-year-old senior in the top 2% of her class at Ashley Ridge High School in Summerville, S.C. She was in a serious snowboarding accident on Dec. 30, 2015, while on a church youth group trip to Lynchburg, Va. She’d tumbled over a foam barrier and struck her head on a pole, causing a traumatic brain injury. Emily spent over two weeks in a medically-induced coma in the Neurological ICU at Lynchburg General Hospital. Her intracranial brain pressures had to be controlled with medications and by draining spinal fluid off of her brain. After regaining consciousness, Emily and her family traveled to Shepherd Center in Atlanta for rehabilitation, roughly one month after the accident. Emily thrived under the center’s care, and following two weeks of inpatient therapy, she was released to the Shepherd Pathway’s outpatient program. While she still has some short-term memory issues and is battling double vision, she has improved dramatically, and a full recovery is expected. On course to graduate high school with her class, Emily plans to attend Clemson University this fall, where she was accepted into the engineering program. Emily’s parents said Andee’s Army marched to their rescue when they were faced with the dilemma of whether or not they could afford the out-of-pocket costs of an extended stay in Atlanta, coupled with time away from work. “Andee’s Army offered to pay the $100 per day for us to stay here for Emily’s six weeks of outpatient therapy at Shepherd Pathways. This made it a no-brainer decision for us to remain here to continue her therapy with one of the best acquired brain injury rehab facilities in the country!”

Erica Wagner suffered a traumatic brain injury from a car accident when she was 20 years old. Her rehabilitation was facilitated by Shepherd Center and Andee’s Army.

“As you can see, we have made great progress. All of these wonderful accomplishments we completely credit to Shepherd’s Beyond Therapy program and Andee’s Army, through which all was made possible. Because of your donors’ generosity, Erica will return to live a full, productive and independent life…of this we have no doubts.” – the wagner family Gina & Greg, ERICA, and siblings Megan, Jessica & Devon

rica Wagner was in a near-fatal car accident in August of 2013. She was partially ejected from the driver-side window with her seat belt still on. She suffered an open head fracture on the right side, as well as diffuse axonal injury to several parts of her brain. After six months at four hospitals plus an additional six months of out-patient therapies, Erica’s traumatic brain injury (TBI) had left her with numerous physical impairments. She had tremors in her left arm and hand, ataxia in her trunk, spasticity in both legs, and coordination and severe balance issues. Forward progress was not occurring so Erica’s family reached out to the Shepherd Center for its expertise. She began Beyond Therapy at Shepherd Center five days a week for two hours a day. Improvement was seen almost immediately, as Erica, a soccer player since she was four years old, was pushed to her fullest potential and beyond. Five weeks later, the Wagner family headed back home to Hudson, Ohio. Last spring, Erica achieved another milestone: she returned to college, majoring in communications at Kent State University. She retired her walker for a cane, and recently amazed her family by walking unassisted down the street and back. She continues to work hard with her personal trainer and physical therapy team on her mobility, with each day full of promise. Inspired by the peer mentoring program at Shepherd Center, Erica hopes to encourage others as a TBI survivor. Southern Seasons Magazine

| 27

Supporting Andee’s Army

“

Andee’s Army serves a vital need for those with catastrophic events in their lives. People often do not plan for a traumatic brain injury or stroke. Andee’s Army provides support for necessary expenses such as therapy. I know as a physician that this care is so important for the best recovery.”

“

– Barbara Weissman, MD Andee’s Army Board of Director

As a longtime supporter and former board member of Andee’s Army, I can honestly say this organization generates incredible return on investment and is extremely well run. The impact this group has had on families during perhaps their most devastated time cannot be overstated. Andee’s Army’s partnerships with Children’s Healthcare of Atlanta and the Shepherd Center give brain and spinal cord injury patients the opportunity to attend muchneeded therapy and rehabilitation, making a full, productive life possible again.”

“

– Millard Choate Choate Construction Co. PRESIDENT

As a member of the medical community, I am honored and committed to helping children and youth with their recovery from brain and neurological injuries. I understand the need and believe that every resource needs to be made available to help these young people become as independent as possible. Andee’s Army patient grant programs fill a void by helping with the continuity of care.”

“

Kari Carlos, her mother Elaine Carlos, Marge Sawyer, Helen A. Carlos and Lisa Kennedy, Andee’s Army Board of Directors vice chair.

Host Committee Luncheon Photos by Thomas E. McBride III, Mac3Photography

– William E. Torres, MD Andee’s Army Board of Director

Since its inception, Andee’s Army has graciously helped many adolescent patients at Shepherd Center by providing financial assistance to those in need of durable medical equipment, additional therapy, assistive technology and transportation to therapy. Andee’s Army helps patients here at Shepherd Center and when they return home.”

“

– Alana Shepherd Shepherd Center Co-Founder

I am immensely proud to be a member of the army of supporters within Andee’s Army. Every child and young adult should have access to these vital resources. Their programs ensure that patients can continue with rehabilitation therapies as they work so intently on restoring former abilities and learning new ways to do things they once could do. Our goal is to provide a community where every child and young adult is able to live a full and vibrant life.” – D. Jack Sawyer Jr. Andee’s Army Board of Director 28

Janet Algers, Nicole Carlos.

www.southernSeasons.net

Diane Ashkouti, Ruth Langsfeld and Nicole Carlos In the club’s lobby.

Andee’s Army committee members congregated at an elegant luncheon at the Cherokee Town Club to discuss plans for the Evening of Hope Dinner. The gala evening, taking place Sept. 16 at Flourish, is being chaired by Lisa Kennedy, Janet Algers, Kari Carlos and Elaine Carlos, who hosted the luncheon.

Host Committee member Dr. William Torres, John & Elaine carlos, Jack Sawyer of Wilmington Trust.

Evening of Hope Co-chair Lisa Kennedy, Lorin & Matt Middelthon, Furman Wood, Co-chair Elaine Carlos and John Carlos, Board Chairman of Andee’s Army.

Anniversary Party

Andee’s Army celebrates its 5th year with a kick-off party for the Evening of Hope benefit on Sept. 16 at Flourish

Co-chair Kari Carlos AND Jimmy & Helen S. Carlos.

Andee’s Army supporters celebrated the foundation’s 5th anniversary at a festive party at The Estate in Buckhead, preceding its annual Evening of Hope Dinner, set for Sept. 16 at Tony Conway’s fabulous Flourish. From cocktails to a sparkling live auction of memorable experiences, dancing to the sounds of the Atlantic City Boys, and a gourmet dinner with exceptional wines, this gala opens the fall season with style and substance. Tickets at $300 per person, with patron reservations from $3,000. andeesarmy.com Photos by Thomas E. McBride III, Mac3Photography

Dr. William Scaljon and Vicki Skandalakis Scaljon, Co-chair Janet Algers and Andee’s Army sustaining sponsor Pano Karatassos.

Tony Conway, Dr. William Torres, Alana Shepherd and Todd Tautest of sponsor Wilmington Trust.

Southern Seasons Magazine

| 29

John & Karen Spiegel with Ron Hilliard and Helen A. Carlos.

Bob Leverte

Jennifer Healey and Ginny Millner.

ix Georgia Pets will host its fifth annual auction fête at The Estate and Gardens in Buckhead on Oct. 20 from 6:30-9:30 PM. This year’s red carpet event promises an elegant evening filled with live entertainment, signature cocktails and hors d’oeuvres, and a silent and live auction presented by Dean Crownover. Featured celebrity guests are Carolyne Roehm and therapy dog Chloe Hubal. “We would love to see a full house from all the buzz this celebrity fête has generated,” said event co-chair Marilyn Krone. “We hope everyone will come together and help us help our pets,” added event co-chair Alison Womack Jowers. Proceeds will support efforts to reduce Georgia’s pet overpopulation. Thanks to Fix Georgia Pets spay and neuter clinics, mobile units and private practice veterinarians are able to provide services to those who otherwise would not be able to afford having their pet “fixed.”

Back: Rubye Reid, Lynn Doble, Patricia Davis, Toni Moceri, Jessica Clark Speaker, Doug Weiss, Aida Flamm and Joanne Chessler Gross. Front: Stacey Ollinger, Kristen Gibbs, event chairs Marilyn Krone and Alison Jowers, and Cathy Iannotti. Not Pictured: Ginny Millner, Chris Casey and Sandra Baldwin.

www.southernSeasons.net

Guest Celebrities

CHLOE HUBAL is a therapy dog celebrity – an orphan beating the odds to become Pittsburgh’s most fashion-forward model and hero to the kids at Children’s Hospital. She reminds us how unique, amazing and lovable shelter dogs truly are.

photography by One Kings Lane

THURSDAY, OCTOBER 20, 2016 | THE ESTATE sponsorship opportunities on reverse

Even� Co-Chairs

alison jowers + marilyn krone BE A SPONSOR

CAROLYNE ROEHM is a designer, writer, gardener, interior designer, photographer, animal lover, skier and author of the justreleased book At Home in the Garden. She resides in Charlotte, S.C.

BE A PATRON

SUPERSTAR ALPHA $25,000

PLATINUM PET $2,500

10 Tickets to event with preferred seating, inclusion in press releases, logo on website, invitation insert, and your corporate banner at the event; recognized through FGP social media and display board at event.

4 Tickets to event, invitation insert, and display board at event.

VIP KITTY $10,000

2 Tickets to event, invitation insert, and display board at event.

8 Tickets to event with preferred seating, inclusion in press releases, logo on website, invitation insert, and your corporate banner at the event; recognized through FGP social media and display board at event.

DIVA DOG $5,000 6 Tickets to event, logo opportunities, and invitation insert; recognized through FGP social media and display board at event.

For more information, contact Caroline Hunter at 404/374-8588 or caroline@ fixgeorgiapets.org.

SPONSORS

BEST CELEBRITY $1,000 The Host Committee, led by passionate people in our community, stands ready to help Georgia! Come Together to Fix Georgia Pets Red Carpet Fête and Auction will help raise much needed funds for the coordination of large scale spays and neuters across Georgia. We want to celebrate our support network of generous donors who are giving back while paying forward to reduce euthanasia and try to end animal overpopulation. Fix Georgia Pets is a 501(c)(3) charitable organization. Your donation will be tax deductible to the extent allowable by the law. Please contact Caroline Hunter for more information on sponsor levels and benefits.

caroline@fixgeorgiapets.org or 404-374-8588

and P A T R O N S

will be invited to a private Patron Party, honoring your generous support, on Thursday, September 22nd at a private home in Buckhead catered by Soiree Catering and Events

formal invi�a�ion to follow

Southern Seasons Magazine

| 31

pick of the

Litter Cuddle Clones Anchors Aweigh!

Waggo puts a nautical spin on playtime with these durable rubber chew toys, both bright and buoyant. Non-toxic; phthalates and BPA free. $15 each; $24 per set. waggo.com

Proud parents of fur babies are sure to love Cuddle Clones, custom-made stuffed animals that capture the unique likeness of one’s pet. Submit photos of the pet, and in several weeks an exact replica arrives at the door. The company, based in Louisville, Ken., gives a portion of every purchase to animal shelters, pet adoption services and other pet charities. $179 and up. cuddleclones.com

Happy Trails Soak up the sun and have some fun on these dog-friendly trails recommended by David York of Barking Hound Village: Sweetwater Creek State Park, just outside the perimeter, boasts a network of hiking trails along a whitewater-filled creek; Morningside Nature Preserve comes complete with a “dog beach” on South Peachtree Creek; and West Palisades Trail, winding along the Chattahoochee River, offers a shallow mid-hike swim on Rottenwood Creek.

HEADS UP!

Unlike conventional dog life jackets, the HedzUp Pets Watercollar™ is designed to keep a dog’s nose and ears above water, even if unconscious. The collar hangs loosely away from the neck for ease of movement out of the water. In the water, the straps position the flotation device under the dog’s chin – allowing for easy treading or a panic-free swim to safety. $39-$55. hedzuppets.com

www.southernSeasons.net

Bow Wow BRUNCH Animal lovers unite for AHS benefit

In a noble quest to help homeless pets, the Atlanta Humane Society put a fun spin on its spring benefit at The Ritz-Carlton, Buckhead, welcoming 300-plus guests to a Bow Wow Brunch that ditched blacktie formality for family philanthropy. Chaired by Jennifer Healey, the inaugural gala introduced animal lovers of all ages to the life-saving mission of AHS, which placed more than 8,300 dogs and cats into forever homes last year. Ginny Millner, founder of Fix Georgia Pets, was presented with the 2016 Anne Cox Chambers Humane Heroine Award for her commitment to animal welfare. Su Longman, CEO of Pallet Central Enterprises Inc., took “Top Dog” honors for raising the most money for AHS (over $20,000) in the Who’s in the Doghouse campaign to support vital programs and services. Participants also included Alexandra Wilson from The Weather Channel, Jenner Wood of SunTrust Banks, Jason Pullman and Kristen Gates from 94.9 the Bull, and Southern Seasons’ Eileen Gordon, who were collectively “bailed out” for over $46,000 in this friendly competition leading up to the event. According to statistics from AHS, it costs an average of $560 in complete shelter care to take an animal from being homeless to having a loving home.

Bow Wow Brunch Committee: Katherine Tolliday, Lisa Brooks, Caroline Hanna, Jennifer Healey, Lisa Fuller, Laurie Mallis, Jenny Allen.

“Ginny has dedicated her life to helping animals. She realized the importance of spaying and neutering animals in order to decrease overpopulation, and we are grateful for her making a significant difference in animal welfare in our region.” – Cal Morgan, president/ceo, atlanta humane society

Ginny Millner, recipient of the 2016 Anne Cox Chambers Humane Heroine Award.

Karen Speigel, Travis Reed, Susan Tucker, John Speigel Southern Seasons Magazine

| 33

Pierson Hill

Mark Mandica

Toughie, the last Rabbs fringe-limbed tree frog, lives in the frogPod at the Atlanta Botanical Garden. Right: Frosted Flatwoods salamanders, native to Georgia, are critically endangered.

What’s in your Backyard? photo: Dominic Chavez. GRAPHIC: © Inktear/ Dreamstime.com

by laura turner seydel

What if I told you there was an entire underground world below you right now? The frogs you may see in your backyard are a tiny portion of the amphibian world surrounding you. According to Mark Mandica, Amphibian Conservation Coordinator at the Atlanta Botanical Garden (ABG), “If you weighed all the spotted salamanders, they’d weigh more than all the mammals and birds combined in a healthy ecosystem.” Salamanders on average live 50-51 weeks underground, until they emerge for their breeding season. Frogs and salamanders come in many shapes, sizes and colors and are critically important to ecosystems around the world. Unfortunately amphibians are dying off in huge numbers in a global mass extinction. Reasons are varied, but chief among them are habitat loss and the chytrid fungus. In the mid-’90s, then Amphibian Conservation Coordinator of ABG, Ron Gagliardo, started what is now one of the oldest amphibian conservation programs in the country. He and several botanists started working with frogs as a way to illustrate plant and animal relationships at the garden. From there the program gained momentum and started safeguarding rare plants and animals. Their work reached a crisis level in 2005 when the chytrid fungus was sweeping through Central America. ABG and Zoo Atlanta went ahead of the fungus and collected as many frogs as possible. After the collection, that same year the fungus killed 85% of amphibians in the region. Famed National Geographic photographer and creator of the Photo Ark, Joel Sartore, likened this to rescuing precious items

THE POWER IS YOURS

www.southernSeasons.net

from a burning house. Thank goodness they did because the frogPod at ABG is now home to some of the world’s rarest frogs (frogpodblog.blogspot.com). I took my children for a behind-the-scenes tour at ABG shortly after Ron and Joe Mendelson, director of Herpetological Research at Zoo Atlanta, returned from their rescue mission. We met them on our tour, and our whole family was totally inspired by their work. It was the beginning of long friendships, but it was my then 9-year-old daughter, Laura Elizabeth, who was truly moved. She befriended Ron and wrote a children’s book with his help, Our Friends the Frogs, with proceeds donated to Ron’s Amphibian Ark. ABG’s conservation program is centered around Captive Assurance Colonies which are collections of endangered animals kept safely in captivity, and bred with the hope they may one day be returned to the wild. For some like Toughie, the last Rabb’s fringe-limbed tree frog known in existence, this will never be a reality. For other species at the frogPod there is hope, but currently it is still not safe to

Mark Mandica

A component in the skin of the endangered phantasmal poison frog is 200 more times effective than morphine and non-addictive.

Mark Mandica

re-release. The chytrid fungus still remains in the area, with ecosystem and partnered with the U.S. Fish and Wildlife no known method of eradication, and growing in lethality. Agency, USGS, San Antonio Zoo, University of Missouri, According to Mark, “the more out of balance an ecosystem, Virginia Tech, Florida Fish and Wildlife Conservation the more lethal the disease becomes.” Professor Tyrone Commission and others. Hayes, U.C. Berkeley, released a study in 2006 positing Conserving amphibians is important for many reasons. agricultural chemical drift, and specifically the most Here in the South, we should be especially grateful for popular herbicide worldwide, atrazine, is compounding the their voracious bug consumption, and even better, spotted problem. Amphibians exposed to atrazine suffer suppressed salamanders are mosquito-eating experts! Mark says a mere immune systems, making them more susceptible to the 1,000 amphibians can eat five million bugs a year! Due to chytrid fungus. amphibian’s highly sensitive skin they are the first to show In the U.S. and specifically Georgia, amphibians are imbalances in the ecosystem. At ABG frogs can only be becoming increasingly endangered from habitat loss. For sprayed with “frog water” because if tap water was used, they eight years ABG has collaborated with Zoo Atlanta and would all die. There are some very important lessons there! Georgia Department of Natural Amphibians are also a critical Resources on a headstart program part of the food chain as popular for our rarest frog, the Gopher prey, and bug-eating predator. frog. They collect eggs every year, To humans, amphibians can raise the tadpoles up through have big health implications. For metamorphosis and release the example, a pharmaceutical study baby frogs in protected habitats revealed a compound in the skin in South Georgia. Their habitat, of the endangered Phantasmal the longleaf pine ecosystem, has poison frog is 200 times more been reduced by 97%. Other effective than morphine and nonanimals adversely affected by this addictive. In a healthy ecosystem, if you weighed all the reduction are the gopher tortoise, Atlanta residents can learn more spotted salamanders they would weigh more than all the mammals and birds combined! indigo snake and Mark’s favorite, about amphibian conservation the flatwoods salamander. from exhibits in the ABG The flatwoods salamander is a peculiar species that has conservatory every day at 11 a.m. They can also join Mark’s never been kept successfully in captivity. But Mark and hugely popular Metro Atlanta Amphibian Monitoring his team are trying to change that. They currently have Program. He gives workshops on how to identify and three adult salamanders and hope to go to 18 this season. monitor frogs and salamanders in your backyard. On the Flatwoods salamanders live underground until they emerge website, maamp.us, Mark has information, call recordings to return to the same small pond they were born in to breed. and pictures of each life stage of all 28 species we have in They have not been detected in South Carolina for six years, Atlanta. Outside the Southeast, you can visit amphibianark. very few last year in Georgia and none this year. Fortunately org to learn more about amphibian conservation. a broad coalition is working to restore their habitat. ABG’s Amphibians saw the dinosaurs come and go, surely we plant conservation efforts have targeted this endangered can save them now! Southern Seasons Magazine

| 35

southern

TALES n GRANDMA GATEWOOD’S WALK: THE INSPIRING STORY OF THE WOMAN WHO SAVED THE APPALACHIAN TRAIL, BEN MONTGOMERY (CHICAGO PRESS REVIEW)

n FIND AN OLD GORILLA: pathways through the jungle of business and life, BERT THORNTON (Lulu Publishing Services)

Waffle House executive gives sage advice on career success

affle House, Inc., one of the largest 24-hour restaurant chains in the world, came to fruition more than 60 years ago, but one of the most iconic additions to the franchise came in 1983 with the creation of Bert’s Chili. With more than 11 million servings sold each year, Bert Thornton – the recipe’s namesake – is proud to bear witness to the stamp he’s made not only on the menu, but also on the business world in general. “I’ve spent more than 40 years successfully shaping the careers of rising high achievers, including my own,” said Thornton, former president and COO of Waffle House. “I know a little about business, but a lot about people and how to help them maximize their potential.” In his new guidebook, Find an Old Gorilla: Pathways through the Jungle of Business and Life, Thornton shares advice for those on all ends of the career spectrum. Citing effective mentoring as the key to success, he details how to choose the right mentor, make critical decisions, and take specific action steps to becoming a strong leader. “No one else is responsible for your success or failure,” he notes. “What happens or fails to happen depends strictly upon your action or your inaction.” After graduating from Georgia Tech in 1968, where he attended on a full football scholarship, Thornton spent two years as an artillery officer in the U.S. Army, serving a tour in South Vietnam. In 1971, he joined Waffle House as a manager trainee, working his way to the top in 2004. He’s now vice chairman emeritus of Waffle House and resides in Pensacola, Fla., with his wife, Kathy. 36

www.southernSeasons.net

Equipped with Keds shoes, a change of clothes and some petty cash, 67-year-old grandmother Emma Gatewood from Gallipolis, Ohio, became the first woman to thru-hike the Appalachian Trail. Her journey in 1955 took 146 days and propelled her to national fame as “Grandma Gatewood.” She subsequently became the first person to walk the entire trail two and then three times. Ben Montgomery’s new biography chronicles her historic adventure in the Appalachian wilderness in amazing detail, showing how one determined woman became a pioneering trailblazer. “It didn’t take fancy equipment, guidebooks, training, or youthfulness,” Montgomery wrote. “It took putting one foot in front of the other – five million times.”

AJC DECATUR BOOK FEST Sept. 2-4 on the square

Drawing over 90,000 attendees each Labor Day weekend, the AJC Decatur Book Festival is the perfect place for authors and book lovers to unite. Presented Sept. 2-4 in the historic downtown Decatur square, the event features book signings, author readings, panel discussions, poetry slams (for adults and youth), writing workshops and more. It’s the largest independent book festival in the country and one of the five largest overall, hosting hundreds of national and local authors, from bestsellers to emerging writers, in all genres. Festival-goers can also enjoy a wonderful Book Market & Street Fair with 150 booths, food and beer vendors (as well as a wine garden), live music, cooking demonstrations, an interactive children’s area and an opening day parade. The Makers Tent covers a wide range of activities – from beekeeping to iOS app development to 3-D printing – and offers kid-friendly fun, as well. decaturbookfestival.com.

n LIES AND OTHER ACTS OF LOVE, KRISTY WOODSON HARVEY (berkley trade paperback original)

n THE BEE AND THE ACORN, PAULA WALLACE (ASSOULINE PUBLISHING)

SCAD founder Paula Wallace tells the school’s amazing story

ack in 1979, Savannah College of Art and Design opened its enterprising doors to 71 freshman. The mission of the tiny art school – the first of its kind in the South – was to prepare talented students for professional creative careers. What followed was an artistic renaissance in the realm of higher education. Today, the international university enrolls 12,500 undergraduate and graduate students from more than 100 countries, boasting four locations on three continents, with top programs in interior design, furniture design, architecture, fashion design and more. The visionary behind it all: SCAD president and founder Paula Wallace. In her newly-penned memoir, The Bee and The Acorn, Wallace candidly shares the trials and triumphs of building the school – from sticking it out through low enrollment and hurricanes to the defining moments of success that put SCAD on the map. “I imagined a student-centered university where the hands readily made what the mind dreamt and what the heart desired. SCAD is that magical triad of a place,” said Wallace, who started the school with her family at the age of 29, and has been a pillar of support and beacon of innovation for nearly four decades. The book is titled after the school’s mascot, the bee, and crest emblem, the acorn – two beings that defy the odds of nature in their ability to rise to great heights. Whimsical illustrations by SCAD alumna Emily Isabella punctuate the story with artful vignettes. An educator, entrepreneur, designer, preservationist, mother and wife who embraces an attitude of gratitude, Wallace encourages others to dream big and do the impossible. “The Bee and The Acorn is my way of sharing with others what they can do,” she said, “if only they dare to try.”

A fresh voice in southern women’s fiction, North Carolina native Kristy Woodson Harvey follows up her well-received debut novel Dear Carolina with a poignant story about the complexities of navigating family and love. Lynn “Lovey” White knows a little white lie is sometimes necessary to shield others from a painful truth. Her granddaughter Annabelle, on the other hand, firmly believes in living life honestly – thus deciding to abruptly dump her hedge fund manager fiancé and marry a musician she’d known for three days. But following her heart’s whims doesn’t go according to plan. And after stumbling upon some shocking discoveries, Annabelle questions the very foundation of her seemingly perfect life.

n A FINE IMITATION, AMBER BROCK (CROWN publishing group)

In her debut novel, Atlanta author Amber Brock sweeps readers into the glamorous world of New York’s high society during the 1920s. For restless Manhattan socialite Vera Bellington, the nights of charity balls and endless cocktail parties have lost their allure as she reflects upon her loveless marriage and empty Park Avenue penthouse, brightened only by her beloved paintings. When a mysterious artist arrives from Europe to paint a mural in Vera’s building, she’s unable to resist his charm and is pulled into a scandalous affair. As the rules and restrictions of life close in around her, she is forced to look within and find the strength to take control over her future – deciding whether life without love is really a life at all. Southern Seasons Magazine

| 37

T h e M a n y Fa c e s o f B e a u t y

by ronald E. goldstein, DDS

7 Tips to Stay Looking

Young

irtually every magazine in the past six months has featured stories on how to look younger. Many offer somewhat costly methods as the best approach, but others that can really help cost very little. This article offers some of each, and I am willing to bet that you may be guilty of one or more behaviors that could be making you appear older than you really are.

control your habits

When it comes to habit control, for most of us, how and what we eat is at the top of the list. True, regulating your eating habits can result in a younger looking body, but that is not what I had in mind. Nor am I talking about proper and regular brushing and flossing, although they, too, can help keep your teeth and gums healthier. The one bad habit that most people are totally unaware of is clenching and grinding (bruxism) your teeth, which can wear down your enamel edges. This devastating habit can make your smile, and therefore your face, look older by wearing down your front teeth. There is another good reason to break the habit. Long-term clenching or grinding can put so much stress on your teeth that it can affect your gum tissue, even causing your gums to shrink away from your teeth. This can result in exposing the roots of your teeth, requiring a gum graft to help repair the damage. So is the solution to get a night guard to wear when you are sleeping? That certainly is part of it, but what you and perhaps 95% of people are totally unaware of is day grinding. We tend to do it in periods of work-related stress, driving in traffic, and even solving everyday problems at home. The solution really does not cost anything to learn to stop the harmful habit. The simple rule is your teeth should only touch when you are eating! Read that line 38

www.southernSeasons.net

again, please, and put it in your memory. So if you find your teeth together or even touching when you are not enjoying a mealâ&#x20AC;Śjust stop it! Your reward will be to continue having a youthful looking smile with your two front teeth just slightly longer than the adjacent teeth. As a result, when you smile the curve of the biting edges of your upper teeth will mimic your lower lip line.

keep the color of your teeth looking bright

When it comes to the color of your teeth, one of the biggest mistakes you can make is waiting too long to begin bleaching your teeth. Assuming you brush and floss properly at least twice daily, your teeth and gum tissue should look healthy, unless you have a periodontal problem. However, there are external substances that can severely darken the teeth, such as smoking, drinking huge amounts of coffee, and even consuming large amounts of healthy but stain-producing foods such as blueberries. As the teeth become darker looking, your smile becomes older looking. Most everyone

ÂŠ Lucky Business | shutterstock

learn what is aging you

has some hidden enamel microcracks that tend to absorb food stains more rapidly than intact enamel. Therefore, try not to wait until your teeth become so dingy that bleaching may not be as effective as it could be. Bleaching doesn’t have to be expensive as there are numerous options available, from your dentist’s office to your closest drugstore or computer for Internet shopping. Most bleaching systems are based on hydrogen peroxide compounds and mainly carbamide peroxide for home bleaching, offering an affordable way to keep your smile looking youthful.

have your teeth contoured to create a younger looking smile

So few people are born with a perfect smile and that is why orthodontists are kept really busy. No doubt repositioning your teeth through typical braces, ceramic brackets or even invisible straightening (Invisalign) is almost always the best option. Although you may think that orthodontic treatment is pricey, think again, because most quick fixes such as porcelain veneers or all-ceramic crowns are not only much more costly, but they will need to be remade a few times during your lifetime. However, there is one possible less costly alternative depending on how misshapen your

teeth are. The technique is called cosmetic contouring of your natural enamel. The procedure normally can be done in a single appointment and can cost from a few hundred dollars to a few thousand, depending on the number of teeth involved and also the artistic talent of the dentist. In the consumer book Change Your Smile (Amazon), I created a comparative guide at the end of each chapter that shows all the ways each problem can be corrected, detailing the advantages, disadvantages, required maintenance, treatment longevity, and appropriate fees for each procedure. (The softbound book is inexpensive and royalties go to charity).

keep sun exposure to a minimum

Dermatologist Dr. Russell Harris of MetroDerm P.C. in Atlanta strongly recommends that to keep your skin looking youthful, you must protect yourself from the sun. The sun’s rays promote premature aging of the skin, or “photoaging,” and the long-term damage from sun bathing will last a lot longer than the tan. Dr. Foad Nahai, a plastic surgeon with Emory Healthcare, agrees, “Sun exposure and smoking accelerate aging of the facial skin. These ‘lifestyle habits’ lead to wrinkling of the skin and patchy color changes. Avoiding these and applying moisturizer will maintain the youthful Southern Seasons Magazine

| 39

frown lines and smile lines around the eyes. Early use of Botox by relaxing these muscles will prevent these lines from eventually deepening and becoming permanent. Starting early with the preventive measures mentioned above will save money in the long run.

maintaining healthy locks is possible on a budget

appearance of the skin and delay aging changes. Skin care with regular facials, microdermabrasion and light peels will also help. Topical retinoids, for example RetinA or Renova, are both preventive and therapeutic.” Dr. Harris advises his patients to use a water-resistant SPF of 30 or higher everywhere that is not covered by clothes, to seek shade between 10 a.m. and 2 p.m., and to wear sunglasses to protect eyes from fine lines.

Mitchell Barnes, stylist and co-owner of Carter/Barnes Hair Artisans in Atlanta, recommends that, “When a client gets a new cut/style, he or she needs to get a finish/blow dry to learn how to maintain the style and see the finished result. So when returning for maintenance haircuts, foregoing the finish/blow dry can save a client $45-60 dollars.” To keep hair healthy between haircuts, Mitchell adds that shampooing everyday with the proper products and even professionally coloring hair at a young age won’t damage hair. If you keep a fairly strict schedule of going to the salon every 6-8 weeks to keep the ends from splitting, then beautiful, healthy hair can be maintained over a lifetime. In summary, the tips given in this article are some of the most important but also some of the easiest rules to remember if you want to continue looking as young as you feel.

Dr. Harris suggests washing the face twice a day with warm water and a mild cleanser to keep the skin clean. After washing the face, apply a moisturizer because the skin becomes drier as we age, and as the moisturizer traps water in our skin it gives off a youthful look. To keep that youthful appearance, Dr. Harris emphasizes eating healthy food and getting enough sleep so your body has time to renew itself.

preventative treatment early on keeps the skin youthful longer

Dr. Nahai says that actions of the muscles that allow us to frown and smile eventually lead to permanent wrinkles, With a lifelong interest in beauty, Dr. Ronald Goldstein conducts ongoing research on the physical attractiveness phenomenon and its role in the achievement of personal success. His dental practice was the first to move beyond the smile and focus on overall facial harmony. He writes extensively for both consumers and the dental profession on beauty, esthetic dentistry and related topics. Dr. Goldstein is the author of the 2-volume textbook, Esthetics In Dentistry and Change Your Smile (12 foreign translations), which now in its 4th edition is the top-selling consumer guide to cosmetic dentistry found in thousands of dentists’ reception rooms around the world. He is on the advisory board of New Beauty magazine and writes for it as well. He is the founder of Tomorrow’s Smiles, a national non-profit fund that helps deserving adolescents receive life-changing smiles through cosmetic dentistry. His multidisciplinary practice Goldstein, garber & salama is in Atlanta, Georgia.

www.southernSeasons.net

a healthy lifestyle promotes healthy skin

By Dr. Karin Luise

On the path to

Healing

We were 29 years old when we first met for lunch on a patio overlooking Peachtree Road. A mutual friend had insisted I meet Denna Babul, knowing we had enough in common to extend lunch into dinner into drinks...which we did. On the surface, we were both strong, vibrant women who seemed to have it all together, but underneath, we were each facing emotional storms due to recent break-ups that seemed to unravel us at our cores. As we would later realize, we were going through these life experiences for a reason. We were being led to confront and heal one of our deepest wounds: fear of abandonment – which we later learned is the hallmark after-shock of father loss. A decade later, Denna and I would write and publish the book that would transform our lives: The Fatherless Daughter Project: Understanding Our Losses and Reclaiming Our Lives (Avery Books; Penguin Random House, June 7, 2016). But the journey had started long before that. Denna was 13 when her father tragically died, and she heard a voice tell her that she would not only heal from her pain, but would one day help women do the same. That calling never left her heart, and after several attempts at writing the book and one appearance on The Today Show, she called me in as the PhD on the project. Of course, we both knew that under my degree and professional experience, I also had my own hidden pain from father loss, due to divorce, abuse and estrangement. What I did not realize in those early months was that researching and writing the manuscript would be the very bridge to my own healing. With Denna’s insight and

Angela Morris

New book empowers fatherless daughters

encouragement, as well as my own work in therapy and prayer, I found a new, open pathway to healing my own wounds and resolving the buried issues with my own fathers. I knew that I had to walk further down my path in order to authentically ask other women to do the same. Through research and interviews, we uncovered the range of emotions that resurface for fatherless daughters as they mature and go through more inevitable heartbreak – in family, career and relationships. Future losses can trigger significantly deep pain for fatherless daughters, pushing them to either isolate themselves, seek out a range of coping mechanisms, or decide to grow by working through old wounds that they had kept hidden since childhood. We define fatherlessness as the loss of a bond with the father from a range of circumstances, including death, divorce, desertion, incarceration, abuse, addiction and emotional absence. In our study, one in two women identified as fatherless, usually before the age of ten. In an effort to bring life and language to the stories of our daughters, we also filmed the documentary “The Fatherless Daughter Project (TFDP)” and started a nonprofit foundation under the same name, which launched in Atlanta in 2015. Our mission was born out of the very experience that brought us together: the need to be heard, supported and empowered. Our book attempts to help women find their own healing by understanding the impact of their losses and recognizing the power of their own resilience.

For more details, visit FatherlessDaughterProject.com, DoctorKarin.com, DennaBabul.com Facebook: The Fatherless Daughter Project / Twitter & Instagram: DoctorKarin; FDPrjct Southern Seasons Magazine

| 41

gallery

VIEWS Sculpture rendering for “Tiovivo: Whimsical Sculptures by Jaime Hayon.” Courtesy of Jaime Hayon.

Playtime on the Piazza at the High

On June 3, the High Museum will unveil “Tiovivo: Whimsical Sculptures by Jaime Hayon,” an outdoor art gallery on the Carroll Slater Sifly Piazza featuring four larger-than-life wooden sculptures that inspire playfulness with eye-popping design and kid-friendly openings to stairs and slides. The site-specific installation continues an innovative initiative to animate the piazza by engaging visitors in an interactive art experience. On view through Nov. 27, “Tiovivo” will also become the stage for performances, art-making activities and special events co-organized with local partner institutions.

Tibetan Art at Carlos

ABOVE: Silver and gilt cup, saucer, and stand. Central Tibet (Lhasa), 19th century. LEFT: A Shrine for Tibet (section). PHOTOs COURTESY OF The Freer Gallery of Art and Arthur M. Sackler Gallery, Smithsonian Institution. from the alice s. kandell collection.

www.southernSeasons.net

Marvel at 220 works of Tibetan Buddhist art at the Carlos Museum’s exhibit, “Doorway to an Enlightened World: The Tibetan Shrine from the Alice S. Kandell Collection,” on view through Nov. 27. Presented in the traditional sacred context of a shrine (regarded as a “doorway” into a higher world), the pieces are arranged in a religiously appropriate manner on elaborately carved and painted wooden tables and cabinets. The collection features gilt-bronze Buddhas and bodhisattvas, a gilded bronze statue of the goddess Tara with a gem-encrusted crown and jewelry, ornate offering bowls and superb thangkas (scroll paintings). Objects from the Kandell Shrine, considered the only one of such magnitude and artistic quality in the United States, were created in artistic centers across the Tibetan Plateau as well as in China and Mongolia between the 15th-18th centuries.

ben rose

Sneaker Culture at High “The Rise of Sneaker Culture,” on view June 11-Aug. 14 at the High Museum of Art, follows the evolution of the sneaker from its origins in the mid-nineteenth century to its role as a status symbol of urban culture and marker of masculine identity. With 155 sneakers on display, the exhibit features works from the archives of manufacturers Adidas, Converse, Nike, Puma and Reebok; Prada and other major fashion design houses and designers; and private collectors including hiphop legend Darryl “DMC” McDaniels, sneaker guru Bobbito Garcia, and Dee Wells of Obsessive Sneaker Disorder.

Backstage, 17th Annual Corps de Ballet Kick-off Luncheon featuring Neiman Marcus’ Fall 2015 Runway SHOW at The Ritz-Carlton, Buckhead.

“Striking Poses” at Lenox Square

Dominion Rubber Company, Fleet Foot, ca. 1925. Collection of the Bata Shoe Museum. Photo: Hal Roth. Courtesy American Federation of Arts/Bata Shoe Museum.

Enjoy a front row seat to some of the city’s signature fashion events at “Striking Poses,” a new permanent exhibit of photographs by Ben Rose at Lenox Square. The images capture the essence of glamour and couture, from backstage to the runway, at such affairs as the Corps de Ballet Kick-off Luncheon, the Forward Arts Foundation Fashion Show and Luncheon, NBAF’s “Fine Art + FASHION” and Jeffrey Fashion Cares Atlanta – all featuring looks from designers found at Lenox and Phipps Plaza. The gallery is located between Cartier and Escada in the Neiman Marcus wing.

“Out of the Ashes” Multifaceted artist Lee Harper, an acclaimed dancer and choreographer well known for her Atlanta dance school and company, recently hosted an art show to benefit firefighters in Madison, who saved her paintings from a fire in the historic Vason Building, where she operates a studio gallery. “When we arrived at the scene, I was overjoyed to discover that the members of the town’s volunteer fire department had first protected my paintings with plastic coverings to shield them from water, and then safely removed them from the building,” said Harper, noting that the 40-plus pieces were created over a period of several years. Collectively titled “Out of the Ashes,” the art may be viewed by appointment through Aug. 1 by calling 404/3684900. leeharperfineart.com

Lee Harper’s painting of the historic Vason Building in Madison.

Southern Seasons Magazine

| 43

Silver icon triptych, 1907

From Russia with Love Private collection of treasures gifted to the Georgia Museum of Art

ithin a year of the 100th anniversary of the Russian Revolution, a previously unknown collection of works of art from Tsarist Russia will be on exhibition at the Georgia Museum in Athens from Sept. 3 to Dec. 31. It was presumed the majority of imperial treasures were destroyed or stolen during the revolution. However, with the aristocrats and elite classes fleeing chaos and death, many of these objects escaped with them. Hidden, disguised or through bribery, exquisite works of art and jewelry found their way to Europe and America. Recently it was revealed that many of these rare, highly-prized objects have

been preserved and cherished in the home of a Southern gentleman who has chosen the Georgia Museum as the repository of his collection. This exhibition, “Gifts and Prayers: The Romanovs and Their Subjects,” reflects the exquisite workmanship of court-appointed jewelers and craftsmen. Featured are ornate personal items of the Tsars, a Faberge design of Peter the Great’s boat, dazzling jewelry, imperial documents and military decorations from all the Russian Imperial Orders of Chivalry. Also on view are rare icons, a diamond-handled sword presented by Alexander I and an intricately designed trophy from the Crimean War.

The georgia museum of art is located on the campus of the University of Georgia and is open free to the public from 10 AM-5 PM Tues., Wed., fri. & Sat., 10 AM-9 PM Thurs., and 1-5 PM Sun. georgiamuseum.org 44

www.southernSeasons.net

Above: watercolor of the thanksgiving prayer of July 15, 1878. Top: Print showing the coronation banquet of Alexander II

Cigar box with enamel miniatures celebrating the coronation of Alexander II

Silver trophy from the Crimean War, 1856

Silver wreath presented to Southern Seasons Zabotkin, Magazine 1878 | 45 General-Lieutenant

Xhibitions

SUMMER

Alan avery art company

Through June 4 Rana Rochat, abstract paintings. New address: 656 Miami Circle, Atl. Tues.-Sat. 404/237-0370. alanaveryartcompany.com.

ANN JACKSON GALLERY 32 Canton St., Roswell. Mon.-Sat. 770/993-4783.

annjacksongallery.com.

ANNE IRWIN FINE ART

June 18, July 16, Aug. 20 Miami Circle Art Stroll, 11 AM-4 PM. 690 Miami Circle, #150, Atl. Mon.-Sat. 404/467-1200.

anneirwinfineart.com.

Art station ARTS CENTER Through June 4 AAFTA. 5384

Manor Dr., Stone Mountain. Tues.Sat. 770/469-1105. artstation.org.

ATLANTA BELTLINE

Ongoing Unique temporary public art installations along the Atlanta BeltLine corridor. beltline.org.

ATLANTA CONTEMPORARY ART CENTER

Through Aug. 7 “The Dapper Comes to the Walkers,” Dapper Bruce LaFitte, vivid drawings of New Orleans marching bands. “It Can Howl,” experiences of the American South, group show. Through Nov. 6 Michi Meko. 535 Means Street NW, Atl. Tues.Sun. atlantacontemporary.org. 404/688-1970.

ATLANTA HISTORY CENTER Through Oct. 10 “Fashion in

Good Taste: Women in Atlanta, 1920-1969,” at Swan House. Through Dec. 31 “Atlanta in 50 Objects,” display of 50 objects that tell Atlanta’s story. Through Dec. 31, 2018 Native Lands: Indians and Georgia. Opening July 2 “Gatheround: Stories of Atlanta,” with artifacts, ephemera and interactive media. 130 West Paces Ferry Road, Atl. Open daily. 404/814-4000.

atlantahistorycenter.com.

BESHARAT GALLERY

175 Peters St. SW, Atl. Thurs.-Sat.

besharatgallery.com. 404/5244781.

BILL LOWE GALLERY

June 3-July 18 “Isness of Being,” 46

Bassmi Ibrahim’s large-scale abstract paintings. Reception: 6-9 PM June 3. 764 Miami Circle, Suite 120, Atl. Tues.-Sat. 404/352-8114.

lowegallery.com.

BOOTH WESTERN ART MUSEUM

Through July 3 “Michael Naranjo: The Artist Who Sees With His Hands.” Through July 24 “Don Coen: The Migrant Series.” 501 Museum Dr., Cartersville. Tues.-Sun. boothmuseum.org. 770/387-1300.

breman museum

Ongoing “Absence of Humanity,” presents history of the Holocaust through artifacts and stories. “Eighteen Artifacts: The Story of Jewish Atlanta.” “100 Years of Hadassah Atlanta.” “Where the Wild Things Are: Maurice Sendak in His Own Words and Pictures.” 1440 Spring St. NW, Atl. Sun.-Fri. 678/222-3700. thebreman.org.

CALLANWOLDE FINE ARTS CENTER GALLERY Through June 24 “Reciprocity,”

featuring three series of works by Erika Hibbert, an Atlanta-based South African artist. 980 Briarcliff Road NE, Atl. Mon.-Sat. 404/872-

5338. callanwolde.org.

CENTER FOR PUPPETRY ARTS

Ongoing Jim Henson Collection,

interactive exhibit features iconic puppets and environments. Global Collection explores puppetry traditions in world cultures. Tues.Sun. 1404 Spring St. NW at 18th, Atl. 404/873-3391. puppet.org.

www.southernSeasons.net

DK GALLERY

June “On the Surface,” contrast of surfaces, group show. July “I’ve Got the Blues,” art that is blue, gallery artists. Aug. “Inside Out,” interiors and exterior scapes. Sept. “Smile.” Opening receptions: 5-9 PM first Friday of the month. 25 W. Park Square, Marietta. Tues.-Sat. dkgallery.us. 770/427-5377.

FERNBANK MUSEUM OF NATURAL HISTORY

Through July 31 “Wild Music,” an exploration of sound and music in nature and in life. Through Aug. 14 “Creatures of Light: Nature’s Bioluminescence,” the amazing natural phenomenon of organisms that produce light. 767 Clifton Road, Atl. Open daily. fernbankmuseum.org. 404/9296300.

FERRARI FINE ART

425 Peachtree Hills Ave., Ste. 3, Atl. Mon.-Sat. ferrarifineart.com.

404/698-5035.

FIRST FRIDAY ART WALK

Monthly Self-guided walking tour of the galleries of the Roswell Art District. 6-9 PM on the first Friday of the month. 770/594-9511.

roswellartdistrict.com.

georgia museum of art Through June 19 “Frank Hartley

Anderson: Forging the Southern Printmakers Society.” “Refining Realities,” electronic installation art. Through July 31 “George Segal: Everyday Apparitions.” Through Aug. 7 “Turned and

DAPPER BRUCE LAFITTE Through Aug. 7 Atlanta Contemporary Sculpted,” wood art from collection of Arthur and Jane Mason. June 4-Aug. 21 “Paper in Profile: Mixografia and Taller de Gráfica Mexicana.” 90 Carlton St., Athens, East Campus of UGA, Arts Complex. Tues.-Sun. georgiamuseum.org.

706/542-4662.

HERITAGE SANDY SPRINGS MUSEUM

Through Aug. 1 “Sandy Springs:

Then & Now,” historic photos, modern studio art, and multimedia components. 6075 Sandy Springs Circle. Open 11 AM-2 PM Wed. & Sat. heritagesandysprings.org.

HIGH MUSEUM OF ART

Through Aug. 21 “Vik Muniz” retrospective, photography.

Through Oct. 30 “A Cut Above:

Wood Sculpture from the Gordon W. Bailey Collection.” Through Jan. 8, 2017 Eric Carle retrospective of 80+ collages from 16 of his most popular books. June 3-Nov. 27 “Tiovivo: Whimsical Sculptures by Jaime Hayon,” large-scale interactive installations on the Sifly Piazza. June 11-Aug. 14 “The Rise of Sneaker Culture,” featuring 160 pairs of sneakers. June 11-Sept. 11 “Walker Evans,” documentary photography.

Woodruff Arts Center, 1280 Peachtree St. NE, Atl. Tues.-Sun.

BASTILLE DAY July 14-28 Huff Harrington Fine Art

404/733-HIGH. high.org.

HUFF HARRINGTON FINE ART July 14-28 Bastille Day group

show featuring works inspired by France. Reception: 6-8 PM July 14. 4240 Rickenbacker Dr., Atl. Mon.-Sat. huffharrington.com.

Amy Dixon, “Eiffel No. 5”

404/257-0511.

MOCA GA

JACKSON FINE ART

Creecy: Retrospective. Museum of Contemporary Art of Ga., TULA Art Center, 75 Bennett St. NW, Atl. Tues.-Sat. 404/367-8700.

Through July 9 Christopher

Bucklow: “Guests.” Liu Bolin: “Hiding in the City.” Willie Anne Wright: “Direct Positive.” 3115 East Shadowlawn Ave., Atl. Tues.-Sat. 404/233-3739.

jacksonfineart.com.

LAGERQUIST GALLERY

June 18, July 16, Aug. 20 Miami Circle Art Stroll, 11 AM-4 PM. 690 Miami Circle NE., Atl. Tues.-Sat. 404/261-8273.

Through Aug. 20 Herbert

mocaga.org.

MOCA GA/TULA Art Complex

Eclectic collection of working artist studios, fine art galleries and alternative art spaces. 75 Bennett St. NW, Atl. Tues.-Sat.

tulaartcenter.com.

lagerquistgallery.net.

MODA

LUMIÈRE GALLERY

America.”

Galleries of Peachtree Hills, 425 Peachtree Hills Ave. NE, Ste. 29B, Atl. Tues.-Sat. 404/261-6100.

lumieregallery.net.

MARCIA WOOD GALLERY

Through June 18 Marcus Kenney. June 23-July 30 Amy Landesberg

Plasti-Plast. Opening reception: 7-9 PM June 23. 263 Walker St., Atl. Tues.-Sat.

Through June 12 “Make-Believe June 26-Oct. 2 “Beautiful Users,”

organized by the Cooper Hewitt National Design Museum, features 100 objects that illustrate the evolution of user-centered design. “On You: Wearing Technology.” Museum of Design Atlanta, 1315 Peachtree St., Atl. Tues.-Sun.

museumofdesign.org. 404/9796455.

marciawoodgallery.com. 404/827-0030.

OGLETHORPE UNIVERSITY MUSEUM OF ART

MARCUS JEWISH COMMUNITY CENTER

Pastel Society 17th International Juried Exhibition. 4484 Peachtree Road NE, Atl. Tues.-Sun. 404/364-

Katz Family Mainstreet Gallery, MJCCA-Zaban Park, 5342 Tilly Mill Road, Dunwoody. 678/812-4002.

atlantajcc.org.

MArietta/cobb museum of art Through June 26 “Catch the

Wave: The Coca-Cola Company and Mason Fine Art Collections.” July 9-Sept. 11 Metro Montage XVI juried exhibit. “Philip Juras: The Wild Treasury of Nature.” 30 Atlanta St., Marietta. Tues.-Sun.

mariettacobbartmuseum.org. 770/528-1444.

MASON FINE ART

415 Plasters Ave, Atl. Tues.-Sat. 404/879-1500.

masonfineartandevents.com.

MICHAEL C. CARLOS MUSEUM

Through Nov. 27 “Doorway to an Enlightened World: The Tibetan Shrine from the Alice S. Kandell Collection,” compelling works of Tibetan Buddhist art presented in their proper sacred context. Emory University, 571 South Kilgo Circle, Atl. Tues.-Sun. 404/727-

4282. carlos.emory.edu.

Through June 26 Southeastern

8555. museum.oglethorpe.edu.

PRYOR FINE ART

June 18, July 16, Aug. 20 Miami Circle Art Stroll, 11 AM-4 PM. 764 Miami Circle, Ste. 132, Atl. Mon.-Sat. 404/352-8775.

pryorfineart.com.

r. alexander GALLERY

5650 Peachtree Pkwy., Peachtree Corners. Tues.-Sat. 770/609-

8662. ralexanderfineart.com.

ROBERT C. WILLIAMS PAPER MUSEUM

Georgia Tech campus, 500 10th St. NW, Atl. Mon.-Fri. 404/894-7840.

ipst.gatech.edu/amp.

SANDLER HUDSON GALLERY

1000 Marietta St. NW, Ste. 116, Atl. Tues.-Sat. 404/817-3300.

sandlerhudson.com.

SCAD FASH

Through Aug. 21 “Grand

Divertissement à Versailles, Vintage Photographs by Bill Cunningham,” images of the 1973 fashion show, “The Battle of

Versailles.” Savannah College of Art and Design’s museum, 1600 Peachtree St. NW, Atl. scadfash. org. 404/253-3132.

SPALDING NIX FINE ART

TEW GALLERIES

Through June 9 America Martin. June 17-July 22 Steffen Thomas. Aug. 5-Sept. 3 “The Nude.”

425 Peachtree Hills Ave. NE, Suite 30-A, Atl. Mon.-Fri. 404/841-7777.

spaldingnixfineart.com.

SWAN COACH HOUSE GALLERY

June 2-July 30 Summer Swan Invitational, exhibit and sale of glass, ceramics, fiber and handmade objects by Georgia artists, including the Berman family potters. 3130 Slaton Dr., Atl. Tues.-Sat. 404/266-2636.

swancoachhouse.com.

425 Peachtree Hills Ave., No. 24, Atl. Mon.-Sat. 404/869-0511.

tewgalleries.com.

THOMAS DEANS FINE ART

June 18, July 16, Aug. 20 Miami Circle Art Stroll, 11 AM-4 PM. 690 Miami Circle NE, #905, Atl. Mon.-Sat. 404/814-1811.

thomasdeansfineart.com.

ALL TIMES AND DATES SUBJECT TO CHANGE. PLEASE CONTACT INDIVIDUAL VENUE FOR CONFIRMATION. Southern Seasons Magazine

| 47

Marimekko

Finnish design house Marimekko welcomes summer with a peppy pop of color and pattern. Right: Oiva and Siirtolapuutarha plates, Quilt and Okko napkins, Flower and Urna vases, Konkkaronkka cutlery, Sukat makkaralla tumblers and stemware. Below: Cushion covers in Pienet Kivet, Tiiliskivi and Varvunraita; Valoisa lamp. us.marimekko.com

Right: Lounge in comfort and style in Maya’s outdoor sectional in Sunbrella® Canvas orange with white zig-zag top stitching. Made in North Carolina, the collection’s armless design allows chairs and chaises to be placed side by side to create sofas or sectionals, or pulled apart for solo seating. Also pictured: Classic outdoor end table, Maui umbrella, Shore square planter and Sunbrella® Canvas solid outdoor pillows. roomandboard.com

www.southernSeasons.net

Marimekko

DESIGNFINDS

HOME &Design

Southern Seasons Magazine

| 49

Venetian plaster and spectacular sculpted curves define this exquisite veranda.

the Height of design BY EILEEN GORDON

the surprising impact of great ceilings

f you can envision a well designed room – any room – with higher ceilings, it can make a stunning impact. Simply increasing ceiling height from 8 to 10 feet makes a dramatic difference in the perceived grandeur and scale of the room. A savvy architect will never discount the ceiling of any space which is often 20% of

www.southernSeasons.net

the real estate in a room. Ceilings do not have to be flat, painted and devoid of detail. An oft-overlooked palette upon which to define one’s home, ceilings might boast a host of vaults or coffers, and be defined by a range of materials: painted or stained wood, brick, plaster detail, gold leaf, trompe-l’oeil or leather. Dare we say it? The sky’s the limit!

â&#x20AC;&#x153;You are only limited by your imagination, as skilled artisans can articulate nearly any ceiling that can be conceived.â&#x20AC;? William H. Harrison, AIA

The opulence of the oval hand-painted dome ceiling of this Beaux Arts mansion is exquisitely lit to appear to be a view of open sky. Southern Seasons Magazine

| 51

Steel beams and phenomenal angles are illuminated by the skylight in this dramatic modern space.

www.southernSeasons.net

The classic coffered ceiling in this charming Mission Revival kitchen is appointed by milk glass pendant lighting within each section.

Unique ceilings will dramatically enhance and define any room.

Harrison Designâ&#x20AC;&#x2122;s body of work extends over many decades and several countries. These stunning images reflect the diversity of style and original concepts which have made this firm iconic leaders in residential architecture. Southern Seasons Magazine

| 53

This classic French Country living room is perfectly appointed by wood beams softening the cathedral ceiling.

Moroccan-inspired wood and leather ceiling. 54

www.southernSeasons.net

The painted bead-board wood-clad ceiling coupled with stained accent beams raises this gallery hall from simple to sophisticated.

Natural light pours into this spectacular sunroom appointed with a vaulted glass skylit ceiling.

Southern Seasons Magazine

| 55

Not all

Proper

www.southernSeasons.net

are in

Manors Chris Nelms | VSI Group

England

Southern Seasons Magazine

| 57

Chris Nelms | VSI Group

The historic appeal of the English Manor home is not only its prominent size, but the timeless architecture which is impervious to changing styles as the centuries evolve. by eileen gordon and alera quinn

ts romantic provenance is a glimpse into the past when many European countries were in a feudal system. Manors and the properties on which they sat were organized territories, providing homes for the aristocratic gentry. They were often surrounded by walls articulating the borders of the property, which were little more than ornamental, despite the intended fortification. The manor home was the impressive centerpiece, where the lord and his lady resided. Smaller abodes served as housing for the staff, and there were stables and outbuildings as well. Originally established in Great Britain, the manor home was distinctively replicated throughout Europe and America with each culture adding its own indigenous elements of design.

www.southernSeasons.net

The spectacular Millwood Manor, inspired by Muckross House in Scotland, was developed by NorthStar and designed by Harrison Design. Sitting regally on just under two manicured acres at the corner of Garmon and West Garmon roads in Buckhead, the L-shaped homeâ&#x20AC;&#x2122;s exterior is finished in exquisite stonework with a slate roof, majestic gales, arched dormers and a host of windows through which the owner may survey his grounds. Luxurious amenities include an elevator, four car garages and a gunite swimming pool. The outdoor spaces and English gardens are as classic as the home itself and are designed to mature over time, gaining rich patina with age. The centerpiece of this modern-day manor is fortified by natural borders of verdant landscaping that affords privacy and a sanctuary on the outskirts of bustling Atlanta.

Southern Seasons Magazine

| 59

Chris Nelms | VSI Group

www.southernSeasons.net

Joey Rodgers

Chris Nelms | VSI Group

13,000 square feet of spacious interiors provide a magnificent canvas on which the new owners may uniquely imprint their own lifestyle and display their heirlooms, art and collections. Entering the home, soaring 12-foot ceilings on the main level underscore the connection with the outdoors that the generous windows provide. Improving on the romance of yesteryear, the home boasts a plethora of amenities to accommodate todayâ&#x20AC;&#x2122;s busier lifestyles. On the main level, the grand salon features a rounded niche, perfect for a grand piano, offering a glorious view of the property. The gorgeous reproduction fireplaces were created by Francois & Co. The pewter wide-planked French oak hardwoods have been meticulously hand waxed. The master suite includes a private study or sitting space and exquisitely appointed his and hers walk-in closets. Upstairs, the four en suite bedrooms offer a studio or recreation space for younger members of the family to congregate. Space over the garage allows a collector enough room to display his finds. The spacious kitchen combines classic traditional cabinetry design with modern state-of-the-art appliances and amenities from start to finish. Featuring the most tech-savvy tools, it is everything a gourmet chef could wish for. The glass-front cabinet doors and hood cover reflect the mullions in the steel windows. Quartzite and marble countertops and the oversized stainless steel sink with oil-rubbed bronze faucet keeps it dressed up. The heart of the home was masterfully created to look aristocratic and timeless by Kingdom Woodworks. Southern Seasons Magazine

| 61

Chris Nelms | VSI Group

While architecturally true to period, this home reflects the finest technology, materials and artistry from the greatest resources in the country. The design team for Millwood Manor did not hesitate to pursue the finest finishing touches available to impress potential buyers. Provenance Antiques Atlanta was delighted to set the stage with some exquisite furnishings from its impressive inventory of magnificent European antiques, dating from the 17th through the early 20th century. In Buckheadâ&#x20AC;&#x2122;s luxury homes market, there are very few homes of this stature available for sale and this new home is a rare find and a must-see for qualified buyers. Offered for sale at $5,750,000 by BETSY AKERS and WENDY ZOLLER 404.372.8144 OR 404.277.0747 | ATLANTAFINEHOMES.COM 62

www.southernSeasons.net

PHOTOGRAPHY BY Joey Rodgers Magazine Southern Seasons

| 63

nest jewelry

Cruise those

Blues

Summer style employs vibrant oceanic shades of blue from pale aqua to cerulean. The mixture of tonalities gives a Caribbean flair that is timeless.

nancy gonzalez

kendra scott Christian Louboutin

www.southernSeasons.net

style

halSton heritage

by gail oâ&#x20AC;&#x2122;neill

Seasons Magazine Magazine Southern SeaSonS

|| 65 65

pop the suz somersall

Devon leigh

lalo

The brightest white is a wardrobe staple from morning till night and invites a punch of color reflected in a whimsical showcase of accessories. Christian louboutin Devon leigh

polo ralph lauren 66 66

www.southernseasons.net www.southernSeasons.net

TROPICS HALSTON HERITAGE

OSCAR DE LA RENTA

SOUTHERN Seasons SEASONS Magazine MAGAZINE Southern

| 67 | 67

s ’ x e R rose alexis bittar

Atlanta-based designer, stylist and overall beauty guru Rex Weston simply adores rose quartz, the Pantone pick of the year! It’s the softest, dustiest shade of pink – beautifully flattering to all skin tones and oh-so-feminine. alexis bittar

edie Parker

soPhia webster

68 68

www.southernSeasons.net www.southernseasons.net

Marchesa

quartz ippolita

alexiS Bittar

Badgley MiSchka

paMella roland paolo SeBaStian Southern Southern Seasons SeaSonS Magazine Magazine

| 69 | 69

Saying “I do by Gail O’Neill

s CEO and president of Mark Ingram Atelier, an upscale bridal boutique located on New York City’s Park Avenue, Mark A. Ingram didn’t expect anything out of the ordinary from Bridal Fashion Week. And then came Naeem Khan’s Spring 2017 show. Khan, a master of beadwork and embroidery, presented a 23-piece collection. But sandwiched between his signature hand-embroidered organza flowers, petal appliqués and floralpatterned embellishments were two nontraditional silhouettes that took Ingram’s breath away. The first was a long-sleeved tunic over matching leggings. The second, an embroidered jumpsuit with plunging neckline. “My mouth was on the floor,” recalls Ingram, a 20-year veteran of bridal couture. “I was gasping for air!” Though Khan is at the vanguard of designers whose wedding wear is following the dictates of ready-towear, he is not alone. More and more, bridal design is mirroring the runway: offering elegant options for women who are less wedded to dreams of looking like princesses in ballgowns and more inclined to look like themselves on their wedding day. Same sex couples who prefer the freedom of pantsuits to the restrictions of mermaid skirts, corsets and trains are flocking to bespoke tailors like LES Downtown in Brooklyn. And fashion-forward brides who prefer to take their sartorial cues from 7th Avenue, as opposed to fairy tales, could not be more enchanted. “I could see many of my clients going for these looks,” says Ingram, who has a 70

www.southernSeasons.net

robust following among fashion editors in New York, Paris and London and brides-to-be from Europe, the Middle East and West Africa. “… if not for the wedding, then for the rehearsal dinner or after-party, for sure.” The editorial look is also favored by risk-takers like Solange Knowles, who famously arrived at her 2014 wedding ceremony in New Orleans astride a bicycle while wearing an ivory jumpsuit by Stephane Rolland. And then there are the trendsetters for whom more is more – who are saying “I do!” to pants while exchanging vows at City Hall or a registry before changing into a more traditional gown for an after-party or religious ceremony. Fortunately, the choices of what-towear are as varied as the brides themselves. This season alone, Christian Siriano channels flat-out romanticism with his ruffled, peplum tuxedo jacket over tailored white pants. Elie Saab’s Battenberg lace top paired with widelegged trousers and a barely-there belt nipping the waist evokes ’60s effortless chic. Lela Rose’s strapless tunic top (with oversized bow in back) over floor-grazing straight-legged pants epitomize Asian fusion dressing. And Carolina Herrera’s jumpsuit with Nehru collar, French cuffs and cropped pant with tulip vents is nothing short of a showstopper. The best way to balance the avantgarde look, says Atlanta-based makeup artist Alex Lucas, “is with an ethereal face. The look should be really soft with a strong brow, natural colored lips, a decent amount of mascara and lashes.” And for those not quite in step with the modern bride? A little smelling salts goes a long way! CHRISTIAN SIRIANO

!â&#x20AC;? to Pants

naeem khan

CAROLINA HERRERA Southern Seasons Magazine

| 71

Wood~Abrams

ritt Wood and Tom Abrams celebrated their 10-year relationship by eloping over the holidays! Pictured with their precious pups Speedy (left) and Malachi (right), these are two of the most talented and accomplished professionals in the city. Tom is now the assistant general manager of Neiman Marcus in Buckhead and Britt is an amazing wedding planner/designer (Britt Wood Designs LLC) whose events have been featured in Southern Seasons over the years. Heartfelt congratulations to this fabulous couple from all of us! 72

www.southernSeasons.net

photography by Grey Darrah

Photography by KATHERINE ROSE Southern Seasons Magazine

| 73

Singleton ~ Gosnell

day of magical enchantment unfolded at Barnsley Gardens in Adairsville this spring, when Jessica Lee Singleton and Ryan Phillip Gosnell were united in marriage April 9 in the storybook setting of the historic manor house ruins. With an intriguing history dating back to the 1840s, this unique destination in the north Georgia foothills was the perfect choice for a couple who truly wanted to make the day their own with a nod to pop culture and science fiction – perhaps most noticeably a life-size Tardis time machine straight out of “Doctor Who.”

“It was awesome,” said Jessica, who was radiant in a Zuhair Murad A-line gown with beaded embroidered bodice and soft silk chiffon skirt, her tulle veil ornately embellished with flowers, crystals and silk organza beaded trim. She wore her “something blue” tucked just beneath her hemline: kicky dance shoes with dazzling blue Swarovski crystals. The ceremony was officiated by the Rev. David Gilleland, under a lush canopy of Southern smilax and gardenias, with music by indie rock band Von Grey. The bride and groom recited their own vows before the 250 guests in attendance, all sharply dressed for the black-and-white themed wedding.

Photography by KATHERINE ROSE

www.southernSeasons.net

Southern Seasons Magazine

| 75

A cocktail reception followed at the Ruins, with singer Francine Reed belting out the blues in the scenic sanctuary. Afterward, a seated dinner was served in the glass-walled reception tent with dramatic décor by designer Robert Long, who brought the couple’s fantasy world to life with 25-foot trees draped with white lights and orchids, dome-shaped Spanish moss chandeliers, quartz crystal centerpieces with succulents, and an ethereal ice-sculpted buffet. Organic textures and a neutral palette elegantly underscored the unusual look. The four-layer, Bailey’s-flavored wedding cake, created by Cecilia Villaveces Cakes in Athens, was topped with customized figurines of the bride and groom as their favorite sci-fi characters: River Song from “Doctor Who” and Cloud from “Final Fantasy.” A dragon perched on the bottom tier. The groom’s cake was a replica of the Hylian Shield from “The Legend of Zelda.” To the delight of celebrants young and old, iconic rocker Alice Cooper took center stage to entertain with

www.southernSeasons.net

his son’s band, CO-OP. Two projection screens flanked the stage, with an illuminated dance floor lighting up the night. The wedding was beautifully coordinated by Lauren Brewton at Events with Grace and assisted by Gail Zantzinger from Robert Long Flora Design. Jessica, the daughter of Valery Voyles and Mark Singleton, is the general manager at Voyles Performance. She earned a bachelor’s degree from Brevard College with a double major in art history and comparative religion, and a master’s degree in art business from Sotheby’s Institute New York. Ryan, the son of Phillip and Michelle Gosnell, is a senior hardware engineer at Siemen’s Energy Management. He graduated from Auburn University, with a bachelor’s and master’s degree in electrical engineering. The newlyweds honeymooned in Costa Rica. They reside in Atlanta.

Southern Seasons Magazine

| 77

Pricilla Wannamaker

www.southernSeasons.net

Southern Seasons Magazine

| 79

Pricilla Wannamaker

KATHERINE ROSE

Anders ~ Meyne

rofessing their love in the splendor of a summer vineyard, Bailey Reid Anders and John Richard Meyne Jr. were united in marriage August 8, 2015, at Montaluce Winery in Dahlonega. The day dawned on a hillside overlook, where the bride and groom swapped gifts and shared a few quiet moments, and ended with a late-night sparkler send-off filled with hugs and warm wishes from family and friends. “The wedding day was simply amazing,” said Bailey, adding that the serene surroundings in the mountain foothills set a wonderfully relaxing pace. “John and I wanted the entire feel of the day to reflect our love for God, our love for every single person who was there, our quirky humor and our deep appreciation of simple things.” With a gentle breeze in the air and pleasant shade of clouds overhead, the picture-perfect ceremony was officiated by Clay Kirkland, who led an inspiring service for the 185 guests in attendance. Bailey was luminous in a white strapless gown by Essence of Australia, offset by the deep purple dresses of her bridesmaids and the scenic sweep of greenery. A reception followed with cocktails in the winery and a seated dinner at Le Vigne Restaurant, featuring the custom creations of executive chef Sean Fritchle. The rustic décor fittingly framed the vineyard setting, with flickering candlelight and lovely floral arrangements by Let’s Celebrate. For dessert, individual decorative cupcakes were served in a variety of flavors. After the newlyweds were sweetly toasted and the cake was cut, DJ Joel Rabe cranked up the dance party, which included a surprise fatherdaughter number to “Watch Me (Whip/Nae Nae)” by Silentó. “It was hilarious because we are such awkward dancers,” Bailey said, “but we went for it and everyone loved it.” The jubilant celebration continued long into the night. When it was time to depart, the newlyweds ran down an aisle of sparklers, waved their goodbyes and hopped into a vintage Cadillac convertible, eager to embark on their new life as husband and wife, starting with a honeymoon trip to Telluride, Colorado. “The feeling at the end of the day was deep satisfaction,” said Bailey, singing the praises of wedding planner extraordinaire Gillian Marto of Events of a Lifetime, as well as their parents: Randy and Kathy Anders on the bride’s side, and John and Lori Meyne on the groom’s.

Morgan Blake Photography 80

www.southernSeasons.net

Southern Seasons Magazine

| 81

“We were so happy knowing that we got to say ‘thank you’ and ‘I love you’ to every person at the wedding.” Brought together by their faith and service, the couple met on their first day of work at the UGA Wesley Foundation, a college ministry in Athens, shortly after graduating from the University of Georgia, where Bailey majored in English and John in marketing. They were smitten. John proposed to Bailey some 3,000 miles away in Oregon, where he surprised her on the West Linn dock on the river. “When we got there, I saw a man with a similar frame to John standing with his back towards me,” said Bailey, who had traveled across the country to help a friend move. “When he heard my voice he turned around, gave me a huge hug and then dropped to one knee and asked me to marry him!” 82

www.southernSeasons.net

Southern Seasons Magazine

| 83

www.tonybrewer.us 404 627 1666

www.southernSeasons.net

society The Atlanta Ballet Ball: An Evening in Paris, Photographed by Janet Howard Studio, Decor by Tony Brewer & Company Southern Seasons Magazine

| 85

Cause Parties for a

june

BROADWAY on PONCE

June 4 8:30 PM. Actor’s Express

fundraising event at Le Masion Rouge at Paris on Ponce will feature a surprise Broadway headliner, the incredible Ragtime, Jazz and Dixieland band, Blair Crimmins and the Hookers, as well as juggling, magic and dancing, delicious appetizers and decadent desserts, plus a live and silent auction.

actors-express.com.

I HAVE A VOICE

June 4 6:30 PM. Fundraiser at American Spirit Works with light hors d’oeuvres and cocktails followed by dinner, dancing and a brief live auction. The highlight of the evening will feature a performance by a small representative group of children who attend GiGi’s Playhouse Atlanta. gigisplayhouse.org.

cheers for children June 10 8 PM-midnight. This

Children’s Healthcare of Atlanta cocktail benefit will take place at American Spirit Works. Guests can enjoy an open bar, catered hors d’oeuvers, a silent auction, raffle prizes and live music. choa.org.

AN EVENING UNDER THE STARS

June 11 The Drake House is celebrating 10 years of service and success at Hodge Farm in Milton with an evening of fun and fellowship, with fabulous food, live music and fun auction items.

thedrakehouse.org.

LEUKEMIA & LYMPHOMA SOCIETY’S “MAN AND WOMAN OF THE YEAR” CELEBRATION

June 11 This Grand Finale Gala at the Hyatt Regency Atlanta

celebrates the culmination of a 10-week competition to raise funds for blood cancer research. The evening features a reception and dinner, as well as a live and silent auction. mwoy.org/ga. lexie.

jachowicz@lls.org. 404/720-7802

LOST OASIS 2016: Glow

June 11 8 PM-midnight. Join the Artemis Guild at Fernbank Museum for this 22nd annual event, inspired by the special exhibit, “Creatures of Light: Nature’s Bioluminescence.” This spectacular night to benefit children’s education features live music, hors d’oeuvres, an auction, prize drawing and the Lost Oasis Wine Wall. 404/929-6404.

artemis@fernbankmuseum.org.

MAGNOLIA BALL

June 11 Enjoy an elegant evening of cocktails, live and silent auctions, dinner and dancing to the ever popular “Grapevine” at the Dunwoody Country Club. Proceeds fund the preservation of Bulloch Hall, the 1839 childhood home of Mittie Bulloch, President Theodore Roosevelt’s mother. 770/992-1731.

bullochhall.org.

Southeast EMMY® AWARDS GALA

June 11 The Southeast Chapter of the National Academy of Television Arts and Sciences will recognize the best of the region’s TV productions at the 42nd annual awards dinner at the Grand Hyatt Buckhead, kicking off with a Champagne reception at 5 PM, followed by dinner at 6 PM and awards presentation at 7 PM. natassoutheast.tv.

southeastemmy.com.

CRUSING THE WORLD

June 14 5:30-9 PM. The Women’s Business Network of the Sandy Springs Perimeter Chamber of Commerce will present the 4th annual fashion show at UPS World

www.southernSeasons.net

Headquarters in Sandy Springs. Chamber members and other women’s business and community leaders will model clothing and accessories from the Drake Closet. Benefits the Drake House.

sandyspringsperimeterchamber. com.

Goodwill 90th birthday Celebration gala June 16 6-10 PM. The cocktail

style event will be held at the Delta Flight Museum and the birthday themed design captures the Goodwill spirit with festive, branded colors and floral décor designed by William Fogler. Drinks, dining and a live musical performance by Kristian Bush of Sugarland are sure to make this a night to remember. Proceeds benefit Goodwill of North Georgia.

goodwillbirthday.eventbrite.com.

THE WHITE PARTY

June 18 7-11 PM. Annual cocktail party and silent auction to benefit homeless youth served by CHRIS Kids at Mason Fine Art Gallery. 415 Plasters Avenue, Atlanta. 404/486-9034. chriskids.org. whitepartyatlanta.org.

BOOTS AND BLUEGRASS June 23 7:30-10 PM. Join

Ashford Park Friends of Children’s Healthcare of Atlanta for an evening of cocktails and music at Southbound Restaurant in Chamblee. choa.org.

FATHER OF THE YEAR AWARDS DINNER

June 23 6:30 PM. Five prominent business leaders will be honored by the Atlanta Father’s Day Council at this annual dinner at the the College Football Hall of Fame. Benefits the American Diabetes Association. Contact Tiffany Kirkland at tkirkland@diabetes. org or 404/320-7100 ext. 3096.

diabetes.org/foty.

Beer Garden Silent Auction and Fundraiser June 25 5:30-8:30 PM. Enjoy

a casual evening outdoors at Oakhurst Garden with local brews, food and music at this popular fundraiser for the Wylde Center, an environmental education organization. wyldecenter.org.

2016 BLACK TIE GALA

June 25 Presented by Winning The Battles in your Mind, this 4th annual black-tie benefit at the Cobb Galleria Centre supports families with children stricken with sickle cell anemia. The event features a full-course dinner, fashion show, entertainment and silent auction. 770/309-3655.

winningbattlesinyourmind.org.

WONDERFARM

June 25 7-11 PM. Premiere event that brings together fare from Atlanta’s most celebrated chefs and an art experience curated by Kris Pilcher. Guests can enjoy a cocktail reception, gourmet seated dinner, interactive demonstrations, performances, art installations and a silent auction within the new Armour Yards. Benefits Community Farmers Markets and WonderRoot. wonderfarm.org.

juLY NBAF GALA

July 9 7 PM. NBAF will present its annual gala, “Platinum and Purple: A Marquee Evening” at Flourish by Legendary Event. Hallmarks of the gala are lively entertainment and great performances, and a live and silent auction of unique items. Pedro and Tomeka Cherry, honorary chairs. Co-Chairs are Tony Conway, Brenda Wood, and Monica and John Pearson. NBAF will showcase and honor the trailblazers and luminaries who have contributed to

NBAF GALA at Flourish July 9

and shaped theater as well as the young, rising stars. 404/730-6369.

nbaf.org.

SUMMER WINE AUCTION

July 28 7-10 PM. This benefit for enAble of Georgia, held at the home of Tom and Michelle Davis, includes heavy hors d’oeuvres, entertainment and an exiciting live auction.

enablega.org.

ON THE LIGHT SIDE

July 29, 30 6:30 PM. Capitol City Opera Company will be holding its annual fundraiser at the Church of the Atonement featuring the music of Stephen Sondheim. Attendees are invited to bring their own “indoor picnic” dinners, and experience beautiful music in the air-conditioned indoors. The event will also feature a silent auction.

AUGUST Kaleidoscope - A Global Celebration Aug.13 7-11 PM. MedShare, an

Atlanta-based humanitarian aid organization, will transport guests to Africa, Asia and Latin America during its inaugural fundraising gala at The Foundry at Puritan Mill. The event will feature live entertainment, international cuisine and inspiring speakers while raising funds to support MedShare’s work.

kaleidoscope.medshare.org/.

GIVE ME FIVE

Aug. 14 5 PM. An amazing fivecourse dinner will be prepared by five of Georgia’s top chefs with wine perfectly paired by five of Georgia’s best sommeliers at this evening of gourmet food and fine wine at Piedmont Driving Club. Benefits Share Our Strength. Each course will be accompanied

Kimberly Evans

ccityopera.org.

by commentary from the chefs and sommeliers. 770/436-5151.

GiveMeFiveDinner.org.

CHRIStal Ball

John Pearson, Monica Pearson, Brenda Wood and Tony Conway, Event Co-Chairs.

Summerour Studios in Midtown. Guests can enjoy summer cocktails and a silent auction followed by music and dancing. choa.org.

Aug. 20 6-10 PM. 16th annual gala at The Ritz-Carlton, Atlanta, honors Atlanta community leaders and organizations who have made significant contributions to improving the lives of children. Guests can enjoy dinner and live and silent auctions. Benefits CHRIS Kids’ programs and services.

ART PARTY 2016

404/564-3411. chriskids.org.

or call 404/233-3843 x211.

The summer sizzle

JEFFREY FASHION CARES

Children’s Healthcare of Atlanta benefit will take place at the chic

charitable fashion event, founded by renowned retailer Jeffrey Kalinsky,

Aug. 26 8 PM-midnight. This

Aug. 27 7 PM-midnight. This multi-media event offers a night of premiere art exhibitions, entertainment and food and drink at the Atlanta Contemporary Art Center. For sponsorship information, contact Veronica Kessenich at

vkessenich@thecontemporary.org

Aug. 29 7 PM. Atlanta’s premier

will feature a pre-show cocktail reception, fashion show and silent and live auctions at Phipps Plaza. Lila Hertz, Jeffrey McQuithy and Louise Sams, event chairs. Proceeds benefit Susan G. Komen Greater Atlanta and the Atlanta AIDS Fund. jeffreyfashioncares.com.

crime is toast breakfast Aug. 30 This signature event

of the Atlanta Police Foundation, at the Georgia World Congress Center, recognizes the brave men and women of the Atlanta Police Department with outstanding service awards. Jeff Sprecher, honorary chair. 404/586-0180. atlantapolicefoundation.org.

ALL TIMES AND DATES SUBJECT TO CHANGE. PLEASE CONTACT INDIVIDUAL VENUE FOR CONFIRMATION. Southern Seasons Magazine

| 87

Horizon On the

SEPTEMBER LEGACY AWARDS GALA Sept. 10 Big Brothers Big

Sisters of Metro Atlanta presents its annual black-tie awards dinner at The St. Regis Atlanta, with a reception, silent auction, dinner and awards presentation. bbbsatl.org.

404/601-7068.

Salute to America and the Arts Concert and VIP After Party Sept. 10 Noon-9:30 PM. Annual

concert celebrates the completion of Callanwolde’s capital campaign. Entertainer and GreenHouse Foundation founder CeeLo Green will headline the concert performing with the Celebrity All-Star Band to

be held in the beautiful Callanwolde Amphitheater. A VIP After Party will be held from 9:30-11:30 PM in the Callanwolde Mansion. callanwolde.

puppet-filled evening for a great cause. This black-tie optional seated dinner features a cocktail hour, and live and silent auctions.

404/881-5118. puppet.org.

auction at Flourish. Proceeds benefit Andee’s Army and Andee’s Army Adolescent Patient Assistance Endowment fund for Shepherd Center. andeesarmy.

WINE WOMEN AND SHOES

TANGERINE TANGO FASHION SHOW

atlanta symphony ball

loving women can sip, savor and shop for a cause at the Grand Hyatt Buckhead, with an opportunity to bid on silent and live auction items. Benefits research of gynecologic cancers at the Northside Hospital Cancer Institute. 770/667-4047.

promote Hunger Action Month in September, Bloomingdale’s Lenox Square is presenting a fashion show with the latest designer looks. Benefits the Atlanta Community Food Bank. For more information, visit acfb.org.

Sept. 17 A special evening of music and celebration in honor of the Grammy Award-winning Atlanta Symphony Orchestra and its 72nd season. Guests can expect a new ball experience with music, a luxurious seated dinner and can’t-miss auction items.

ANDEE’S ARMY “EVENING OF HOPE”

The Big Deal

evening features cocktails, dinner, live music, dancing and a live

Healthcare of Atlanta for a cocktail celebration in honor of the

org. GHFoundation.org. 404/872-5338.

Sept. 11 2 PM. Wine savvy, shoe-

winewomenandshoes.com/ atlanta.

STRING FLING GALA

Sept. 10 The Center for Puppetry Arts’ promises a unique, fun,

Sept. 13 5:30-7:30 PM. To help

Sept. 16 7 PM. This elegant

com.

atlantasymphony.org. Sept. 17 7 PM. Join Children’s

swan coach house flea market preview party at the Atlanta History Center – September 22

Honorary chairman Bettye Maddox and her daughter, Flea co-chair Sissy Davis, with fellow Flea co-chair Amanda Tucker and honorary chairman Jean Astrop.

Michael Kriethe and Lilly Kriethe-Reed, dressed in Burberry, with Flea Market co-chairs Amanda Tucker and Sissy Davis.

Photography by Kim Link

www.southernSeasons.net

SWAN COACH HOUSE FLEA MARKET PREVIEW PARTY

Sept. 22 Guests can get a sneak peek at the elegant “treasures” offered for sale at the Forward Arts Foundation’s fundraiser at the Atlanta History Center and have the opportunity to bid on an array of silent auction items. The market runs from 9/23-9/24. Tickets available online at 501auctions. com/2016fleamarket or at the Swan Coach House Gift Shop.

404/261-9855.

hope flies: catch the cure

Sept. 23 7 PM. Enjoy a fabulous night of dinner, cocktails and dancing. Unique raffle, live auction and surprises will all be part of a fun evening to benefit the Foundation for Mitochondrial Medicine at American Spirit Works. mitochondrialdiseases.org/event/ catchthecure/.

GARDEN OF EDEN BALL

Sept. 24 6:30 PM. The Atlanta Botanical Garden’s black-tie benefit features cocktails and a seated dinner in a tented ballroom on the Great Lawn. Shearon and Taylor Glover, honorees. Stephanie and Austin Stephens, chairs. Dean DuBose Smith, ball advisor. 404/591-1730.

atlantabotanicalgarden.org.

CORPS DE BALLET kick-off LUNCHEON

Sept. 26 11 AM. The Atlanta Ballet kicks off its season at this 18th annual luncheon at The Ritz-Carlton, Buckhead, featuring a runway presentation by Neiman Marcus and a performance from Atlanta Ballet dancers. atlantaballet.com/

corps-de-ballet/. 404/873-5811, ext. 208.

PARTY IN THE KITCHEN Sept. 29 7 PM. Enjoy an

evening of music, cocktails and exquisite cuisine prepared by chefs from some of Atlanta’s finest restaurants at the American Spirit Works. Benefits Open Hand.

projectopenhand.org/s-eventspitk10.asp. partyinthekitchen.org. 404/419-3333.

OCTOBER LATIN FEVER BALL

Oct. 1 7 PM. The Latin American Association presents its 28th annual gala at the InterContinental Atlanta. The black-tie event features Latin cuisine, a live Latin orchestra and silent auction. Benefits the programs and services of LAA. Ball chairs are Rey and Genie Pascual. 404/471-

1892. ereyes@thelaa.org.

PINK RIBBON PARTY

Oct. 2 6:30-10 PM. Opening party for the Pink Ribbon Classic Golf Tournament (Oct. 4) at the River Club Lodge in Suwanee. The elegant evening includes hors d’oeuvres, wine, and live and silent auctions. Party by invitation only. Benefits the American Cancer Society. pinkribbonclassic.org.

Adam Davila

innovation and impact made by the many physicians who proudly serve CHOA. The evening will feature games of chance, dinner, a silent auction and live music. Three outstanding physicians will be honored: Gary Frank, M.D.,The Rising Star Award; Cedric Miller, M.D., The 1998 Society Award; Jules Sherwinter, M.D., The Pediatric Pioneer Award. choa.org.

Polo for Parkinson’s

Oct. 9 2 PM. Wilkins Parkinson’s Foundation presents a day of polo at Chukkar Farm and Polo Club, with music, food, open bar, silent auction, champagne divot stomp and “best hat” contest. Benefits Parkinson’s disease awareness. For sponsorship information, call 770/730-5840 or visit

poloforparkinsons.com.

MiddelthonCandler Gala

Oct. 12 7 PM. Awards dinner at the Millennium Gate Museum. On display at the museum during the gala The Games: Ancient Olympia to Atlanta to Rio, will showcase ancient Greek artifacts, many exceeding 3,000 years of age. The exhibition will introduce visitors to the mythology of Mount Olympus and the twelve Olympian Gods as this mythology played a momentous role in the lives of the ancient Greeks. 404/446-4307.

thegateatlanta.com/gala/.

CRYSTAL BALL

Oct. 15 The Arthritis Foundation’s 35th annual benefit at The RitzCarlton, Buckhead is themed “The Enchanted Forest...Once Upon a Time.” The elegant evening includes a formal dinner, live music and dancing, and an exclusive silent auction. arthritis.org. the-

crystal-ball.org. 678/237-4458.

Crystal Ball chairs John and Kristen Novay and Drs. Tom and Mara Morrison.

crystal ball

at The Ritz-Carlton, Buckhead October 15 information, contact Caroline Hunter at 404/374-8588 or caroline@

The Art of Nature Gala Oct. 15 6-11 PM. This benefit

for Caring for Others, Inc. at the Georgia Aquarium honors Robert LoCascio, Dwight Pullen and former Mayor Shirley Franklin. Guests can enjoy an evening of dinner, dancing, live music and silent auction. Event chairs Merceditas Z. de Padua and Shelly Jones. 404/761-0133.

caring4others.org.

COME TOGETHER TO FIX GEORGIA PETS RED CARPET FÊTE

fixgeorgiapets.org.

HEARTS AND HANDS GALA

Oct. 22 Annual black-tie dinner at Flourish will feature a seated dinner, live and silent auctions and live entertainment. Presented by The Coca-Cola Company. Benefits Atlanta Ronald McDonald House Charities. Javier Goizueta, event chair. armhc.org. 678/704-8086.

Oct. 20 6:30-9:30 PM. Annual

Monster Mash Fairy Tale Bash

auction fête at The Estate and Gardens promises an elegant evening with live entertainment, signature cocktails and hors d’oeuvres, and a silent and live auction presented by Dean Crownover. Featured celebrity guests are Carolyne Roehm and therapy dog Chloe Hubal. For more

costume party benefiting the Marcus Autism Center at the Wild Heaven Brewery. Guest are encouraged to wear their most Grim(m) costume attire for a chance to win prizes. There will also be a makeup artist, photo booth, silent auction, DJ and food and drinks. choa.org.

Oct. 23 6-9 PM. Ghoulish fairy tale

ALL TIMES AND DATES SUBJECT TO CHANGE. PLEASE CONTACT INDIVIDUAL VENUE FOR CONFIRMATION. Southern Seasons Magazine

| 89

McHenry, Charlotte, Atlanta Ballet Ball chair Ginny, Charles and Lucy Brewer.

Atlanta Ballet Ball chair Barbara and Eric Joiner.

Ballet Ball

Atlanta Ballet, the countryâ&#x20AC;&#x2122;s oldest ballet company and the state ballet of Georgia, celebrated its 36th annual Ballet Ball in February at The St. Regis Atlanta in Buckhead. More than 500 guests attended the sold-out black-tie affair, which is the largest fundraising event for the 87-year-old organization. Proceeds from the festivities directly support the operations and initiatives of Atlanta Ballet in bringing professional dance to Atlanta and the Atlanta Ballet Centre for Dance Education. This year, under the leadership of chair Barbara Joiner, the event raised more than $500,000, one of the highest total revenues in the ballâ&#x20AC;&#x2122;s history. PHOTOGRAPHY BY NINH T. CHAU

Rebecca and Sanjay Gupta. 90

Atlanta Ballet Ball presenting sponsors Chris and Nicole Carlos.

www.southernSeasons.net

Chandra StephensAlbright from Coca-Cola and Warren Albright.

Peachtree Tents & Events founding partner Jeff and Rachael Terry.

Juanita and Jack Markwalter, chairman/CEO of Atlantic Trust, with Atlanta History Center president/CEO Sheffield and Elizabeth Hale.

Kathleen and Gary Rollins.

Swan House Ball

Guests enjoyed a perfect spring evening at the 31st annual Swan House Ball, held on the grounds of the Atlanta History Centerâ&#x20AC;&#x2122;s Swan House. Led by co-chairs Spring Asher and Victoria Palefsky, the event honored Mary Ann and Lloyd Whitaker and their philanthropic leadership of the Atlanta Cyclorama project. Atlantic Trust again served as the presenting sponsor, joined by The Coca-Cola Company, Cox Enterprises and Delta Air Lines as platinum sponsors, and Peachtree Tents & Events as tent sponsor. Host Committee co-chairs were Eileen and Bo DuBose with Karen and Richard Parker; Patron co-chairs were Blain and Ivan Allen IV with Lovette and Michael Russell. Joyce Shlesinger was Auction chair. Left: Co-chairs Victoria Palefsky and Spring Asher. Right: Honorees Lloyd and Mary Ann Whitaker. Below left: Patron co-chairs Michael and Lovette Russell and Ivan and Blain Allen. Below right: Bill Torres, Marge Sawyer, Jack Sawyer and Howard Palefsky. photography by Kim Link and Bartram Nason

Southern Seasons Magazine

| 91

Drew Tutton, GM, Ed Voyles Chrysler Dodge Jeep Ram and 1st Sgt. Kathryn Burns, Cobb County School District TOTY. Kathryn is a JROTC teacher at Campbell High School.

Bill Brantley, Ed Voyles Automotive Group presiden/COO; Ginny Lyons, Chalker Elementary School TOTY; and Don Marlowe, Ed Voyles Honda Fleet Manager.

COBB CHAMBER HONORS LOCAL TEACHERS OF THE YEAR

S Julie Pinto, Marietta City Schools TOTY, and John Schibi, GM, Ed Voyles Hyundai and Ed Voyles Kia. Julie is a math teacher at Marietta High School.

Bill Brantley and Carol Mickus, Cooper School TOTY. 92 Middle www.southernSeasons.net

aluting education in Cobb County, the Cobb Chamber celebrated 27 years of Give Our Schools a Hand (GOSH), with three events that brought together educators, students, parents, businesses and community leaders. The handprints of the 2015 Teachers of the Year (TOTY) were unveiled at a public ceremony at Glover Park on the Marietta Square, as 1st Sgt. Kathryn Burns from the Cobb School District and Julie Pinto from Marietta City Schools became the 27th pair to leave their handprint legacy on the Teacher Walk of Honor. A breakfast and pep rally were subsequently held to honor all Cobb County and Marietta City and post-secondary TOTY at Roswell Street Baptist Church, where students cheered on their favorite teachers and enjoyed school-sponsored dance and musical entertainment. Ed Voyles Automotive Group additionally presented a one-year lease on a new car of their choice to both Burns and Pinto, as well as to Cobbâ&#x20AC;&#x2122;s elementary and middle school top TOTY: Ginny Lyons and Carol Mickus.

????? ?????? and Ginny Lyons, Chalker Elementary.

Bloomingdaleâ&#x20AC;&#x2122;s presents the Basler Spring Collection Bloomingdaleâ&#x20AC;&#x2122;s hosted a fabulous fashion show featuring the spring collection of Basler presented by Troy Patruno. Guests enjoyed champagne and light refreshments while models walked the runway.

Troy Patruno, Basler area manager; Michael Walker, Basler senior VP of retail; and Lisa Fuller. Southern Seasons Magazine

| 93

RON Jones Photography

Thomas E. Lewis and Andrea Amar, Bronson Smith and honorary chair Dean DuBose Smith, Bronson and Laura Smith, Brad and Lindsay Bays.

Preservation Gala

catmax photography

Event chairs Ivan Allen IV and Blain Allen.

More than 400 guests enjoyed a “Meadow in the Moonlight” at the 32nd annual Preservation Gala for The Georgia Trust for Historic Preservation, held at the Allen family’s Buckhead property, The Meadow. Chaired by Blain and Ivan Allen IV, the event honored Dean DuBose Smith, who continues her family’s legacy of supporting Georgia’s historic resources. The benefit raised $110,000 for The Georgia Trust’s preservation and revitalization work.

Rand Suffolk (Nancy and Holcombe T. Green, Jr. director of the High Museum), honorary chair Louise Sams, Rhonda Matheison (High Museum CFO), David C. Driskell, Mark Bradford (2016 Driskell Prize honoree), Sally Morgens, co-chairs Jim Morgens and Alexis Scott, and Brian McKissick.

driskell prize dinner

The High Museum of Art’s Driskell Prize Dinner honored contemporary artist Mark C. Bradford, the 2016 recipient of the David C. Driskell Prize. Guests enjoyed a decadent dinner and dancing to the sounds of Class Act, with event design by Tony Brewer and Company. 94

www.southernSeasons.net

Jack Sawyer, Thelma Driskell, David C. Driskell and Dr. Bill Torres.

Ben Rose/Getty Images

Rebecca and Sanjay Gupta.

Ted Turner, Laura Turner Seydel, John R. Seydel.

The U.S. Fund for UNICEF hosted the 2nd annual Evening for Children First at The Foundry at Puritan Mill, raising more than $650,000 to support UNICEFâ&#x20AC;&#x2122;s lifesaving work for children around the world. Ted Turner was honored with the Global Philanthropist Award for his work with the United Nations Foundation, and for the tremendous impact he has made on the lives of countless children and their families. The event was presented by the Isdell Family Foundation.

liz erikson photography

Evening for Children First

Suzanne Malveaux.

Gailtricia and Tracy Fogg.

Bryan and Sara Ray.

Shaken, not Stirred Gala

Audrey Arrowood, Mary Tipton Carter and Christine Pullara.

Keeyoung and Duff Boyd.

The 6th annual Shaken, Not Stirred Gala, presented by Northside Hospital Cancer Institute, dazzled 700 attendees at the Delta Flight Museum with an elegant dinner created by Les Dames dâ&#x20AC;&#x2122;Escoffier International - Atlanta Chapter Chefs. The event raised almost $250,000 for the Georgia Ovarian Cancer Alliance and honored Mary Bernier, a 22-year survivor and original founding member of GOCA, as well as Mary Tipton Carter, a 9-year-old survivor. Southern Seasons Magazine

| 95

Jenny AROUND TOWN WITH

Ross Henderson

Jenny Pruitt, founder/CEO of Atlanta Fine Homes Sotheby’s International Realty, has set the bar with her professional endeavors and philanthropic support in Atlanta and beyond. Here’s where she was recently making the rounds:

Southern Spin

New Orleans writer Julia Reed drew an overflow crowd at the Cathedral Antiques Show at St. Philip’s Cathedral for her lecture, sponsored by Atlanta Fine Homes Sotheby’s International Realty. The bestselling author and witty essayist regaled guests with her recollections of growing up in the deep South. The annual show benefited Literacy Action. Above: The lecture of guest speaker Julia Reed (2nd from left) was supported by agents Sandra Carey, Wes Vawter, Ally May, senior VP Nancy See Quarles and (not pictured) Nancy Rizor.

Top Agents

Ross Henderson

An elegant dinner was hosted by Jenny Pruitt and David Boehmig to salute the company’s highest producing agents. Above: Wes Vawter of the Vawter Group, Jenny Pruitt and her brother Sandy Sanford. Right: #1 Agent Betsy Akers with Jenny Pruitt. Below: Kevin McBride, Atlanta Fine Homes Developer Services; Lisa Johnson, VP/managing broker of the Intown office; David Boehmig, founder/ president; and leading agent Clay Henderson of the Intown office.

The Boyd Team

With a three-generation real estate heritage, the Boyd Team has found a new brokerage home at Atlanta Fine Homes Sotheby’s International Realty. Kim Boyd is a Crystal Phoenix Award recipient of the Atlanta Board of Realtors Multi-Million Dollar Club and one of the board’s Top 5% Agents; Kathryn Boyd joined her mother in the profession two years ago. Kim’s own mother Holly Boyett was a real estate superstar who spent three decades in the business. Jenny Pruitt called the addition of the Boyd Team “a tremendous coup,” praising the dynamic duo as two of Atlanta’s most sought-after residential and luxury homes specialists. Above: Kathryn Boyd and Kim Boyd show their luxury listing, a French chateau estate, in a prime location.

www.southernSeasons.net

Robert & Betty Balentine.

Shelia & Milton Jones.

Old” (2014) by Vik Muniz, “The Dirty Spoon Cafe” (2002) by Winfred Rembert, “Portrait of Industrial Designer, John Vassos” (ca. 1935) by James Henry Daugherty, and “Indian Country” (2015) by Stanley Whitney.

David Allen, Lillian Darden and Egbert Perry.

The Foundation of Wesley Woods’ 27th annual Heroes, Saints and Legends gala at The St. Regis Atlanta was an overwhelming success. The prestigious awards ceremony and seated dinner honored Dr. J. David

Allen, Lillian Budd Darden and Egbert L. J. Perry. Proceeds support Wesley Woods Senior Living’s independent living communities and Alzheimer’s and Parkinson’s disease research and education programs at Emory University. kim Link photography

Heroes, Saints & Legends

The High Museum acquired four new works of art during the Collectors Evening at The St. Regis Atlanta. More than 200 attendees helped build the museum’s permanent collection, with the selection of “Vik, 2 Years

kim Link photography

Collectors Evening at the High

Ross & Ashley Kotkin and Randall Suffolk.

CatMax photography

John & Suzanne Kasler Morris and Michelle & Steve Sullivan.

Georgia Schley Richie, Donna Burchfield.

AHC Guild Spring Luncheon

Cindy Widner Wall, Michelle Davis.

Lisa Fuller, Ginny Brewer.

Celebrating its 26th year, the Members Guild of the Atlanta History Center hosted an afternoon of fashion, food and fun at its annual Spring Luncheon, chaired by Georgia Schley Ritchie and presented by Bill

Tom Abrams, Toni McGowan.

Bill Voyles.

and Cindy Voyles. The program included a presentation by the High Museum’s Sarah Schleuning, curator of Decorative Arts and Design; and fashion modeling provided by Neiman Marcus. Southern Seasons Magazine

| 97

on the

Homefront

Berkshire Hathaway HomeServices

Top Agents

Phoenix Awards Left: Marsha Sell, pictured with Dan Forsman at the Atlanta Board of Realtors Multi-Million Dollar Club gala, was the first-ever agent to receive the “Diamond” Phoenix Award for an incredible 40 years of membership. Above: Agents Greg Parks and Jodi Patterson, also from the East Cobb office, were awarded for their 10-year memberships.

The Peachtree City office and its Million Dollar producers were honored at a reception preceding the Fayette Board of Realtors’ Million Dollar Club Banquet. Above: Dan Forsman, president/CEO of Berkshire Hathaway HomeServices, leading agents Valerie Howard and Kelli Barrow, and Peachtree City office senior VP/managing broker Steve Quinn. Right: Fayette Board president and top agent Stephen Jackson with executive VP Toni McGowan.

Ross Henderson

Ross Henderson photography

Real Estate Educator

Guest speaker Tom Ferry riveted agents during Berkshire Hathaway HomeServices’ kick-off event at the Galleria Center. The California-based expert has earned a national reputation as a top business coach for professionals in the real estate and financial services industries. His latest book, Life! By Design, has become a best-seller. Above (left): From the Buckhead office, Debra Johnson, a Luxury Collection agent, and Bill Murray, Senior VP/managing broker. Above (right): Kathy Connelly, senior VP of Corporate Services; Susan Ireland, special guest from Washington, D.C. and manager of Business Consulting for BHHS; and Todd Tucker, managing broker of the East Cobb office. Ross Henderson photography

www.southernSeasons.net

“Elite” Honors

Recognized as the top 1% of agents globally and the best performers in residential real estate production in the country, “Elite Agents” were honored at an awards luncheon at The St. Regis Hotel. Above: From the Smyrna-Vinings office, Dan Petersen of Petersen Partners, the #1 Team company-wide, with Debra Johnston and Rachel Patel of the Buckhead office, and Dan Forsman.

Patron Party co-chair Juli Owens, Patron Committee co-chair Cecilia Wright, Arthritis Foundation, senior executive director Southeast Jamie Johnson, Georgia Schley Ritchie, Jade Slover and Faye Donaldson.

Dottie Smith with event designer Tony Brewer and Melanie Boltax.

Crystal Ball Patron Party

The Arthritis Foundation-Georgia recently hosted the kickoff luncheon for its 35th annual Crystal Ball, set to take place Oct. 15 at The Ritz-Carlton, Buckhead. With the theme “The Enchanted Forest…Once Upon a Time,” the benefit will help children with juvenile arthritis find their “Happily Ever After.” Photos courtesy of Adam Davila

Barbara Kelley, Jill Berry and Jade & Jack Slover, Patron Committee co-chairs.

Cathedral Antiques

Tour of Homes With the continuing support of co-sponsors Harry Norman, Realtors and Arrow Exterminators, the Cathedral Antiques Show Tour of Homes featured five magnificent Buckhead residences, including a circa-1928 Mediterranean Revival villa and a 1927 red brick home by Pringle & Smith, as well as three newer homes, designed by Harrison Design Associates, Michael Dobbs and Ladisic Fine Homes in collaboration with Linda MacArthur. The event was co-chaired by Barbara Waters and Janice Cook. Tour proceeds benefited Literacy Action. Above: Josh Richey, Savannah Thomas of Arrow Exterminators, co-chair Barbara Waters, Forde Kay of Harry Norman, Realtors, and co-chair Janice Cook in the glorious red dining room of one of the homes on tour. Right: Allison Sinkler and Mary Ellen Jones of Harry Norman, Realtors, co-chair Barbara Waters, and agents Natalie Spalding and Dorcas Winton admired the décor of a Buckhead estate. Photography by Ross Henderson

Southern Seasons Magazine

| 99

Cause to Celebrate

1 1. The Buckhead North office of Harry Norman, Realtors toasted Todd Banister’s awards at the Atlanta Board of Realtors Multi-Million Dollar Club Gala at the Georgia Aquarium. Joining in the celebration are Mary Clark Caldwell, Jim Simons, Todd Banister, Katiti Mwebe, Karen McRae, Madeleine Kotora, Lisa Walter, Betsey Banister, Krista Ward, Sally Wiggins and Rob Owen.

2. Travis Reed and Michael Kriethe of Harry Norman, Realtors sponsored the French Heritage Society’s luncheon for garden designer Louis Benech (2nd from right). They are pictured with French Heritage Society chair Suzy Wasserman and Betsy Franks of Harry Norman, Realtors. Photo by Kim Link 3. Congregating at the Friends of Shutze Party for the Shutze Awards are Barry Hutner of Parc Monceau, honoree Jackie & Bill Lanham, and Terry & Wes Vawter of The Vawter Group, the event sponsor. Photo by Kim Link 4. Melanie Turner and Stan Benecki, pictured with Shutze Awards chair Judy Talley, hosted the Friends of Shutze Party at their historic “Pink Castle” home, designed by Philip Trammell Shutze. Photo by Kim Link

3 4 5

100

www.southernSeasons.net

5. Cutting the ribbon for Harry Norman, Realtors new Milton office are Steve Krokoff, Ga. Sen. Brandon Beach, Kathy Vaughn, Jenni Bonura, Dan Parmer, Todd Emerson, and Milton Mayor Joe Lockwood. Photo by Kim Link

6 7 6. Enjoying the Patron Party for the 2016 Atlanta Ballet Ball are Elizabeth Morgan Spiegel, Jane & Greg Blount and honoree Ginny Brewer. The ball benefits the Atlanta Ballet and the Centre for Dance Education. 7. Eric Joiner, Atlanta Ballet Ball chair Barbara Joiner and Atlanta Ballet president/CEO Arturo Jacobus with hosts Melody & Joe Thomas at the Patron Party for the ball. 8. Pictured at the Patron Party for the Atlanta History Centerâ&#x20AC;&#x2122;s Swan House Ball: Steven Fearnley, Ruth Anthony, Ball chair Victoria Palefsky and Alex Fearnley. Photo by Kim Link 9. Atlantic Trust chairman/CEO Jack & Juanita Markwalter with Mark & Laura Miles, AHC board member, gathered for a beautiful spring Patron Party kicking off the 31st annual Swan House Ball. Photo by Kim Link

10. Attending a garden party in support of the Alzheimerâ&#x20AC;&#x2122;s Association Dancing Stars of Atlanta gala are Dr. William Torres, Dancing Stars chair Jan Collins, Patron Party co-chair Leslie McLeod and Dancing Stars judge Jack Sawyer. Photo by Ross Henderson 11. Forde & Carter Kay, Suzy Wasserman and James Simons at a Cocktail Culturel hosted by the French Heritage Society and sponsored by the Buckhead North office of Harry Norman, Realtors. Photo by William Rubin

9 11 10

Southern Seasons Magazine

| 101

etcetera

1 2 3 4

1. Over $155,000 was raised at the Odyssey Brunch at The St. Regis in Buckhead. Co-chairs Molly Caine and Mary Ann Groton with Odyssey executive director Jeff Cohen. Ben Rose Photography 2. Kimberly Gray Fess, Zak Lee, Cara Isdell Lee and Deanna Thomas pictured at the Odyssey Brunch. Ben Rose Photography 3. Davio’s CEO Steve DiFillippo and Martha Jo Katz at Davio’s Atlanta, discussing his new book “It’s All About the Guests.”

4. The Cobb-Marietta Coliseum & Exhibit Hall Authority has selected industry veteran Sandie Aaron as the new managing director of the Cobb Energy Performing Arts Centre. 5. BlazeSports America was honored at the International Day of Sport for Development and Peace. Showing their support were former NFL athlete Stevie Baggs Jr., Erika Mueller of BlazeSports America and Parag Shah of Shaw Law Firm. 6. Ryan Gravel, pictured with publicist Liz Lapidus, signed copies of his book “Where We Want to Live: Reclaiming Infrastructure for a New Generation of Cities” at Switch Modern’s Spotlight On Design series. Photo by Hilary Harmon 7. Patron Party hosts Jennifer & Martin Flanagan celebrated Earth Day at The Nature Conservancy’s “On Top of the World” benefit on the rooftop of Ponce City Market. 8. Pamela Isdell, executive director Deron Davis and Tricia Allen at The Nature Conservancy’s Earth Day fundraiser.

6 7

102

www.southernSeasons.net

10 9 9. Melisa Morrow of Children’s Healthcare of Atlanta accepted a contribution from Kiehl’s president Chris Salgardo at the store’s grand opening at Lenox Square this spring. 10. Cure CP co-founder Maurie Drambel, event chair Jennifer Kellett and co-founder Lizette Dunay gear up for the 4th annual Night at the Derby Auction this spring at the Summerour Studio. 11. “An Affair of the Art,” an art auction and cocktail party to benefit Jerusalem House, was co-hosted by ArtsNow at the Atlanta Decorative Arts Center. Enjoying the evening were Charles Yorke and Robin Sangston. Photo by Dan Lax for Jerusalem House 12. Erin Bakermans and Jason Hall were among the guests at “An Affair of the Art.” Photo by Dan Lax for Jerusalem House 13. Dawn Tresh, Kwanza Hall and Angelle Hamilton were among the 1,200 attendees at the 17th annual ART PAPERS Art Auction, held at BoBo Intriguing Objects on Atlanta’s Westside. benrosephotography.com

11 12 13

14. Kai Parham, Victoria Camblin and Sara Shlesinger joined the crowd at the ART PAPERS auction. benrosephotography.com 15. “A CHaRM’ing Evening” for the Center for Hard to Recycle Materials was held at Piedmont Park. The inaugural fundraiser was hosted by Atlanta City Council member Alex Wan (center) and the Live Thrive Atlanta Board of Directors, including board president Nicholas Niespodziani and founder/executive director Peggy Whitlow Ratcliffe, pictured with the electric 2016 BMW i3 that was raffled. Andria Lavine Photography

Southern Seasons Magazine

| 103

courtesy cpa

performing

arts

Cirque du Soleil’s “toruk” June 15-19 Infinite Energy Arena

“tHE LITTLE PIRATE MERMAID” June 7-July 17 – Center for Pupppetry Arts

SUMMER

2002 Lakewood Ave., Atl. 404/443-

aaron’s amphitheatre at laKEWOOD CONCERTS

ACT1 THEATER

July 14-Aug. 7 (select dates)

8 PM Wed.-Sat., 2 & 7 PM Sun. June 23-26 Libby’s at the Express, Libby Whittemore performs ’70s hits, 7:30 PM. 887 W. Marietta St., Atl. 404/607-

Brothers

“Seussical the Musical,” features colorful characters of Dr. Seuss. 180 Academy St., Alpharetta.

aLLIANCE THEATRE

June 8 Journey, The Doobie

June 16 Weezer, Panic! At The Disco

June 24 The Cure, Twilight Sad June 29 Slipknot, Marilyn Manson, Of Mice and Men

July 15 Dierks Bentley, Randy Houser, Cam, Tucker Beathard July 24 5 Seconds of Summer Aug. 6 Kiss 104.1 Flashback Festival Aug. 12 Def Leppard, REO Speedwagon, Tesla Aug. 26 Brantley Gilbert, Justin Moore, Colt Ford Oct. 22 Florida Georgia Line, Cole Swindell, The Cadillac Three, Kane Brown 104

5000.

770/663-8989. act1theater.com.

ACT3 PRODUCTIONS

Aug. 12-27 “The Fantasticks,” a funny, romantic musical about a boy and girl on a magical journey of love, and the two fathers who try to keep them apart. 6285-R Roswell Road NE, Sandy Springs Plaza shopping center. 770/241-1905.

act3productions.org.

ACTOR’S EXPRESS

Through June 19 “Significant Other,” romantic comedy about searching for love and moving on.

www.southernSeasons.net

7469. actors-express.com.

Family Series

June 1-July 3 “Pancakes,

ATLANTA BRAVES SUMMER CONCERT SERIES June 25 Flo Rida Aug. 20 Tori Kelly

Postgame concert, free with paid game ticket. braves.com/tickets.

800/745-3000.

ATLANTA LYRIC THEATRE

Pancakes!,” world premiere play salutes artist/author Eric Carle with original songs and design. Hertz Stage, Woodruff Arts Center, 1280 Peachtree St. NE, Atl. 404/733-

June 10-26 “West Side Story,” landmark Broadway musical about two lovers caught between warring street gangs in New York City. Jennie T. Anderson Theatre, Cobb Civic Center, Marietta. 404/377-

ART STATION THEATRE

ATLANTA SYMPHONY HALL

South – GRITS: The Musical,” toetapping tale of four generations. 384 Manor Dr., Historic Stone Mountain Village. artstation.org.

June 5 Cyndi Lauper June 10 Chris Botti and Joshua

4650. alliancetheatre.org.

July 14-31 “Girls Raised in the

770/469-1105.

9948. atlantalyrictheatre.com.

June 3 “The Music Of David

Bowie A Musical Odyssey,” ASO

Bell with ASO

June 17 Gregory Alan Isakov with

photos: Daniel A. Swalec

ASO

Aug. 10 Alice Cooper Aug. 26 Air Supply

Symphony Hall, Memorial Arts Building, Woodruff Arts Center, 1280 Peachtree St. NE, Atl.

800/745-3000. ticketmaster.com.

ATLANTA SYMPHONY ORCHESTRA

June 9, 11, 12 Brahms Piano Concerto No. 2 and Symphony No. 2, 8 PM Thurs. & Sat., 3 PM Sun. Atlanta Symphony Hall, Memorial Arts Bldg., Woodruff Arts Center, 1280 Peachtree St. NE, Atl. ASO Summer Concerts June 16 Great American Music, 8 PM, Verizon Wireless Amphitheatre at Encore Park. vzwamp.com. June 25 The Music of The Eagles: A Tribute to Glenn Frey, 8 PM, Chastain Park Amphitheatre.

404/733-5000. aso.org.

ATLANTA WIND SYMPHONY June 24, 26 Roswell Patriotic

Celebration with RUMC Sanctuary Choir, 7:30 PM Fri. & 4 PM Sun., Roswell United Methodist Church.

atlantawindsymphony.org.

AURORA THEATRE

July 21-Aug. 28 “In the Heights,” universal story of a vibrant Latin community in New York’s Washington Heights, co-produced with Theatrical Outfit. 128 East Pike St., Lawrenceville. auroratheatre.

com. 678/226-6222.

BUCKHEAD THEATRE

June 11 Matt Corby June 18 Lake Street Dive, The Lone Bellow June 24 The Jayhawks 3110 Roswell Road, Atl. 404/843-

2825. thebuckheadtheatre.com.

BreeAnne Clowdus

“tHE WIZARD OF OZ” – June 21-26 at the Fox Theatre

CALLANWOLDE CONCERT BAND

July 4 Pops Concert to Celebrate America, 7 PM, Bandstand on the Square in Decatur. 404/872-5338. calcb.org.

CALLANWOLDE’S JAZZ ON THE LAWN CONCERTS

June 10 Virginia Schenck June 24 Joe Gransden July 8 Joey Sommerville July 22 Diane Durrett Aug. 5 Bob Baldwin, Audrey Shakir Bring a blanket and picnic, and enjoy great music at Callanwolde Amphitheater, 980 Briarcliff Road NE. $25 ($20 adv.); free on-site parking. 404/872-5338.

callanwolde.org.

CAPITOL CITY OPERA COMPANY

Ongoing Dinner and a Diva series:

“CHARLOTTE’S WEB” Through July 31 Serenbe Playhouse, Chattahoochee Hills

Southern Seasons Magazine

| 105

PERFORMING ARTS June 11 Michael Carbonaro June 12 Making a Murderer’s

July 16 Indigo Girls Aug. 13 Loretta Lynn Outdoor concert series at Atlanta Botanical Garden’s Great Lawn (Midtown garden) and Ivester Amphitheater (1911 Sweetbay Dr., Gainesville). General admission seating; bring blankets or lowrise chairs. 1345 Piedmont Ave. NE. concertsinthegarden.org. 404/876-5859.

404/873-3391. puppet.org.

Dean Strang & Jerry Buting: A Conversation on Justice June 13 Happy Together Tour June 15 Zach Seabaugh & Emily Ann Roberts June 19 Frankie Valli and the Four Seasons June 23 Maks & Val Live On TourOur Way, dance tour of Maksim and Valentin Chmerkovskiy June 24 Roberta Flack & Peabo Bryson June 25 Sinbad July 8 GOT7 July 15-17 Atlanta Lyric Theatre: Joseph and the Amazing Technicolor Dreamcoat Aug. 2 Peter Frampton Sept. 10 The Legend of Zelda Symphony of the Goddesses Sept. 24 Il Divo 2800 Cobb Galleria Pkwy., Atl.

CENTERSTAGE NORTH

cobbenergycentre.com. 800/7453000.

“La traviata,” June 21, 23. “Il barbiere di Siviglia,” July 14, 19, 21. “Don Giovanni,” Aug. 16, 18, 25. Restaurant partners: Petite Auberge, Toco Hills ( 404/6346268 ); Sugo, John’s Creek (770/817-8000), Zola, Milton (770/360-5777 ). ccityopera.org. 678/301-8013.

CENTER FOR PUPPETRY ARTS Family Series

Through June 5 “The Swan.” (3+) June 7-July 17 “The Little Pirate Mermaid”

July 19-31 “Sleeping Beauty” Aug. 2-Sept. 11 “Old MacDonald’s Farm.” (2+) New Directions Series Sept. 2-4 National Puppet Slam. (18+) 1404 Spring St. NW at 18th, Atl.

Aug. 5-13 “Farming Beauty,”

CUMMING PLAYHOUSE

June 4 Frances Mooney and Fontanna Sunset 2016, 8 PM.

July 21-Aug. 14 “Leader of the Pack,” Broadway musical celebrates Ellie Greenwich. 8 PM Thurs.-Sat., 3 PM Sun. Aug. 27 Classic Nashville Roadshow: Jason Petty & Katie, 3 & 8 PM. 101 School St. in the Historic Cumming Public School. 770/781-

9178. playhousecumming.com.

Winwood July 1 Joe Walsh, Bad Company July 12 Flight of the Conchords July 14 Boyz II Men July 16 Pat Benatar & Neil Giraldo, Melissa Etheridge Sept. 4 Goo Goo Dolls, Collective Soul 4469 Stella Dr. at Powers Ferry Road, Atl. 404/733-5012.

BARENAKED LADIES – June 28 Verizon Wireless Amphitheatre

chastainseries.com.

CIRQUE du Soleil “TORUK – THE FIRST FLIGHT” June 15-19 Live multimedia

immersive spectacle brings the breathtaking world of James Cameron’s “Avatar” to the stage at Infinite Energy Arena, Duluth. cirquedusoleil.com/toruk.

COBB ENERGY CENTRE

June 10 Heart Of The King - A Tribute to Elvis

106

Postmodern Jukebox Oct. 21 Bill O’Reilly and Dennis Miller: Who Wants to be President? 60 Peachtree Street NE, Atl.

404/881-2100. foxtheatre.org. ticketmaster.com.

GA. ENSEMBLE THEATRE July 14-30 “Almost Heaven:

John Denver’s America,” staged at Chattahoochee Nature Center, Roswell. get.org. 770/641-1260.

GLOVER PARK CONCERTS

home by dark CONCERTS

June 11 Harry Connick Jr. June 19 Kenny Rogers June 26 Steely Dan, Steve

atlantaplaysitforward.org. chukkarfarmpoloclub.com.

Miss D and her Dancing Dolls

July 17 Shawn Mendes July 30 Ray LaMontagne Aug. 9-14 “If/Then” Sept. 9 Brian Wilson Oct. 13 Celtic Thunder Oct. 15 Scott Bradlee’s

5601. mariettaga.gov/concerts.

CHASTAIN PARK AMPHITHEATRE

Bring a picnic and dine at 8 PM at Chukkar Farm & Polo Club, 1140 Liberty Grove Road, Alpharetta. $15, lawn. $40-$145, tables.

18 Brit Floyd 19 “Weird Al” Yankovic 21-26 “The Wizard of Oz” 29 “Bring It! Live” tour with

8 PM at Glover Park, 50 Park Square, Marietta. Free. 770/794-

3330. centerstagenorth.org.

June 17 Capitol City Xpress July 15 Jeff Pike Band Aug. 19 The Pieces of Eight Sept. 16 Divas of Swing Oct. 21 Atlanta Dance Party

June June June June

June 24 Sons of Sailors July 29 Members Only Aug. 26 Infinity Show Band Sept. 30 Soul Purpose

drama explores art, truth, beauty, blessings and curses. The Art Place-Mountainview, 3330 Sandy Plains Road, Marietta. 770/516-

Chukkar Farm T.G.I.F. Concerts

Fantasia

CONCERTS BY THE SPRINGS June 12 Convoy July 10 Electric Avenue Aug. 14 A1A Sept. 11 Band X

Free outdoor concert series from 7-8:30 PM at Heritage Green on the Sandy Springs Society Entertainment Lawn, 6110 Bluestone Road. Reserved tables available. 404/851-9111.

heritagesandysprings.org.

CONCERTS IN THE GARDEN

ABG Midtown June 25 John Prine, Amanda Shires July 29 Neko Case, k.d. lang, Laura Veirs July 30 Phillip Phillips, Matt Nathanson, A Great Big World Aug. 19 Lyle Lovett & His Large Band ABG Gainesville June 18 The Four Tops

www.southernSeasons.net

DELTA CLASSIC CHASTAIN PARK CONCERTS

June 24 Jerry Garcia Symphonic Celebration: Warren Haynes with Atlanta Symphony Orchestra 4469 Stella Dr. at Powers Ferry Road, Atl. 404/733-5012. deltaclassicchastain.com.

ESSENTIAL THEATRE

July 29-Aug. 28 “Dispossessed,”

romantic comic fantasy about a Yiddish theater company in the 1920s; “When Things Are Lost,” humorous drama about friendship, loss, understanding and forgiveness. West End Performing Arts Center, 945 Ralph David Abernathy Blvd., Atl. 866/811-4111.

essentialtheatre.com.

FOX THEATRE

June 2 Toni Braxton June 4 Garrison Keillor’s “A Prairie Home Companion’’

June 17 Anthony Hamilton and

Concert series pairs performing songwriters with instrumentalists. Chukkar Farm & Polo Club: June 3-4 Emily Shackelton, Michael Logen July 1-2 Jenn Bostic, James David Carter Aug. 5-6 Beth Wood, Ernie Halter 8 PM at 1140 Liberty Grove Road, Alpharetta. 678/665-0040. Infinite Energy Theater: Aug. 13 Georgia Middleman, Jesse Terry, 8 PM. 770/626-2464.

homebydark.com.

HORIZON THEATRE

Through June 26 “The City of Conversation,” political drama about an influential Washington, D.C. hostess chronicles the end of Carter’s presidency through Obama’s inauguration. July 15-Aug. 28 “’da Kink in My Hair,” inspiring musical set in a hair salon gives a powerful voice to women’s stories through drumming, singing and dance. 8 PM Wed.-Fri., 3 & 8:30 PM Sat., 5 PM Sun. 1083 Austin Ave., Little Five Points, Atl. 404/584-7450. horizontheatre.com.

“IF/THEN”

Aug. 9-14 Broadway musical set in New York follows one woman’s two possible life paths, painting a moving portrait of the lives we lead and the lives we might have led. Staged at the Fox Theatre, 660 Peachtree St. NE, Atl. 7:30 PM Tues.-Thurs., 8 PM

Joan Marcus

Fri., 2 & 8 PM Sat., 1 & 6:30 PM Sun. broadwayinatlanta.com.

foxtheatre.org.

Infinite Energy Center Arena

June 2 Jimmy Buffett & The Coral Reefer Band June 4 Dolly Parton June 15-19 Cirque du Soleil’s “Toruk – The First Flight” Aug. 6 Twenty One Pilots Theater June 5 Dance Showcase 2016 June 25 Nashville Hitmakers Aug. 13 Home By Dark: Georgia Middleman & Jesse Terry 6400 Sugarloaf Pkwy., Duluth. infiniteenergycenter.com.

LIVE! IN ROSWELL SERIES

“If/Then” – Aug. 9-14 at the Fox Theatre

June 11 Edwin McCain, 8 PM at Roswell Cultural Arts Center, 950 Forrest St. 770/594-6232. roswellpresents.com.

MABLE HOUSE BARNES AMPHITHEATRE

Sept. 10 Atlanta Smooth Music

Festival: Warren Hill, Chieli Minucci with Special EFX, Steve Oliver, Generation Next, Greg Chambers and Jazmin Ghent. 5239 Floyd Road, Mableton. 770/819-7765.

mablehouse.org.

MALL OF GEORGIA MONTHLY MUSIC JAM

June 3 The Woody’s Unplugged July 1 Brent Gafford Aug. 5 The Woody’s Unplugged Sept. 2 Fire & The Knife Duo Oct. 7 The Woody’s Unplugged Bring blankets and chairs for free outdoor concert from 6:30-8:30 PM at Hennessy Cadillac Village Stage, Mall of Georgia, Buford.

PHILIPS ARENA

June 9 Selena Gomez June 11 R. Kelly June 18 Hot 107.9 Bday Bash ATL June 29 Demi Lovato, Nick Jonas Aug. 7 Janet Jackson Oct. 26 Maná Oct. 28-29 Adele 1 Philips Dr., next to CNN Center.

404/878-3000. philipsarena.com.

PINCH ‘N’ OUCH THEATRE June 16-July 16 “The Way We

Get By,” edgy romantic comedy about modern relationships. Staged at 8 PM Thurs.-Sat. (no shows June 30-July 2). 195 Arizona Ave., Suite L/W1, Atl. 678/231-

Project Free concerts: 7-9 PM at Riverside Park, 575 Riverside Road. Food trucks on-site. 770/641-3705.

roswellriversidesounds.com.

SERENBE PLAYHOUSE

Through July 31 “Charlotte’s Web,” beloved tale about a charismatic young pig and literate spider comes to life on a vibrant farm with live animals. June 9-July 26 “Of Mice & Men.” Two men overcome impossible odds to reach their destinies in this adaptation of John Steinbeck’s novel, set on a working farm, with live horses wandering the barn. July 21-Aug. 7 “Miss Saigon.” An American GI falls in love with a Vietnamese barmaid in a tale of heartbreak and heroism, dramatically staged outdoors, complete with a Huey helicopter. Selborne Lane, Chattahoochee Hills. serenbeplayhouse.com.

770/463-1110.

7 STAGES

June 3-5 “The Dingalogues,” dramedy showcases spectrum of masculinity in the gay community. 1105 Euclid Ave., Atl. 404/5237647. 7stages.org.

SIX STRING SOCIAL CLUB CONCERT SERIES June 25 Acoustic Eidolon Sept. 10 Frank Vignola, Vinny

Raniolo Woodstock Community Church, 237 Rope Mill Road. 770/365-

1263. pnotheatre.org.

7738. sixstringsocialclub.com.

ROSWELL RIVERSIDE SOUNDS CONCERTS

STAGE DOOR PLAYERS

June 4 The Bonaventure Quartet, Amy Pike July 2 Grace & the Victory Riders Aug. 6 The Get Right Band Sept. 3 Stephane Wrembel Oct. 1 Ed Roland & the Sweet Tea

Through June 12 “The 39 Steps,” fast-paced whodunit with nonstop laughs and 150 zany characters. North DeKalb Cultural Center, 5339 Chamblee Dunwoody Road, Dunwoody. stagedoorplayers.net.

770/396-1726.

STRAND THEATRE

TRUE COLORS THEATRE CO.

Modern Millie, Jr.,” charming musical comedy. July 1-3, 7-10 “Jukebox Giants: Motown & More,” high energy song and dance show. Staged at the Earl Smith Strand Theatre, 117 North Park Square, Marietta. earlsmithstrand.org.

on the eve of Obama’s first election, four Harvard intellectuals find themselves entangled in a complex web of social and sexual politics in this provocative and funny play. Staged at 8 PM Wed.-Sat., with 2:30 PM matinees on Sat. & Sun. Southwest Arts Center, 915 New Hope Road, Atl.

June 17-18, 24-26 “Thoroughly

July 12-Aug. 7 “Smart People,”

770/293-0080.

877/725-8849. 404/532-1901. truecolorstheatre.org.

SUNDAYS ON THE RIVER CONCERT SERIES

VERIZON WIRELESS AMPHITHEATRE

June 12, July 10, Aug. 14, Sept. 11, Oct. 9 Outdoor concerts at

June 6 Ellie Goulding, Matt and Kim June 11 Keith Urban, Brett

Chattahoochee Nature Center’s Ben Brady Lakeside Pavilion. Doors open at 6:30 PM, concerts at 7:30 PM. $17.50, lawn. $22.50, table seating. 9135 Willeo Road, Roswell. chattnaturecenter.org.

THEATRICAL OUTfit

Eldredge, Maren Morris June 16 Atl. Symphony Orchestra June 18 CROCK Fest: Lynyrd Skynyrd, Montgomery Gentry June 22 Taste of Chaos: Dashboard Confessional, Taking Back Sunday, Saosin with Anthony Green, The Early November June 28 Barenaked Ladies, OMD, Howard Jones July 16 I Love the 90’s: Salt N Pepa, Biz Markie, Kid ‘N Play, All-4-One, Coolio, Tone Loc, Rob Base, Young MC July 23 Tedeschi Trucks Band, Los Lobos, North Mississippi Allstars July 29 Gwen Stefani, Eve Aug. 6 Boston, Dennis DeYoung Aug. 13 Train, Andy Grammer Aug. 14 Dixie Chicks Aug. 20 Needtobreathe, Mat Kearney, John Mark McMillan, Welshly Arms Aug. 27 STS9 Sept. 11 Darius Rucker, Michael Ray, Dan+Shay 2200 Encore Pkwy., Alpharetta.

theatricaloutfit.org.

ALL TIMES AND DATES SUBJECT TO CHANGE. PLEASE CONTACT INDIVIDUAL VENUE FOR CONFIRMATION.

SYNCHRONICITY THEATRE

June 17-19 “The Last Time We Were Here,” intimate new folk rock musical about relationships, staged at 8 PM Fri. & Sat., 5 PM Sun. Peachtree Pointe, 1545 Peachtree St., Atl. synchrotheatre.com. 404/484-8636.

“THE WIZARD OF OZ”

June 21-26 Join Scarecrow, Tin Man, Lion, Dorothy and her little dog Toto, as they journey through the magical land of Oz, with a few surprises along the way, in this musical treat for the family. Staged at the Fox Theatre, 660 Peachtree St. NE, Atl. 7:30 PM Tues.-Thurs., 8 PM Fri., 2 & 8 PM Sat., 1 & 6:30 PM Sun. broadwayinatlanta.com. foxtheatre.org.

July 29-30 “The Wizard of Oz, Jr.,” Youth Theatre at the Outfit at 7:30 PM Fri. and 2:30 & 7:30 PM Sat. Balzer Theater at Herren’s, 84 Luckie St. NW, Atl. 678/528-1500.

vzwamp.com.

Southern Seasons Magazine

| 107

FESTIVALS & foodie fun

AJC DECATUR BOOK FEST

Sept. 2-4 Largest independent book festival in country features book signings, author readings, panel discussions, interactive children’s area, live music, parades, cooking demonstrations, poetry slams, writing workshops, and more on Decatur’s downtown square. decaturbookfestival.com.

ALIVE IN ROSWELL

June 16, July 21, Aug. 18 Familyfriendly festival with live music, food trucks, art vendors, local merchant booths and free kids activities, from 5-9 PM (every third Thurs. through Oct.) on the Historic Town Square downtown. Free trolley service between the Square and Canton Street. atlantaplaysitforward.org/ aliveinroswell/.

ALPHARETTA ART IN PARK

in downtown Athens showcases local, regional and national musical talent on three outdoor stages, plus artist market, two-night Club Crawl in 10+ venues, and KidsFest celebration. Proceeds benefit AthFest Educates. 706/548-1973.

athfest.com.

ATL. BAR-B-Q Festival

Aug. 12-13 Atlanta’s top BBQ

restaurants will serve up their specialties, while teams compete in a cook-off at Perimeter Mall, with live music and an interactive children’s area. 4-10 PM Fri., noon8 PM Sat. atlbbqfest.com.

ATL. FOOD & WINE FEST

June 2-5 6th annual epicurean

extravaganza in Midtown Atlanta with 250 chefs, sommeliers and mixologists celebrates Southern food and beverage traditions with learning experiences, tasting tents, dinners, masterclasses and more. 10th St. NE and Peachtree Walk. 877/725-8849.

atlfoodandwinefestival.com.

June 25, July 30, Aug. 27, Sept. 24 Outdoor artists market features

ATL. ICE CREAM FESTIVAL

handcrafted work by local artists, from pottery and woodwork to jewelry and paintings. 9 AM-4 PM at Main Street & Milton Avenue.

ice cream shops, health & wellness vendors, food and family fun at Piedmont Park, 10th St. & Charles Allen Dr. entrance. 11 AM-6 PM.

awesomealpharetta.com.

July 23 Annual fest features local

atlantaicecreamfestival.com.

ALPHARETTA BREW MOON COUNTRYFEST

ATL. SUMMER BEER FEST

beer, wine and food from some of Alpharetta’s best restaurants. 6:30-11 PM, Milton Ave. $10 (table of 6, $100; table of 8, $130).

200+ beers, plus live musical entertainment, from 4-9 PM at Historic 4th Ward Park 665 North Ave. NE, Atl. Ages 21+ only. $55 ($45 adv.). Food available for purchase. atlantasummerbeerfest.

June 4 Celebrate summer with

awesomealpharetta.com.

APPALACHIAN WINE, JAZZ & ART FESTIVAL June 10-11 Enjoy art, jazz, fine

wine and food at the Georgia Mountain Fairgrounds, Hiawassee. 5-8 PM Fri., 11 AM-8 PM Sat. $35.

mountainwinefest.com.

ATHFEST 2016

June 22-26 Music and arts festival

108

June 18 Enjoy a selection of

com. atlantabeerfestivals.com.

ATTACK OF THE KILLER TOMATO FESTIVAL

July 17 Sample innovative tomato

dishes and cocktails and enjoy live music from 1-5 PM at JCT. Kitchen & Bar, 1198 Howell Mill Road, Atl. Benefits The Giving Kitchen and Georgia Organics.

killertomatofest.com.

www.southernSeasons.net

“Creatures of Light: Nature’s Bioluminescence” Through Aug. 14 Fernbank Museum In this re-creation of part of New Zealand’s Waitomo cave system, visitors glimpse a fantastic spectacle above their heads: sticky “fishing lines” dropped from the ceiling by glowworms – bioluminescent gnat larvae – to trap prey.

BACK TO THE CHATTAHOOCHEE RIVER RACE & FESTIVAL June 11 Upper Chattahoochee

Riverkeeper’s 14th annual race for recreational and competitive paddlers, plus a free festival with live music, exhibits, vendors and kids’ activities at Roswell’s Riverside Park from 10 AM-3 PM. Race (8-mile course) begins at 9 AM at Garrard Landing Park, with online and on-site registration available. chattahoochee.org.

BROOKHAVEN BEER FEST

June 11 Sample domestic, craft and imported beers, plus wine tasting tents and live music, from 3-8 PM at Apple Valley Road behind Brookhaven Marta station, 1224 Fernwood Cir. NE. Food available for purchase. Ages 21+ only. brookhavenbeerfest.com.

DECATUR BBQ, BLUES & BLUEGRASS FESTIVAL

Aug. 13 16th annual event features live music, classic southern BBQ and cold beer. 630 East Lake Dr. and Harmony Park in Oakhurst, Decatur. Noon-8 PM. Ticketed event. decaturbbqfestival.com.

DECATUR BEACH PARTY

June 17 Decatur Square will be

fun around town

transformed into a beach, with 60 tons of sand, children’s boardwalk games, wading pools in the sand, live music, dancing and food court. 5-11 PM. 101 E. Court Square.

678/553-6573. decaturdba.com.

FLYING COLORS BUTTERFLY FESTIVAL

June 4-5 Chattahoochee Nature

Center’s annual event features butterfly releases, arts & crafts, food, music, costume parade, plant sale and Butterfly Encounter exhibit with 200 free-flying butterflies. 10 AM-3 PM Sat., noon-5 PM Sun. $12 (free, 2 & under). 9135 Willeo Road, Roswell. 770/992-2055.

chattnaturecenter.org.

GEORGIA MOUNTAIN FAIR

July 15-23 Music performances, carnival rides, arts & crafts, Pioneer Village and “Old Ways” demonstrations at the Georgia Mountain Fairgrounds, 1311 Music Hall Road, Hiawassee.

georgiamountainfairgrounds. com. 706/896-4191.

GA. RENAISSANCE FESTIVAL

June 4-5 Step into a 16th century European country faire with games & rides, food & drink, artists market, music & comedy shows, jousting knights & strolling

On the Scene

Eric Carle art at High Museum

Enjoy a colorful retrospective of the beloved children’s book artist and author at the High Museum of Art. “I See a Story: The Art of Eric Carle” features over 80 collage works from 15 of his most popular books, on view through Jan. 8, 2017. above and left: IllustrationS from “The Very Lonely Firefly” © 1995 by Eric Carle. Book Art. “I See a Story: The Art of Eric Carle” is organized by The Eric Carle Museum of Picture Book Art, Amherst, Massachusetts. BELOW: dale chihuly’s “sapphire star” at atlanta botanical garden’s new exhibit, “Chihuly in the garden.”

Chihuly exhibition at Atl. Botanical Garden The spectacular glass works of acclaimed Seattle artist Dale Chihuly have been unveiled at the Atlanta Botanical Garden, where visitors can marvel at 20 magnificent sculptural installations blooming in kaleidoscopic color amidst the natural beauty of the grounds. The eye-popping pieces in the surreal juxtapositions include the chartreuse Hornet Chandelier suspended from the Canopy Walk and the 30-foot-tall neon Saffron Tower rising from the Water Mirror pool. On view through Oct. 30, “Chihuly in the Garden” marks the 40th anniversary of ABG, which drew record crowds for Chihuly’s first blockbuster show back in 2004. For an enchanting evening experience, “Chihuly Nights” is offered Wed.-Sun. atlantabg.org.

Southern Seasons Magazine

| 109

FUN AROUND TOWN Music Festival (3-9 PM Sat.). 9 AM-5 PM Sat., 11 AM-5 PM Sun. 50 N. Park Square. 770/592-7180.

mariettastreetfest.com.

Flying Colors Butterfly Festival June 4-5 Butterfly Encounter June 6-July 31 Chattahoochee Nature Center

MISS MARY’S ICE CREAM CRANKIN’

Aug. 21 Sample 100+ flavors of

homemade ice cream and enjoy live music and children’s activities at this old-fashioned social on Roswell Square to benefit The Drake House. 2-4 PM. $6 ($20 per family). 610 Atlanta St. 770/587-

4712 x 307. thedrakehouse.org. missmarysicecream.org.

OLD FOURTH WARD PARK ARTS FESTIVAL June 25-26 Community event

with fine arts & crafts, street market, kids’ play area, live acoustic entertainment, food and beverages. 592 N. Angier Ave. NE, between North Ave. and Ralph McGill Blvd., Atl. 10 AM-6 PM Sat., 11 AM-6 PM Sun.

oldfourthwardparkartsfestival. com. 404/845-0793.

OLD SOLDIER’S DAY PARADE Aug. 6 Alpharetta’s parade pays thespians. 10:30 AM-6 PM. I-85 to exit 61-Peachtree City/Fairburn.

6400 Sugarloaf Pkwy., Duluth. 10 AM-6 PM. $10 (6 & under, free).

770/964-8575. garenfest.com.

404/842-0736. japanfest.org.

GERMAN BIERFEST

MARIETTA ART IN THE PARK FESTIVAL

Aug. 20 Celebrate the greatness

of German beer in a family-friendly environment at this annual fest at Woodruff Park in downtown Atlanta, with authentic German food and beer, kids activities, music and fun. 2-7 PM. 678/244-

Sept. 3-5 Art festival at Glover Park in the Marietta Square with a juried artist market of original works by 175 artists, Children’s Art Alley, Chalk Spot street art ($10/$15 participation fee), live music and more. Free admission. 10 AM-5 PM. 50 N. Park Square.

GRANT PARK SUMMER SHADE FESTIVAL

artparkmarietta.com.

1528. germanbierfest.com.

Aug. 27-28 Annual fest at Historic

Grant Park with juried and nonjuried Artist Markets, live music, Kids Zone, food and more. Adams Realtors 5K Run for the Park: 8 AM Sat. (7 AM registration), walkers welcome. Farmers Market: 9:30 AM-1:30 PM Sun. Festival hours: 10 AM-10 PM Sat., 11 AM-7:30 PM Sun. Free admission. 800 Cherokee Ave., Atl. Benefits Grant Park Conservancy. 404/521-0938.

MARIETTA JUNETEENTH CELEBRATION June 17-19 The Cobb County

branch of the NAACP hosts this annual event on the historic Marietta Square to commemorate the date the last U.S. slaves were freed. Evening Under the Stars, 6-11 PM Fri. Juneteenth Cultural Festival, 10 AM-7 PM Sat. Gospel Festival, 3-7 PM Sun. Free. 50 Park Square, Marietta. 770/425-5757.

summershadefestival.org.

cobbnaacp.org. mariettaga.gov.

Great Southern Food Truck Rally

Marietta SQUARE ARTISTS MARKET

Aug. 27 Details TBA. Kennesaw State University Sports and Entertainment Park.

JAPANFEST

Sept. 17-18 Largest Japanese cultural festival in the Southeast features music and dance performances, taiko drummers, martial arts demonstrations, workshops, a marketplace of goods, exhibits, kids activities and food at Infinite Energy Center, 110

June 11 & 25, July 9 & 23, Aug. 13 & 27 Open-air showcase

of juried fine arts with booths on Mill Street, by Glover Park, Marietta. 9 AM-2 PM, 2nd & 4th Sat. artistsmarketmarietta.com.

MARIETTA STREETFEST

Sept. 17-18 25th annual event

on the historic Marietta Square features arts & crafts, Kids Zone, Classic Car Cruise-In (10 AM-3 PM Sat.) and Marietta Grassroots

www.southernSeasons.net

tribute to all war veterans, with floats, marching bands, military units, classic cars, clowns and candy. 9:15 AM-noon, Grand Stand at corner of Old Milton and Roswell Street. Post celebration at the American Legion, Post 201 with free hotdogs, soft drinks and children’s activities. 678/297-6000.

alpharetta.ga.us.

PIEDMONT PARK SUMMER ARTS & CRAFTS FESTIVAL Aug. 13-14 Enjoy visual arts

and family fun in Piedmont Park with 250 participating artists, acoustic music, street market, children’s play area, festival foods and beverages. 10 AM-6 PM Sat., 11 AM-6 PM Sun. 1215 Piedmont Park Ave. NE, Atl.

piedmontparkartsfestival.com.

PIONEER DAYS

Sept. 2-5 Family-friendly festival with arts & crafts, rides, games, dancers, musicians and fireworks at dusk on Mon. at Sam Smith Park in Cartersville. 4-11 PM Fri., noon-11 PM Sat. & Sun., noon10 PM Mon. $5 (under 12, free); $20 daily wristband for unlimited carnival rides. 770/974-9033. pioneerdaysga.com.

Southern Cigar Fest

June 3-5 Enjoy premium cigars, spirits, music and more at Cutters Cigar Emporium, 5530 Windward Pkwy., Alpharetta. 18+ only. southerncigarfestival.com.

SOUTHERN GROWN FEST

June 10-12 Sea Island hosts a weekend of food and fun with top chefs and live music (including

Tedeschi Trucks Band, Jason Isbell and Dumpstaphunk). 800-SEA-

ISLAND. southerngrown.com.

VIRGINIA-HIGHLAND SUMMERFEST

June 4-5 Shop for original art and enjoy live music and great food in the Virginia-Highland neighborhood with a juried artist market, music stage, 5K race & Tot Trot (Sat.), KidsFest (10 AM-3 PM daily, John Howell Park), and an Acoustic Street Party on Fri. & Sat. nights. Virginia Avenue, between N. Highland Avenue & Park Drive, Atl. 10 AM-11 PM Sat. (artist market through 6:30 PM), 10 AM-6 PM Sun. Free (donations to Virginia-Highland Civic Assoc.). vahisummerfest.com.

WING & ROCK FESTIVAL

June 4-5 Family-friendly festival at Etowah River Park in Canton features chicken wing restaurants, live music, inflatable amusement rides for kids, and arts & crafts. 12-9 PM Sat., 12-6 PM Sun. 600 Brown Industrial Pkwy. Free; food/ drink tickets available for purchase. wingandrockfest.com.

WYLDE CENTER’S BEER GARDEN

June 25 Annual fundraiser features local craft beer, food, live music and silent auction at Oakhurst Garden, 435 Oakview Road, Decatur. 5:30-8:30 PM (VIP: 4:30 PM). Ages 21+ only. Ticketed event. wyldecenter.org/beergarden/.

SPECIAL EVENTS ANIMAL RESCUE FAIR

June 12 Largest pet adoption

and educational family fun day in Georgia, noon to 5 PM, at Wills Park Equestrian Center, 11915 Wills Road, Alpharetta. Free; requested donation of a bag of Purina dog, cat or horse food. 770/886-5419.

animalrescuefair.org.

COCA-COLA SUMMER FILM FESTIVAL

Summer Film favorites presented on a 26’ x 56’ big screen at the Fox Theatre in Atlanta. Schedule TBA. foxtheatre.org. 855/285-8499.

DAHLONEGA EVENTS

June (weekends) Georgia Wine Country Festival at Three Sisters Vineyards & Winery. Sip local wines and enjoy musical entertainment on weekends, from 11 AM-5 PM Sat., 12-5 PM Sun. Food available for purchase. 706/865-9463. threesistersvineyards.com. June 17-18 Mountain Top Rodeo,

world-class competitive action, 8 PM. Midway of vendors & exhibitors opens at 6 PM.

In the Garden The Penny McHenry Hydrangea Festival will take place June 4-5 in Douglas County.

FARM FRESH ALPHARETTA FARMERS MARKET

Saturdays 8:30 AM-1 PM. 21 Milton Ave. at the corner with Old Canton St., downtown. 404/402-5389. alpharettafarmersmarket.com.

DECATUR FARMERS MARKET

Saturdays 9 AM-1 PM. 308 Clairemont Ave., at the corner with Commerce Dr., on the front lawn of First Baptist Church of Decatur. cfmatl.org/decatur/.

EAST ATLANTA VILLAGE FARMERS MARKET

Thursdays 4-8 PM. 561 Flat Shoals Ave. SE, Atl. Street parking on Stokeswood Ave. cfmatl.org/eav/.

FLOWER POWER BASCOM IN BLOOM

July 15-16 Garden festival in the mountain resort community of Highlands, N.C., features multiple events, including a flower show and horticulture exhibits. Proceeds support The Bascom, a nonprofit visual arts center. 828/526-4949.

mountainsinbloom.com.

HYDRANGEA GARDEN TOUR

June 11 American Hydrangea Society’s 22nd annual tour features beautiful hydrangea-filled gardens, both large and small, throughout metro Atlanta. 9 AM-5 PM. $30 tour and annual membership. americanhydrangeasociety.org.

PENNY MCHENRY HYDRANGEA FESTIVAL June 4-5 Themed “America, the Beautiful!”, this

9th annual festival, held at multiple locations in Douglas County, features a standard flower show, miniature gardens, Master Gardeners’ vegetable garden scarecrows, Courthouse Gallery art exhibit, new quilt exhibit and the official opening of the Rosalyn Carter Butterfly Trail. Produced by the Douglas County Tourism and History Commission.

pennymchenryhydrangeafestival.com. 678/4493939. info@visitdouglascountyga.com.

ROSWELL LAVENDER FESTIVAL

June 11 Discover the many varieties, uses and folk remedies associated with this ancient plant at this free family event at historic Barrington Hall in Roswell, with art, antiques and craft vendors, beer and wine garden, demonstration booths, handson crafts, children’s area, musical performances and specialty items. 10 AM-5 PM. Limited parking on site. 535 Barrington Dr. 770/640-3855.

southerntrilogy.com.

GRANT PARK FARMERS MARKET

Sundays 9:30 AM-1:30 PM. 600 Cherokee Ave. SE, at the corner with Milledge Ave., Atl. cfmatl.org/ grantpark/

HERITAGE SANDY SPRINGS FARMERS MARKET

Saturdays 8:30 AM-noon. Century Springs East Parking Lot, 6100 Lake Forrest Dr., at the corner with Mt. Vernon Hwy.

sandyspringsfarmersmarket.com.

MARIETTA SQUARE FARMER’S MARKET

Weekends 10 AM-1 PM Sat., noon-

3 PM Sun. North Park Square, 65 Church St., Marietta. 770/499-9393.

mariettasquarefarmersmarket.net.

piedmont park GREEN MARKET

Saturdays 9 AM-1 PM. 12th St. Gate area off Piedmont Drive inside the park, Atl. piedmontpark.org.

PONCE CITY FARMERS MARKET

Tuesdays 4-8 PM. BeltLine Shed, Eastside Trail, Atl. cfmatl.org/ pcfmbeltline/.

WESTSIDE FARMERS MARKET

Sundays 10 AM-2 PM. 1100 Howell

Mill Road NW, at the corner with 14th St. NW, Atl. cfmatl.org/westside/.

Southern Seasons Magazine

| 111

Jessica Fontana (Digital Media)

FUN AROUND TOWN Rescued sea lions at Georgia Aquarium’s SunTrust Pier 225

aTLANTA HISTORY CENTER

June 18-19 Juneteenth, family program commemorates the end of slavery in the U.S., with activities, performances and crafts. June 21 Garden Lecture Exhibitions Through Oct. 10 “Fashion in Good Taste” at Swan House. Through Dec. 31 “Atlanta in 50 Objects” and “Native Lands: Indians and Georgia.” Opening July 2 “Gatheround: Stories of Atlanta,” cornerstone exhibit interprets the history of Atlanta, with artifacts, ephemera and interactive media. 130 West Paces Ferry Road, Atl. atlantahistorycenter.com. 404/814-4000.

BARRINGTON HALL

June 11 Roswell Lavender

Festival, with vendors, food, music and more. 10 AM-5 PM. Free. July 4 BBQ & Bluegrass. 535 Barrington Dr., Roswell.

770/640-3855. roswellgov.com.

BULLOCH HALL

$14 ($6 children); $5 parking.

mountaintoprodeo.com. dahlonega.org.

AM-2 PM. Registration: 9 AM at Park Tavern, 500 10th St NE, Atl. $25 adv. greatcityrace.com.

GEORGIA BRIDAL SHOW

Infinite Energy Center

extravaganza at Infinite Energy Forum, 6400 Sugarloaf Pkwy., Duluth (06/26 show), and Cobb Galleria Centre, Two Galleria Pkwy., Atl. (07/31 show). Noon-5 PM. $15 ($10 online). eliteevents.com.

June 15-19 Cirque du Soleil’s “Toruk – The First Flight,” inspired by James Cameron’s “Avatar.” Aug. 27 Endurocross, indoor offroad motorcycle racing. Forum June 11-12 CFA Southern Regional Awards Show June 26 Georgia Bridal Show Aug. 13-14 Intergalactic Bead Show Aug. 27 51st Atlanta Model Train and Railroadiana Show 6400 Sugarloaf Pkwy., Duluth.

June 26, July 31 Bridal

GEORGIA STATE PARKS

June 3 New Moon Kayak Tour,

8:30 PM, Hard Labor Creek State Park, Rutledge. RSVP only. $15 plus $5 parking. 706/557-3001. June 4 Celebrate National Trails Day with ranger-led hikes, including Tails on Trails dog hike at 10 AM at Sweetwater Creek State Park in Lithia Springs; $7 plus $5 parking, RSVP only, 770/732-5871. June 4 152nd Battle of Pickett’s Mill, 10 AM-4 PM at Pickett’s Mill Battlefield Historic Site in Dallas. $3-$5.50. 770/443-7850. June 18 Scavenger Hunt Challenge, 10 AM-3 PM at Etowah Indian Mounds Historic Site, Cartersville. $2-$6. 706/387-3747.

Arena

infiniteenergycenter.com.

LAKEWOOD 400 ANTIQUE MARKET

June 17-19, July 15-17, Aug. 19-21 North Atlanta’s premier market for antiques, collectibles, vintage furniture, re-claimed architectural, home & garden decor and more. 1321 Atlanta Hwy., Cumming. 9 AM-5 PM Fri. 9 AM-6 PM Sat., 10 AM-5 PM Sun. $3. 770/889-3400.

lakewoodantiques.com.

GA. TRUST EXPEDITION

MOVIES UNDER THE STARS

and architecture of Barnesville on “Buggy Through Barnesville,” with self-guided home tours, lunch and reception. $25-$60. 404/885-

7812. georgiatrust.org.

GREAT CITY RACE

June 18 Urban scavenger hunt race with clue solving on foot. 10 112

Summer Schedule TBA.

1731. bullochhall.org.

northatlantatradecenter.com. 770/279-9899.

cALLANWOLDE FINE ARTS CENTER EVENTS

SCOTT ANTIQUE MARKETS SHOWS

Open Mic Poetry Night, $5.

1700 Jeurgens Ct., Norcross.

gastateparks.org. 800/864-7275. June 11 Explore the rich history

NORTH ATLANTA TRADE CENTER

Summer Free family fun on Saturday nights in June and July (except July 2) at Mall of Georgia in Buford, with 9 PM movie screenings on the Village Amphitheater lawn, live music from 6:30-8:30 PM, and kids’ bounce houses. Concessions available. Bring blankets and lawn chairs. mallofgeorgia.com.

www.southernSeasons.net

Ongoing Guided tours of this historic site are offered 10 AM-3 PM Mon.-Fri., 1-3 PM Sun. 180 Bulloch Ave., Roswell. 770/992-

June 9-12, July 7-10, Aug. 11-14

World’s largest series of indoor antique shows with 3,500 exhibit booths at Atlanta Expo Center, 3650 Jonesboro Road SE, I-285 Exit 55. 10:45 AM-6 PM Thurs., 9 AM-6 PM Fri.-Sat., 10 AM-4 PM Sun. $5, free parking. 404/361-

2000. scottantiquemarket.com.

ATTRACTIONS ARCHIBALD SMITH PLANTATION HOME

Ongoing Tour this historic house built in 1845. 935 Alpharetta St., Roswell. 678/639-7500.

archibaldsmithplantation.org.

ATLANTA BOTANICAL GARDEN

Through Oct. 30 “Chihuly in the Garden,” encore exhibit of Dale Chihuly’s spectacular works, with “Chihuly Nights” evening hours. June Reopening of renovated Children’s Garden. 1345 Piedmont Ave. NE, Atl. atlantabg.org. 404/876-5859. Gainesville location: Summer “Woven Whimsy: Stickworks by Patrick Dougherty.” 1911 Sweetbay Dr., Gainesville.

atlantabg.org/visit/gainesville. 404/888-4760.

June 9, July 21, Aug. 11

June 10, 24, July 8, 22, Aug. 5

Jazz on the Lawn concerts June 16 “A Book Affair,” reception for local authors, $5. 980 Briarcliff Road NE, Atl.

404/872-5338. callanwolde.org.

cALLAWAY GARDENS

June 4-July 22 Florida State University “Flying High” Circus at Robin Lake Beach Dome, with performances at 3:30 PM Mon., Thurs., Sat. & Sun.; and 8 PM Fri. & Sat. (plus 6 PM July 4). Free with admission. circus.fsu.edu. June 16 Fitness Series: Sprint Triathlon & 5K. active.com. July 1-4 Star Spangled Beach Party with music and fireworks. Sept. 2-4 Hot Air Balloon Fest with balloon glow at Robin Lake Beach, balloon flights, live music, classic car show, Kids Zone, beach activities and more. Sept. 4 Fitness Series: Olympic Triathlon & 5K Run. active.com. Pine Mountain. 1-800-CALLAWAY. callawaygardens.com.

CENTENNIAL OLYMPIC PARK EVENTS

Summer Music at Noon, noon-1 PM Tues. & Thurs., through Oct. July 4 Fourth of July Celebration Aug. 6 Praise in the Park centennialpark.com. 404/2227275.

Stone Mountain Park’s Fantastic Fourth Celebration July 1-4

ALPHARETTA’s FIREWORKS AND FESTIVITIES

July 4 Celebrate from 6-9 PM with children’s activities, entertainment, food vendors and fireworks. Alpharetta Community Center Event Lawn, 175 Roswell St.

BBQ AND BLUEGRASS AT BARRINGTON

July 4 Old-fashioned family fun

from 11 AM-5 PM with music, children’s games and food & drink concessions in the backyard of Barrington Hall in Roswell.

770/640-3855.

CALLAWAY GARDEN’s STAR SPANGLED BEACH PARTY

July 1-4 Live music and fireworks

extravaganza at Robin Lake Beach. Pine Mountain. 1-800-CALLAWAY.

callawaygardens.com.

CENTENNIAL OLYMPIC PARK’s CELEBRATION

July 4 Fabulous fireworks light

CHATTAHOOCHEE NATURE CENTER

Ongoing Trail Hikes, River Canoes, Animal Encounters, Creature Features and more. June 4-5 Flying Colors Butterfly Festival. June 6-July 31 Butterfly Encounter, live butterfly exhibit. June 18 Possum Trot 10K & 1-Mile Fun Run. June 23, July 14, Aug. 25 Sunset Sips, 6:30-9:30 PM. 9135 Willeo Rd., Roswell. 770/9922055. chattnaturecenter.org.

CHILDREN’S MUSEUM OF ATLANTA

Ongoing Spark imagination and

inspire discovery and learning through the power of play. June 11-Sept. 4 “XOXO” exhibit encourages children to explore their feelings. 275 Centennial Olympic Park

Fourth of July

down Cherokee St. to N. Marietta Pkwy.), followed by festival fun through 9 PM, with concerts, museum tours, arts & crafts, food, carnival games and fireworks finale at dark. mariettaga.gov.

Celebrations up dowtown Atlanta at this annual Fourth celebration filled with festive fun. Details TBA. 404/222-7275.

centennialpark.com.

DAHLONEGA’s 4TH OF JULY FAMILY DAY CELEBRATION July 4 Enjoy music, parade, 5k &

10k races, ceremony and fireworks in the downtown Square and UNG Drill Field. dahlonega.org.

LENOX SQUARE’s LEGENDARY 4TH OF JULY

July 4 Family celebration starts

at 6 PM with children’s games, musical entertainment, food concessions and the largest fireworks display in the Southeast at 9:40 PM at Lenox Square, 3393

Dr. NW, Atl. 404/659-KIDS.

childrensmuseumatlanta.org.

FERNBANK MUSEUM OF NATURAL HISTORY Exhibitions

Through July 31 “Wild Music,” explore sound and music in nature and in life through whimsical, hands-on activities. Through Aug. 14 “Creatures of Light: Nature’s Bioluminescence,” discover the extraordinary organisms that produce light, from flickering fireflies to deepsea fishes and other creatures. IMAX® screenings

Through June 16 “National Parks Adventure,” majestic beauty of America’s legendary landscapes. Through Sept. 15 “A Beautiful Planet,” captured by astronauts aboard the ISS. Ongoing Martinis & IMAX® with

PIED PIPER PARADE, CONCERT & FIREWORKS

Peachtree Road NE, Atl. No pets.

404/233-6767. simon.com.

July 4 Dress up in red, white and blue to walk, ride or skate in this parade through downtown Decatur at 6 PM, followed by a concert at 7 PM and a fireworks spectacular at 9 PM. 101 E. Court Square. Free. decaturdba.com.

MALL OF GEORGIA’S STAR SPANGLED FOURTH

July 4 Patriotic fun for the family

starts at 5 PM with children’s rides and inflatables, live music, food & drink concessions, fireworks display at 9:35 PM, and screening of “The Hunger Games: Mockingjay-Part 2.” 3333 Buford Dr., Buford. mallofgeorgia.com.

visitdecaturgeorgia.com.

STONE MOUNTAIN PARK’s FANTASTIC FOURTH

July 1-4 46th annual celebration on Memorial Lawn, 10:30 AM-8 PM. Lasershow Spectacular at 9:30 PM with patriotic fireworks finale. Arrive early for park entry. Free; park entry fee required.

MARIETTA’s FOURTH IN THE PARK July 4 The Marietta Freedom

Parade kicks off the day at 10 AM (traveling from Roswell Street Baptist Church to the Square and

stonemountainpark.com.

and food trucks.

cocktails, cuisine and music, 7-11 PM Fri. 404/929-6400. 767 Clifton Road. 404/929-6300.

June 19 Malts & Vaults of

fernbankmuseum.org.

GEORGIA AQUARIUM

Ongoing Explore the world’s aquatic biodiversity in a fascinating setting. The new SunTrust Pier 225 features six rescued (and nonreleasable) sea lions, including pups “Jupiter” and “Neptune,” a notably social species of pinniped. 225 Baker St. NW, Atl. 404/5814000. georgiaaquarium.org.

ticketalternative.com. Ongoing “Sights, Symbols &

Stories of Oakland” guided tours, Sat. & Sun. $12 ($6 students & seniors). 248 Oakland Ave. SE, Atl.

oaklandcemetery.com.

LEGOLAND DISCOVERY CENTER ATLANTA

HISTORIC OAKLAND CEMETERY EVENTS

June 11 Gone with the Wind

Oakland: Where Beer Meets History, 5 PM. Advanced tickets only. ticketalternative.com. Aug. 27 Love Stories of Oakland. Advanced tickets only. $16 ($10 students & seniors).

Anniversary Tour, 7 PM. Advanced tickets only. $16 ($10 students & seniors). ticketalternative.com. June 18 Tunes from the Tombs music festival, 1-8 PM, featuring all genres of music, plus beer & wine

Summer Swashbuckling fun awaits Lego-lovers of all ages at the new Pirate Adventure Island attraction. Phipps Plaza, 3500 Peachtree Road NE. legolanddiscoverycenter.com/ atlanta/. 404/848-9252.

Southern Seasons Magazine

| 113

FUN AROUND TOWN to benefit Aflac Cancer Center & CHOA. 404/785-7373. choa.org.

MAGNOLIA RUN & WALK

Aug. 20 32nd annual event hosted by The Epilepsy Foundation of GA with a 5K run & 1-mile fun-run/ walk. epilepsyga.org/events/ magnolia-run/. 404/527-7155.

OLD SOLDIER’S DAY ROAD RACE

Atlanta Moon Ride June 10 Piedmont Park STONE MOUNTAIN PARK

5K RUN AND BLOCK PARTY

9:30 PM nightly through Aug. 6, plus Aug. 13, 20, 27; 9 PM show Sept. 3-5. Memorial Lawn. Free with vehicle entry fee. June 11-July 31 Summer at the Rock, with family-friendly activities and attractions at Crossroads, including the JUMP, Geyser Towers, SkyHike and the new Georgia Justice Wild West Train Show. Adventure Pass. June 11-12 Atlanta Food Truck and Music Festival. June 19 Father’s Day Vintage Car Show, 10 AM-6 PM. July 1-4 Fantastic Fourth Celebration on Memorial Lawn. 10:30 AM-8 PM. Lasershow at 9:30 PM with fireworks finale. Free. Sept. 3-5 Labor Day Weekend: Lasershow & Fireworks. Sept. 8-11 Yellow Daisy Festival. Vehicle entry fee. 1000 Robert E. Lee Blvd., Stone Mountain.

at Alpharetta City Hall, 5-9 PM, with food trucks, live music and Sponsor Expo. Kids Fun Run at 6:30 PM (free, must register); 5K at 7 PM ($35, $30 adv). Park at Milton Center, 86 School Dr., or City Hall, 2 Park Plaza. alpharetta.ga.us.

Summer Lasershow Spectacular,

stonemountainpark.com. 770/498-5690.

ZOO ATLANTA

June 6-10 Art Gone Wild PaintOut Week. Watch 40 select artists create animal-inspired works. June 18-25 Art Gone Wild Show and Sale. June 19 Father’s Day at the Zoo. 800 Cherokee Ave., Atl. 404/6242809. zooatlanta.org.

SPORTS & FITNESS AJC PEACHTREE ROAD RACE

July 4 Patriotic supporters, rolling hills and live music await the 60,000 participants in the country’s largest 10K road race, on a 6.2mile-stretch from Lenox Square to Piedmont Park, Atl. 404/231-9064. atlantatrackclub.org/peachtree.

ALPHARETTA MAYOR’S CORPORATE CHALLENGE 114

Aug. 25 20th annual running

AREA 31.1/Terrestrail 5K Aug. 13 Alien-themed night road

race at 7 PM at Riverside Park, 575 Riverside Road, Roswell. Benefits Matthew E. Russell Foundation and Flagshare. alienhalf.com.

ATLANTA BELTLINE RACE July 16 Westside 5K, West End

Park, 1111 Oak St. SW, Atl. $30 adv.

beltline.org/races.

ATLANTA BRAVES

Home Games June 1-2 San Francisco Giants June 10-12 Chicago Cubs June 13-16 Cincinnati Reds June 23-26 New York Mets June 27-29 Cleveland Indians June 30-July 3 Miami Marlins July 15-17 Colorado Rockies July 28-31 Philadelphia Phillies Aug. 2-4 Pittsburgh Pirates Aug. 16-17 Minnesota Twins Aug. 18-21 Washington Nationals Aug. 30-Sept. 1 San Diego Padres Games at Turner Field. 800/326-

4000. atlanta.braves.mlb.com.

ATLANTA KIDNEY WALK June 4 National Kidney

Foundation’s pledge walk at Turner Field, 755 Hank Aaron Dr. SE, Atl. Walk start: 10:15 AM. 770/452-

1539 x 602. kidneyga.org.

ATLANTA MOON RIDE

June 10 Hit the streets for a fun 6.5-mile night bike ride to benefit Bert’s Big Adventure. Open to all skill levels and ages; costumes encouraged, helmets required. Starts and ends at Piedmont Park, with traffic-free route

www.southernSeasons.net

ADAM DAVILA PHOTOGRAPHY

Aug. 6 8K road race at 7 AM

through Atlanta neighborhoods, chaperoned by Atlanta Police Dept. Registration and kick-off party: 6 PM. Ride: 11 PM. $30. atlantamoonride.com.

BB&T ATLANTA OPEN

July 30-Aug. 7 An ATP World

Tour 250 Event at Atlantic Station, 1380 Atlantic Dr. NW, Atl. Tournament features men’s top world tennis players in singles and doubles competition.

bbtatlantaopen.com.

BICYCLE RIDE ACROSS GEORGIA (BRAG 2016)

June 4-11 Georgia’s largest family oriented bicycling event is headed from Atlanta to Savannah for the 37th annual ride, covering about 55 miles per day. 770/498-5153.

at Wills Park, Old Milton Pkwy., Alpharetta. $30 ($24 adv.).

678/297-6100. alpharetta.ga.us. awesomealpharetta.com.

PADDLE GEORGIA 2016

June 18-24 Journey from Dalton to Rome on the Conasauga, Oostanaula and Coosa rivers at the Georgia River Network’s canoe/ kayak camping adventure. Daily paddling trips average 15 miles. garivers.org/paddle_georgia. 706/409-0128.

POSSUM TROT 10K

June 18 10K Race & 1-Mile Fun Run at Chattahoochee Nature Center, Roswell. A fun, flat and fast course along the river banks, 7-10 AM. Qualifier for the Peachtree Road Race. Pre-registration required. chattnaturecenter.org. 770/992-2055 x 226.

ROAD ATLANTA

June 4-5 NASA June 17-19 WERA Cycle Jam July 23-24 SCCA Double SARRC Aug. 26-28 GRIDLIFE motorsports festival capped by an electronic music showcase at night. 5300 Winder Hwy., Braselton.

brag.org.

roadatlanta.com. 800/849-RACE.

Bike MS: COX Atlanta Peach Ride 2016

STRONG4LIFE SUPERHERO SPRINT

Oct. 1-2 Cycling fundraiser, starts at Blalock Lakes in Coweta County. bikemsgeorgia.org.

DOGWOOD INVITATIONAL June 27-July 2 Elite amateur

golfers compete at Druid Hills Golf Club at this internationally-ranked tournament. thedogwood.com.

GA. 400 Hospitality Highway Century Ride

July 10 Embark on a bike ride on Hwy. Ga. 400 (with all lanes closed to traffic), for 9, 27, 45, 60 or 101 miles. Start/finish in Sky Zone parking lot, Kings Market Shopping Center, 1425 Market Blvd., Roswell. 7 AM. ga400century.com.

June 4 5K Run and 1-mile Fun Run at Piedmont Park to benefit the Children’s Healthcare of Atlanta’s campaign against childhood obesity. Registration: 7-10:15 AM. 5K at 9 AM, Fun Run at 10 AM, Costume Contest at 10:45 AM. choa.org.

“SWING INTO ACTION”

June 6 North Fulton Community Charities presents its annual golf and tennis tournament at St. Ives Country Club. 678/3874459. nfcchelp.org/swing. vmalbrough@nfcchelp.org.

TOBY WADE CHAPIN MEMORIAL GOLF TOURNEY June 5-6 Benefit tournament at

john smoltz BRAVES CELEBRITY-AM GOLF TOURNAMENT

RiverPines Golf, 4775 Old Alabama Road, Johns Creek. choa.org.

alumni, athletes and celebs at this tournament at Atlanta National Golf Club, White Columns Country Club and Hawks Ridge Golf Club

ALL TIMES AND DATES SUBJECT TO CHANGE. PLEASE CONTACT INDIVIDUAL VENUE FOR CONFIRMATION.

770/442-5960.

Aug. 14-15 Golf with Braves

Travel photography by Dero Sanford

Crystal Bridges Museum of American Art.

Southern Seasons Magazine

| 115

by Vivian Holley

Big Lures in Little Bentonville

ou might picture Bentonville, set in northwest Arkansas at the foot of the Ozarks, as a Mayberry-like place wrapped in a grand expanse of outdoor pleasures from fly fishing to mountain biking. Or you might think of Bentonville as Walmart Country; this, after all, is where the retail behemoth was born. What you might not imagine is that Bentonville is a major art mecca. Yet all of the above images are right on target – the newsiest being the art part. Situated not in a throbbing coastal capital but smack in the midst of 120 serene, wooded and stream-threaded Arkansas acres is the Crystal Bridges Museum of American Art, home to one of the largest and most important assemblages of its kind anywhere. Conceived by longtime collector and Bentonville hometowner Alice Walton, daughter of Walmart founder Sam Walton, Crystal Bridges opened its doors in November 2011 – the first new museum dedicated to our country’s art in more than a generation. You could call Alice Walton Bentonville’s answer to Peggy Guggenheim – except that Walton’s focus is on American art presented in a natural American landscape. Spanning five centures of masterworks from Colonial days to the present, Crystal Bridges galleries unfold a chronological look at the nation’s narrative told via the vision of its artists. Here are such icons as Charles Willson Peale’s George Washington and Asher Brown Durand’s Kindred Spirits (controversially purchased from the New York Public Library in 2005). Copley and Singer and Cassatt. John Singer Sargent’s Capri Girl Dancing on a Rooftop. Georgia O’Keeffe and Norman Rockwell’s Rosie the Riveter. Rothko and Rothenberg and Lichtenstein. Andy Warhol’s Coca-Cola and Louise Bourgeois’s monumental spider sculpture Maman. The feast comes wrapped in Moshe Safdie’s stunning architectural creation of eight connected pavilions, their concrete walls banded in red cedar with soaring pine beams and arched copper roofs. Spanning signature spring-fed ponds are the structure’s namesake gleaming glass bridges, all spread at the base of a natural ravine with towering tulip trees and other Ozark forest species rising on all sides. Added to the Crystal Bridges exhibits last year is a Frank Lloyd Wright Usonian house, built in 1954 along the Millstone River in New Jersey. Repeatedly threatened by the flooding river, the house was relocated for preservation and reconstructed, complete with Wright’s distinctive built-in furniture, near the museum’s south entrance. Three miles of meandering trails surround the architectural design, one of them the 116

www.southernSeasons.net

photography by Dero Sanford. Courtesy of Crystal Bridges Museum of American Art, Bentonville, Arkansas.

of Arkansas

photography by Dero Sanford. Courtesy of Crystal Bridges Museum of American Art, Bentonville, Arkansas.

The Art

Crystal Bridges Museum of American Art.

Dining bridge at dusk.

Southern Seasons Magazine

| 117

Visit Bentonville

Louise Bourgeois: Maman.

The museum’s entrance features Nancy Schon’s bronze piece Tortoise and Hare. 118

www.southernSeasons.net

sculpture-punctuated Art Trail that connects the museum acreage to downtown Bentonville. Trace the trail about a mile into town and you’ll find a cultural and culinary renaissance in progress. Thanks to becoming an unlikely art destination, Bentonville – a supremely walkable charmer bursting with flower beds – boasts a growing population, new galleries, and an assortment of hip restaurants. Launched in 2013 at a corner of the town square, 2lc Museum Hotel is the third property in a rapidly growing chain, an uncommon venue that is both a buzz-stirring boutique hotel with a hot restaurant – Chef Matthew McClure’s The Hive – and a gathering of works by 21stcentury artists. It’s a collection you can view around the clock in the restaurant and bar, on elevators, in hallways and restrooms, on the roof and sidewalk. In the mix, sculpted from recycled plastic, is a whimsical platoon of migrating fourfoot penguins that may turn up anywhere at all. Including, rumor has it, in your shower. The hotel is hard to miss, thanks to some of

photography by Timonthy Hursley

Gallery bridge and north lawn with Lowell’s Ocean, steel sculpture by Mark di Suvero. photos Courtesy of Crystal Bridges Museum of American Art

those apple-green penguins standing rooftop guard. No less eye-grabbing is Monica Mahoney’s sidewalk “art car” christened Making Change. The Fleetwood Cadillac limousine, completely covered in pennies, nickels, and dimes, is circa-1962, marking the year that Walmart was founded here. Its coin motif was inspired by the original Walton’s 5 & 10, still located on the town square and now housing a museum of company history. It’s a must-see – the 1950s-era Walton’s 5 & 10 – to soak up the Walmart story, linger over a milkshake at the soda fountain, and stock up on retro toys and sweets, the likes of saltwater taffy and candy cigarettes. Another must, neighbor to Crystal Bridges, is Amazeum, a new and irresistibly interactive wonderland for children that captivates adults as well. Drive some 20 minutes south for a look at Fayetteville, humming with its lively University of Arkansas student population and ardent Razorback fans. Boutiques, bookstores, eateries, and nightlife abound, while the art

Nick Cave, Soundsuit, 2010. Photography by James Prinz; Image courtesy of Jack Shainman Gallery, NY.

Karen LaMonte, Dress Impression with Wrinkled Cowl, 2007. by Martin Polak. Southern Photography Seasons Magazine | 119

Nathan S. Pierce: SunKissed

Visit Bentonville

Northwest Arkansas Council

21c Making Change art car.

vibe continues at Fayetteville Underground, a spacious stronghold of galleries and working studios devoted to area artists. Nearby, the regionâ&#x20AC;&#x2122;s focus on outdoor riches is spotlighted at the dozen themed and blossoming venues of the enchanting Botanical Garden of the Ozarks. As the cognoscenti have it, Crystal Bridges is the most 120

www.southernSeasons.net

Clear Creek Trail, part of 37-mile Razorback Regional Greenway.

impressive institution of its kind on the U.S. scene since the Getty Center debuted in Los Angeles. Not to mention that when it comes to art destinations, Bentonville is more accessible than L.A., and way easier to navigate. Information: www.northwestarkansas.org; www.21cmuseumhotels.com/bentonville

21c Museum Hotel, Bentonville. Artwork at The Hive.

Matthew McClure, Executive Chef, The Hive. Images courtesy of 21c Museum Hotels

The Hive. Southern Seasons Magazine

| 121

food for thought

Special Blend Beautiful Briny Sea, an artisan dry goods company in Atlanta’s historic Grant Park, creates unique seasoning blends for shops and restaurants around the country. The products are 100% handmade using locally grown herbs, foraged mushrooms and organic spices that are sustainably sourced. New mixes include Daiquiri Sugar for Williams-Sonoma ($12.95), with AA Madagascar Bourbon vanilla beans and certified organic cane sugar; and Cawffee Shuguh with Heat for Fishs Eddy ($17.95), made from organic cane sugar, AA vanilla, espresso, cayene and satsuma. beautifulbrinysea.com. in time for bottling some of summer’s sunJammin’4Just ripened bounty, “The All New Ball Book of Canning

and Preserving” (Oxmoor House, June 2016) is filled with fresh and flavorful recipes for jams, jellies, jerkies, pickles and more in a comprehensive guide from the most trusted name in home preserving. Featured recipes include Strawberry-Rhubarb Jam, Glazed Apple Tart, Fresh Cherry Salsa and Smoked Maple-Juniper Bacon, as well as convenient heat-and-eat options, soups and recipes in a jar. Beautifully illustrated with mouthwatering photography, the book offers simple step-by-step instructions on everything from fermenting and freezing to curing and smoking.

minty fresh 3

For a sweet twist on summer refreshment, try a Cool Melon-Mint Cocktail with a flavorful blend of fresh honeydew melon and mint. Blend half of a honeydew melon (cut into small cubes) with 1/4 cup of elderflower cordial until pureed smooth for about 1-2 minutes. Add 3/4 cup of Woodbridge by Robert Mondavi Moscato (chilled) and 1 cup of crushed ice and blend until fully smooth. Add seltzer water to taste and garnish with fresh mint or melon wedges. Rim serving glasses with ginger sugar if desired.

122

www.southernSeasons.net

Belgian Chocolate Soup from Cape Dutch restaurant. Photo by Heidi Geldhauser.

DINING Southern Seasons Magazine

| 123

by jennifer bradley franklin

Cape of Good Hope Joyful South African Fare at Cape Dutch

I’m always on the hunt for restaurants that feel good. It’s the same thrill I get when traveling, to discover a truly unique destination that makes my spirit sing. For both eateries and countries, I find myself looking for an indefinable quality – an elusive mix of flavor, atmosphere, vibe, and the sort of je ne sai quois I can’t quite put my finger on. The kind of place that charms you to your very core. My first visit to Cape Dutch was that for me.

he menu, while not huge (nine appetizers, seven grilled items and seven entrées), is so compelling that I was loathe to choose. Lemongrass mussels with coconut milk; Thai basil, seared scallops with cucumber noodles and quinoa tabbouleh; elk chop with spaghetti squash; and board of meats and cheeses from around the world (including biltong, South African cured beef ) all called my name. Lucky for me and my dinner date (my husband, Will), restaurant owner Justin Anthony

124

happened to be on hand to offer his guidance. We didn’t deviate from his sagacious recommendations and were the better for it. We started with an entrée portion of porcini ravioli, split into two appetizer plates by the accommodating hive of chefs, buzzing in the diminutive open kitchen, the dining room’s centerpiece. The pillowy, mushroom-stuffed pasta swam in fragrant sage butter and was topped with Parmesan shavings and – the pièce de résistance – decadent, earthy black truffles, shaved tableside by executive chef Philippe Haddad himself. Each bite was euphoric.

PhotoGRAPHY BY Heidi Geldhauser and Jonathan Phillips

www.southernSeasons.net

Above: Cheshire Politan, the restaurant’s take on a Cosmo. Right: Sake Scottish Salmon with bok choy, radish and shiitake. Top: Foie Gras Brûlée with figs, king oyster mushrooms and espelette salt. Southern Seasons Magazine

| 125

For the main event, we got to know the braai, Haddad and Anthony’s stateside take on the traditional South African grill. Locally sourced hickory and oak create a rousing open flame, infusing anything cooked on it with a woody depth of flavor. We opted for a surf ‘n’ turf of sorts: prime bonein ribeye and a whole branzino (Mediterranean sea bass). The steak, aged for 35 days, was perfectly marbled, umamiladen and so tender a fork was all that was needed to build the perfect bite. Dipped in the chef ’s silky bordelaise or rich béarnaise, it was heaven. As much as I relished the aforementioned dishes, the real star of the meal was the exquisitely prepared branzino. It comes whole (though you can opt to have it filleted), stuffed with fragrant rosemary and juicy lemon and grilled on the braai. The result is a charred crust of skin (like a deliciously salty chip), surrounding succulent, sweet, flaky flesh. Decadent gratin Dauphinoise, toothsome roasted wild mushrooms and expertly prepared pommes frites (the chef hails from Belgium, after all), rounded out the meal and beautifully showcased Haddad’s considerable skill. Thanks to a genius – and simple – wine program style (one which I can’t help but wish other restaurants of this caliber would adopt), Cape Dutch ensures you won’t have to wait long for each dish’s appropriate pairing. The dining room features a wine table so that servers can recommend, pour and deliver a glass in record time – without waiting 126

for the busy bartenders to accommodate. The list itself is a treasure as well. You’ll find some delicious South African wines here (including one from Ken Forrester’s Stellenbosch vineyard, which helped inspire the concept for the restaurant), in addition to stand-outs from around the world. If you’re celebrating something – or just want to spring for a really special bottle – a selection of rare and extra-large bottles are available (Schrader “Old Sparky” 2013 Magnum for $1,500, anyone?). Not only is Cape Dutch a culinary tour de force, it’s a feast for the eyes as well. The former Woodfire Grill space has been gorgeously transformed by Anthony’s interior designer wife, Kelly (of Anthony | Wolf ), so that it feels at once fresh, comfortable and established. Rich, worn leather, rough-hewn wood plank floors and oversized glass globes lit with Edison light bulbs give the nearly 7,000-square-foot interior coziness in spades. There’s a touch of whimsy too – like the canvas painted in bold black letters, “Frankly My Dear, I Don’t Give A Damn.” Overall, the space and the menu feels, to employ a perhaps overused term, global. There are influences from Haddad’s native Belgium, France, Asia and the Mediterranean and of course, Anthony’s South African home. Regardless of which region of the world speaks to you, I can almost guarantee that a meal at Cape Dutch will make your taste buds – and quite possibly, your spirit – sing.

Visit Cape Dutch at 1782 Cheshire Bridge Road NE, Atlanta. 404/343-0313. capedutchrestaurant.com www.southernSeasons.net

Cape Dutch is not only a culinary tour de force, itâ&#x20AC;&#x2122;s a feast for the eyes as well, with a spacious interior that has coziness in spades.

Southern Seasons Magazine

| 127

Heidi Geldhauser

Cooks & Soldiers

Dining Guide AMERICAN

ANOTHER BROKEN EGG CAFE 2355 Peachtree Road NE, Atl., 404/254-0219. 4075 Old Milton Pkwy., Alpharetta, 770/837-3440. 4300 Paces Ferry Road, Vinings, 770/384-0012. 4745 Ashford Dunwoody Road, 770/408-0110. Southern regional cooking with an edge. } anotherbrokenegg.com. ARIA 490 E. Paces Ferry Road NE, Atl. 404/233-7673. Buckhead hot spot with creative “slow food” served in a sleek space. Signature dishes include Niman Ranch Slow Roasted Pork and Zinfandel Braised Beef Short Rib. p }}} aria-atl.com. ★★★ ATLANTA GRILL 181 Peachtree St. NE @ The Ritz-Carlton, Atlanta, 404/221-6550. Grilled steaks, chops, seafood and Southerninspired cuisine are served in a warm, clubby atmosphere. p }}} ritzcarlton.com. ATLAS 88 W. Paces Ferry Road NW @ St. Regis Atlanta, 404/600-6471. Farmfresh, seasonal American cuisine combined with European influences. p }}} atlasrestaurant.com. 128

www.southernSeasons.net

BACCHANALIA 1198 Howell Mill Road, Atl. 404/365-0410. Great service and generous portions with a heavenly menu of specialties served in a warehouse-chic setting. p h }}} starprovisions.com. ★★★★

CANOE 4199 Paces Ferry Dr., Vinings. 770/432-2663. Culinary expertise and natural aesthetics come together for a rich, flavorful experience, with a seasonal menu and inviting interior. p }} canoeatl.com. ★★★

BETTER HALF 349 14th St., Bldg. C, Atl., 404/695-4547. Seasonal menu reflects the best products the South has to offer in a casually refined spot. p }} betterhalfatl.com.

CAPITAL GRILLE-ATLANTA 255 E. Paces Ferry Road, Atl. 404/262-1162. Classic steak house offerings, from chops to fresh seafood, in a relaxed atmosphere that features a sweeping view of Buckhead. p }}} thecapitalgrille.com. ★★

BLUE RIDGE GRILL 1261 W. Paces Ferry Road, Atl. 404/233-5030. Signature dishes, from grilled Georgia trout and slow-roasted grouper to iron skillet mussels and hickorygrilled rib eye, are served in the cozy comforts of a mountain lodge, with stone fireplace, log walls and red leather booths. p }}} blueridgegrill.com. ★★★ BUCKHEAD DINER 3073 Piedmont Road, Atl. 404/262-3336. Atlanta icon offers inventive menu, from sweet and spicy Thai chili calamari to veal and wild mushroom meatloaf, in an upscale, retro atmosphere. Call-ahead priority accepted. } buckheadrestaurants.com. ★★★

EMPIRE STATE SOUTH 999 Peachtree St., Atl. 404/541-1105. A community restaurant that appeals to a broad range, a la celebrated Athens chef Hugh Acheson, with authentic Southern dishes served in a meat-and-three format. p }} empirestatesouth.com. 4TH & SWIFT 621 North Ave. NE, Atl. 678/904-0160. Enjoy such specialties as North Georgia apple salad and sticky toffee pudding in a quaint setting, in the former engine room of the Southern Dairies Co. in the Old Fourth Ward. p }} 4thandswift.com.

FLIP BURGER BOUTIQUE 1587 Howell Mill Road, Atl., 404/352-3547. 3655 Roswell Road NE, Atl., 404/549-3298. Unique menu of burgers, sandwiches, sides and salads served in a contemporary, hip space. } flipburgerboutique.com.

Two Urban Licks

GORDON BIERSCH BREWERY RESTAURANT 3242 Peachtree Road NE, Atl., 404/264-0253. 848 Peachtree St. NE, Atl., 404/870-0805. Hand crafted beer and madefrom-scratch food served in a fun atmosphere. p } gordonbierschrestaurants.com. GRACE 17.20 5155 Peachtree Pkwy., Ste. 320, Peachtree Corners. 678/421-1720. Creative, seasonal menu in a casually elegant setting. p }} grace1720.com. ★★ HAVEN RESTAURANT AND BAR 1441 Dresden Dr., Ste. 160, Atl. 404/969-0700. Casual neighborhood dining with a fresh seasonal menu and an impressive wine list. p }} havenrestaurant.com. ★★★ HOBNOB NEIGHBORHOOD TAVERN 1551 Piedmont Ave. NE, Atl. 404/968-2288. Comfort pub cuisine and craft beers in a community-driven establishment in Ansley Park. p } hobnobatlanta.com. HOLEMAN & FINCH PUBLIC HOUSE 2277 Peachtree Road, Atl. 404/948-1175. Hailed as a British gastropub with a Southern accent, with savvy cocktails and a meaty menu. } holeman-finch.com. HOUSTON’S 2166 Peachtree Road NW, Atl., 404/351-2442. 3321 Lenox Road, Atl., 404/237-7534. 3539 Northside Pkwy., Atl., 404/262-7130. Lavish portions of fresh American fare, from hickory-grilled burgers to tender, meaty ribs. } houstons.com. ★ JCT. KITCHEN & BAR 1198 Howell Mill Road, Ste. 18, Atl. 404/355-2252. A casual, yet upscale setting to enjoy such specialties as angry mussels, chicken and dumplings, fried chicken, truffle-parmesan fries and Georgia peach fried pies. p } jctkitchen.com. JOEY D’S OAKROOM 1015 Crown Pointe Pkwy., Atl. 770/512-7063. Upscale steakhouse features choice-aged charbroiled steaks, signature sandwiches, salads, pastas, chicken and fish, plus over 400 brands of spirits. p }} joeydsoakroom.com. ★★ JP ATLANTA 230 Peachtree St., Ste. 1150, Atl. 404/523-7600. The latest creation of John C. Portman Jr. combines refined cuisine and contemporary elegance, with innovative dishes made with fresh local ingredients. p h }}} jp-atlanta.com.

LITTLE BACCH 1198 Howell Mill Road, Atl. 404/365-0410. Intimate dining with ingredient-driven menu, abundant with fresh-grown produce and seasonal flavors, plus hand-crafted cocktails. Specialties include caviar service, oysters, cheese soufflé, whole roasted heritage chicken, dry-aged beef and chocolate soufflé and fruit tarts. p }} starprovisions.com. LIVINGSTON RESTAURANT AND BAR 659 Peachtree St. @ Georgian Terrace Hotel. 404/897-5000. Fresh American cuisine in a classy setting. p }} livingstonatlanta.com. LOBBY BAR AND BISTRO 361 Seventeenth St., Atl. 404/961-7370. Seasonal menu with a comfort food edge in a casual atmosphere. p } lobbyattwelve.com. LOCAL THREE 3290 Northside Pkwy NW, Atl. 404/968-2700. Farm-fresh seasonal fare, from Ga. Mountain Trout to Springer Mountain Farm Chicken Pot Pie, served in a comfy space. p } localthree.com. MILTON’S CUISINE & COCKTAILS 800 Mayfield Road, Milton. 770/817-0161. Feast on such Southern specialties as sweet potato and shrimp fritters, fried chicken, pork loin and chef ’s veggie plate in the charming setting of a restored 150-year-old farmhouse and 1930s cottage. p }} miltonscuisine.com. MURPHY’S 997 Virginia Ave., Atl. 404/8720904. Inventive, fresh seasonal fare, excellent service and basement charm. p } murphysatlanta-restaurant.com. ONE. MIDTOWN KITCHEN 559 Dutch Valley Road, Atl. 404/892-4111. Inventive

atmosphere, food and wine served in a renovated urban warehouse space. p } onemidtownkitchen.com. ★★ PARK 75 75 14th St. NE @ Four Seasons Hotel Atlanta. 404/253-3840. Seasonal and regional favorites, from crispy lobster with shittake sticky rice and Asian vegetables to barbecue “Kobe” short-rib with smoked Gouda grits, in an elegant setting. p }} fourseasons.com. ★★★ PUBLIK DRAFT HOUSE 654 Peachtree St., Atl. 404/885-7505. Great gastropub cuisine served in a fun place. p } publikatl.com. RATHBUN’S 112 Krog St., Atl. 404/5248280. New American food served with Southern flair in a swanky space at the Stove Works in Inman Park. p }} rathbunsrestaurant.com. ★★★★ RESTAURANT EUGENE 2277 Peachtree Road, Atl. 404/355-0321. Seasonal cuisine and boutique wine combined with gracious service in a sophisticated spot in the Aramore Building. p }}} restauranteugene.com. REVIVAL 129 Church St., Decatur. 470/2266770. Kevin Gillespie’s family-style dining experience with traditional Southern-inspired dishes with farm-fresh ingredients. p }} revivaldecatur.com. QUICK GUIDE p reservations h dress restrictions } entrees $10-20 }} entrees $20-30 }}} entrees $30+

SOUTHERN SEASONS STARS ★ great ★★ excellent ★★★ superb ★★★★ the best

Southern Seasons Magazine

| 129

SAGE WOODFIRE TAVERN 11405 Haynes Bridge Road, Alpharetta, 770/569-9199. 4505 Ashford Dunwoody Road, Atl., 770/8048880. City chic yet casual atmosphere featuring contemporary American cuisine with global influences. p }} sagewoodfiretavern.com. SALT FACTORY 952 Canton St., Roswell, 770/998-4850. 102 S. Main St., Alpharetta, 770/752-1888. Neighborhood gastropub with exceptional food and drink served in a comfy setting, from soups, salads and appetizers to specialty burgers, pizza, pasta, fish and beef. } saltfactorypub.com. ★★★ SALTYARD 1820 Peachtree Road NW, Atl. 404/382-8088. Diverse selection of seasonal dishes offered in family-style small plates, plus signature cocktails and craft beer in spirited setting. p } saltyardatlanta.com. SEASONS 52 90 Perimeter Center West, Dunwoody, 770/671-0052. Two Buckhead Plaza, 3050 Peachtree Road NW, Atl., 404/8461552. A seasonally changing menu of fresh food grilled over open wood fires and a bythe-glass wine list in a casually sophisticated setting with live piano music in the wine bar. p }} seasons52.com. SHULA’S 347 GRILL 3405 Lenox Road NE

@ Atlanta Marriott Buckhead. 404/848-7345. Signature meals from Hall of Fame football coach Don Shula in a casual chic setting. p } shulas347atlanta.com. SOUTH CITY KITCHEN 1144 Crescent Ave. NE, Atl., 404/873-7358. 1675 Cumberland Pkwy. SE, Vinings, 770/4350700. The Old South meets the big city, with contemporary Southern cuisine, from fried chicken to garlic-sautéed collards, dished out from the exhibition kitchen. p }} fifthgroup.com. ★★★ SOUTHERN ART 3315 Peachtree Road NE @ InterContinental Buckhead. 404/946-9070. Southern-inspired cuisine and cocktails in a relaxed atmosphere, with an artisan ham bar, vintage pie table, and sophisticated bar and lounge. Dine on baked oysters with crispy pork belly, chicken & dumpling soup and Low Country seafood. p }} southernart.com. TAP 1180 Peachtree St., Atl. 404/347-2220. Gastropub with innovative comfort food, extensive draft beer and barrel wine selections, and convivial setting. p } tapat1180.com. TERRACE BISTRO 176 Peachtree St. NW @ The Ellis Hotel. 678/651-2770. Flavorful farm-to-table dishes served in a chic setting.

p }} ellishotel.com/dining. THE CAFE AT THE RITZ-CARLTON, BUCKHEAD 3434 Peachtree Road, Atl. 404/240-7035. Delightful menu, sunny ambiance and live piano music. Seasonal patio seating. p }}} ritzcarlton.com. ★★ THE SOUTHERN GENTLEMAN 3035 Peachtree Road NE, Atl. 404/9399845. Southern-inspired gastropub offers a fresh, modern take on traditional dishes made with locally sourced ingredients in a gorgeous top floor space in the Buckhead Atlanta Shops development. p h }} thesoutherngentlemanatl.com. THE SUN DIAL RESTAURANT 210 Peachtree St. NW @ The Westin Peachtree Plaza. 404/589-7506. Offers a 360-degree dining experience, 723 feet above the city, with contemporary cuisine and live jazz. p }}} sundialrestaurant.com. THREE SHEETS 6017 Sandy Springs Cir., Atl. 404/303-8423. A refreshing escape with cocktails, music and small plates. } threesheetsatlanta.com. ★★★ TWO URBAN LICKS 820 Ralph McGill Blvd., Atl. 404/522-4622. Fiery cooking with

Through these doors go only those that know

Happy Hour MONDAY - FRIDAY | 4:00PM - 7:00PM Enjoy Half Priced Hors D'oeuvres at the Bar from 4:00pm - 7:00pm Specialty Cocktails & Wines are available all day! 3500 PEACHTREE ROAD NE, ATLANTA GA, 30326 | 404.844.4810

WWW.DAVIOS.COM/ATL | @DAVIOSATLANTA

130

www.southernSeasons.net

1495 Chattahoochee Avenue • Atlanta • 404.352.9009

www.nuevolaredocantina.com Mr. Chance Evans, El Presidente

wood-roasted meats and fish, plus a touch of New Orleans and barbecue, in a chic warehouse, with live blues music. p }} twourbanlicks.com. VILLAGE TAVERN 11555 Rainwater Dr., Alpharetta. 770/777-6490. Fresh fish, pastas, salads, chicken, steaks and chops in an upscale, casual setting. p }} villagetavern.com. WATERSHED ON PEACHTREE 1820 Peachtree Road, NW, Atl. 404/809-3561. Southern-inspired menu in farmhouse-chic setting, from fried pimento cheese sandwich to bone-in ribeye with black truffle gravy. p }} watershedrestaurant.com. YEAH! BURGER 1168 Howell Mill Road, Ste. E, 404/496-4393. 1017 N. Highland Ave., Va.-Highland, 404/437-7845. Organic, ecofriendly restaurant offers customizable burgers in a fast-casual format. } yeahburger.com. ZEAL 1255 Johnson Ferry Road, Marietta. 678/401-7142. Chic, farm-to-table modern eatery with chef-inspired menu, plus craft beers, boutique wines and spirits in a relaxed atmosphere. p }} zealrestaurant.com.

Indulge in the ultimate epicurean weekend June 2-5 at the Atlanta Food & Wine Festival in Midtown. atlfoodandwinefestival.com

BRAZILIAN

FIRE OF BRAZIL 218 Peachtree St. NW, Atl. 404/525-5255. Marinated slow roasted choice cuts of meat prepared in Brazilian tradition. p }}} fireofbrazil.com. FOGO DE CHAO 3101 Piedmont Road, Atl. 404/266-9988. Delectable cuts of fire-roasted meats, gourmet salads and fresh vegetables, and a variety of side dishes. p }}} fogodechao.com. ★★★

CHINESE

CANTON HOUSE 4825 Buford Hwy., Chamblee. 770/936-9030. Cantonese cuisine, specializing in dim sum, served in a spacious dining room with friendly service. } cantonhouserestaurant.com. ★★★★ HONG KONG STAR 4719 Lower Roswell Road, Ste. 110, Marietta. 770/5092129. Exciting dishes with Asian flair, with great service and inviting setting. } hongkongstarmenu.com.

QUICK GUIDE p reservations h dress restrictions } entrees $10-20 }} entrees $20-30 }}} entrees $30+

AFWF/Raftermen Photography

SOUTHERN SEASONS STARS ★ great ★★ excellent ★★★ superb ★★★★ the best Southern Seasons Magazine

| 131

including wood-grilled octopus, oven-roasted lemon chicken, slow-braised lamb shank, and spinach and feta spanakopita. p h }} buckheadrestaurants.com. ★★★★

ITALIAN

ANTICA POSTA 519 E. Paces Ferry Road, Atl. 404/262-7112. Tuscan cuisine served in a cozy bungalow with an extensive wine list. p }} anticaposta.com. BARAONDA RISTORANTE & BAR 710 Peachtree St., Atl. 404/879-9962. Authentic Italian, from homemade pastas and pizzas to grilled dishes, served in a charming setting, with an expansive wine list. p }} baraondaatlanta.com.

Kyma P.F. CHANG’S CHINA BISTRO 7925 N. Point Pkwy., Alpharetta, 770/992-3070. 500 Ashwood Pkwy., Atl., 770/352-0500. 3333 Buford Dr., Buford, 678/546-9005. 1624 Cumberland Mall, Ste. LS108, Atl., 770/8035800. Enjoy diced chicken wrapped in lettuce leaves, orange-peel beef with chili peppers, and wok-fried scallops with lemon sauce in a stylish space. p }} pfchangs.com.

include white Gulf shrimp, sautéed short smoked mountain trout and Maine cod. p }} buckheadrestaurants.com. ★★★★

THE REAL MANDARIN HOUSE 6263 Roswell Road, Atl. 404/255-5707. Upscale Chinese and Vietnamese cuisine, with dishes ranging from Orange Beef and Sake Sea Bass to Peking Duck and Lettuce Wrap Chicken. } mandarinhousesandysprings.com. ★★

LE BILBOQUET 3035 Peachtree Road, Ste. A180, Atl. 404/869-9944. Simple, classic French cooking brings a slice of Parisian café culture to the neighborhood. p }}} lebilboquetatlanta.com.

CREOLE

MCKINNON’S LOUISIANE RESTAURANT 3209 Maple Dr., Atl. 404/237-1313. Louisiana seafood dishes reflect the refined cooking of New Orleans and the pungent dishes of the Cajun Bayou. p }} mckinnons.com.

ECLECTIC

LAST WORD 701 Highland Ave., Ste. 5, Atl. 404/343-1274. Innovative cocktails and chef-driven fare in a communal, relaxed bar setting. Specialties: lamb belly shawarma and hand-rolled couscous with braised beef cheek. p } lastwordatl.com.

FRENCH

BISTRO NIKO 3344 Peachtree Road NW, Atl. 404/261-6456. Regional comfort French cuisine in a casual bistro setting. Specialties 132

www.southernSeasons.net

LA PETITE MAISON 6510 Roswell Road, Sandy Springs. 404/303-6600. Charming French bistro offers everything from filet mignon to grilled salmon. } lapetitemaisonbistro.com. ★★

NIKOLAI’S ROOF 255 Courtland St., Atl. 404/221-6362. Superb cuisine, impeccable service and award-winning wine list, with skyline views from the 30th floor of the Hilton Atlanta. p }}} nikolaisroof.com. ★★★

FUSION

AQUA BLUE 1564 Holcomb Bridge Road, Roswell. 770/643-8886. Global cuisine, from seafood and sushi to steaks and chops, plus signature drinks, in a welcoming environment. p }} aquablueatl.com. ★★ 10 DEGREES SOUTH 4183 Roswell Road, Atl. 404/705-8870. South African restaurant offers a cultural fusion of cuisine, from calamari and lamb chops to sosaties and chicken curry, in lively setting. p }} 10degreessouth.com.

GREEK

KYMA 3085 Piedmont Road, Atl. 404/2620702. Dramatic décor and inventive cuisine,

CIBO E BEVE 4969 Roswell Road, Atl. 404/250-8988. Celebrates the vibrant food, wine and culture of Italy, with the best seasonal produce from local growers. p }} ciboatlanta.com. DAVIO’S NORTHERN ITALIAN STEAKHOUSE 3500 Peachtree Road NE, Atl. 404/844-4810. Simple, regional Italian foods with a focus on the grill, from aged steaks to unique pasta creations and signature veal chop. p }} davios.com. DØUBLE ZERØ NAPOLETANA 5825 Roswell Road, Atl. 404/991-3666. Southern Italian featuring the cuisine of the Campania region of Italy, as well as Neapolitan pizza. p }} doublezeroatl.com. FLOATAWAY CAFE 1123 Zonolite Road, Ste. 15, Atl. 404/892-1414. Fresh seasonal cuisine is created with country French, Mediterranean and Italian influences. p }} starprovisions.com. IL LOCALINO 467 N. Highland Ave., Atl. 404/222-0650. Italian favorites served up in a fun setting, with eclectic decor and warm hospitality. p }} illocalino.com. ★★★★ LA GROTTA 2637 Peachtree Road NE, Atl, 404/231-1368. 4355 Ashford Dunwoody Road, Dunwoody, 770/395-9925. Enjoy a three-course dinner in an intimate place overlooking a beautiful garden. p h }} lagrottaatlanta.com. ★★★★ LA TAVOLA 992 Virginia Ave. NE, Atl. 404/873-5430. Cozy, authentic Italian trattoria serves classics like spaghetti and meatballs and more adventurous dishes. p }} latavolatrattoria.com. MAGGIANO’S LITTLE ITALY 3368

Peachtree Road, Atl., 404/816-9650. 4400 Ashford Dunwoody Road, Dunwoody, 770/8043313. Divine dining in a nostalgic setting reminiscent of pre-World War II Little Italy. p } maggianos.com. MEDICI 2450 Galleria Pkwy. @ Renaissance Waverly Hotel. 770/953-4500. Mediterraneaninspired Tuscan grill with herb-rubbed prime steaks, hand-crafted pastas and market-fresh seafood. p }} mediciatlanta.com. NO. 246 129 E. Ponce de Leon Ave., Decatur. 678/399-8246. Savor ricotta agnolotti, Ramano pizza, charred octopus and other specialties in a 100-seat space with an open kitchen, backyard deck and welcoming neighborhood atmosphere. } no246.com. PORTOFINO 3199 Paces Ferry Place, Atl. 404/231-1136. Neighborhood bistro offers simple pastas and innovative appetizers and entrees with an attentive staff. p }} portofinoatl.com. PRICCI 500 Pharr Road, Atl. 404/2372941. Creative menu, dramatic interior and friendly service. Enjoy wood-fired pizza, tortelli pasta, beef short rib ravioli and roasted Mediterranean sea bass. p h }} buckheadrestaurants.com. ★★★★ SOTTO SOTTO 313 N. Highland Ave. NE, Atl. 404/523-6678. Italian dishes, from Carnaroli rice risotto to a whole roasted fish, served in a cozy setting in a revived brick storefront. p }} urestaurants.com. ST. CECILIA 3455 Peachtree Road NE @ Buckhead’s Pinnacle Building. 404 /554-9995. Dine on divine coastal European food in a sumptuous setting, with small plates, seasonal entrées like Maine sea scallops, and handmade pasta dishes. p }} stceciliaatl.com. SUGO 10305 Medlock Bridge Road, Duluth. 770/817-8000. An inspiring blend of unique family style dishes, from Mediterranean mussels to Greek pizza, served with gracious hospitality. p } sugorestaurant.com. ★★★ VALENZA 1441 Dresden Dr., Ste. 160, Atl. 404/969-3233. Cozy, upscale Italian eatery in Brookhaven with a classic menu of antipasti, pasta, risotto and Italian entrees. p }} valenzarestaurant.com. QUICK GUIDE p reservations h dress restrictions } entrees $10-20 }} entrees $20-30 }}} entrees $30+

SOUTHERN SEASONS STARS ★ great ★★ excellent ★★★ superb ★★★★ the best

In the kitchen n UNITED TASTES OF TEXAS, JESSICA DUPUY (OXMOOR HOUSE)

Journey into the Lone Star State with a fourth generation Texan, who explores the state’s five distinct culinary regions – Central, Coastal, East, South and West – with 125 delicious recipes, from Smoked Barbeque Baby Back Ribs and Herbed Beer Bread to Chicken Fried Steak and Bourbon Sweet Potatoes. Among the to-die-for desserts: Orchard Peach Crisp, Pecan Pralines and Apple Cake Cobbler. Filled with mouthwatering photography, each chapter includes a brief history of the region, notes on cooking equipment and stories on local chefs and restaurants. n Enchiladas: aztec to tex-mex, cappy lawton & chris waters dunn (trinity university press)

In Mexico, there’s more than one way to make an enchilada. Explore over 60 traditional and modern recipes in this beautifully illustrated cookbook, as well as 40 recipes for accompanying salsas, sauces, salads and sides. Cappy Lawton, owner of one of the country’s oldest Mexican restaurants in San Antonio, Texas, shares entertaining anecdotes and expert cooking advice on creating authentic enchiladas, including making corn tortillas from scratch, fire-roasting fresh chiles, whipping up homemade queso fresco and crema Mexicana, and cooking Mexican rice – six ways. n FAST TO THE TABLE FREEZER COOKBOOK, Becky Rosenthal (Countryman Press)

A freezer can do more than store bags of peas and half-eaten pints of Häagen-Dazs. Becky Rosenthal offers tips and tricks for satisfying meals with strategically frozen ingredients – avoiding food waste, speeding up dinner prep and saving money. Beyond freezer meals, it includes components like sauces, stocks and cooked meat that can be used to make fresh, flavorful dishes in a snap. Learn how to freeze fruits and veggies from the farmer’s market. For a real shortcut, buy frozen ingredients for recipes like Peach Prosciutto Pizza, Chicken Potpie and Peach-Blueberry Cobbler. Southern Seasons Magazine

| 133

JAPANESE

MO MO YA 3861 Roswell Road, Atl. 404/261-3777. Sushi, sashimi and tempura served in a traditional dining room with hibachi cooking at the table. The outdoor courtyard features meticulous Japanese gardens. } momoyaga.com. NAKATO 1776 Cheshire Bridge Road NE, Atl. 404/873-6582. Gracious servers dressed in kimonos pamper diners with delicious authentic Japanese cuisine in an aura of the grandeur of traditional Japan. p }} nakatorestaurant.com. ★★★★ SUSHI-HUKU 6300 Powers Ferry Road NW, Atl. 770/956-9559. Fresh, authentic sushi that’s creatively presented and highly praised, with attentive service, intimate seating and relaxed atmosphere. } sushihuku.com. UMI 3050 Peachtree Road NW, Atl. 404/841-0040. Modern Japanese flavors in a sophisticated, contemporary setting.

Chef Fuyuhiko Ito’s menu showcases the freshest fish from the world’s finest markets; diverse beverages include exclusive craft sake, handmade cocktails and artisan roasted coffee. p }} umiatlanta.com.

MEDITERRANEAN

ECCO 40 7th St., Atl. 404/347-9555. A bold approach to seasonal European cuisine, from paninis, pastas and pizza to fig-glazed lamb loin, served in a warm, welcoming setting, with award-winning Old World and New World wine lists and hand-crafted cocktails. p }} ecco-atlanta.com. ★★★

MEXICAN

NUEVO LAREDO CANTINA 1495 Chattahoochee Ave., Atl. 404/352-9009. Fresh Mexican fare, including chicken mole, pork tender briskets, lobster tacos and enchiladas, served by an attentive staff in a fun, casual environment. p } nuevolaredocantina.com.

MOROCCAN

IMPERIAL FEZ MOROCCAN 2285 Peachtree Road, Atl. 404/351-0870. An oasis of good food and entertainment with traditional cuisine including fresh legumes, meats and fish. p }}} imperialfez.com.

NEW ORLEANS

A taste of success Steve DiFillippo was only 24 when he opened his first Davio’s restaurant. Since then, he has wowed Julia Child with his pomodoro, taken on American Express, gotten himself into Time and Newsweek (for taking on American Express), cooked a rabbit for Stevie Ray Vaughn, whipped up some tasty eats at the Super Bowl...and created a $50 million restaurant brand group. Frequently asked how he did it, DiFillippo penned “It’s All About the Guest,” the ultimate guide to starting a restaurant, running a successful business, enjoying food and living life – with 12 signature recipes thrown in for good measure.

134

www.southernSeasons.net

American seafood flown in fresh daily. p }}} atlanticseafoodco.com. C&S SEAFOOD AND OYSTER BAR 3240 Cobb Pkwy., Atl. 770/272-0999. Fresh seafood, a well-stocked raw bar and classic prime steaks in an elegant setting, with classic cocktails. p }} candsoysterbar.com. LURE 1106 Crescent Ave. NE, Atl. 404/8811106. Contemporary fish house serving only the freshest ingredients delivered daily, from smoked seafood platter to fried oyster slider. p }} lure-atlanta.com. RAY’S IN THE CITY 240 Peachtree St., Atl. 404/524-9224. Enjoy a selection of the freshest seafood, made-to-order sushi and hand-cut steaks, in a casual yet elegant setting. p }} raysrestaurants.com. RAY’S ON THE RIVER 6700 Powers Ferry Road, Atl. 770/955-1187. A palatepleasing menu of fresh seafood and fine cut steaks, an award-winning wine list and a romantic view of the Chattahoochee assure a delightful dining experience. p h }} raysrestaurants.com. ★★★ THE OCEANAIRE SEAFOOD ROOM 1100 Peachtree St. NE, Atl. 404/475-2277. Feast on fresh seafood, flown in daily, in a setting as sleek as a 1930s ocean liner. p }}} theoceanaire.com.

PARISH: FOODS & GOODS 240 North Highland Ave., Atl. 404/681-4434. New Orleans-inspired, bi-level restaurant and market in the beautifully restored 1890s Atlanta Pipe and Foundry Company terminal building. p } parishatl.com.

THE OPTIMIST 914 Howell Mill Road, Atl. 404/477-6260. Upscale seafood with playful flavor combinations served in a beautiful space, with an experienced staff, wellrounded wine list and upbeat vibe. p }} theoptimistrestaurant.com.

PERSIAN

SOUTH AFRICAN

RUMI’S KITCHEN 6152 Roswell Road, Atl. 404/477-2100. Fresh Persian dishes, from kabobs and dolmeh to fresh-baked flat bread, served in an intimate dining room with attentive hospitality. } rumisrestaurant.com.

SEAFOOD

ATLANTA FISH MARKET 265 Pharr Road, Atl. 404/262-3165. Southeast’s largest selection of fresh seafood offered in a neighborhood setting. Specialties include Hong Kong sea bass, cashew crusted swordfish and blackened mahi mahi. p h }} buckheadrestaurants.com. ★★★★ ATLANTIC SEAFOOD COMPANY 2345 Mansell Road, Alpharetta. 770/640-0488. Contemporary atmosphere showcases modern

CAPE DUTCH 1782 Cheshire Bridge NE, Atl. 404/343-0313. Globally-inspired dishes highlight braai (African barbecue) techniques, from wood-grilled steaks to seafood, in a sophisticated setting. p }} capedutchrestaurant.com.

SOUTHWESTERN

ALMA COCINA 191 Peachtree St. NE, Atl. 404/968-9662. Dine on green chorizo tostadas, bay scallop ceviche and braised goat huaraches in a spirited venue. p } alma-atlanta.com. RAY’S RIO BRAVO 6450 Powers Ferry Road, Atl. 770/612-2829. Fresh Tex-Mex cuisine, from Chili Con Queso to Grilled & Sizzling Fajitas, is served in a fun and festive setting. p } raysriobravo.com.

SPANISH

COOKS & SOLDIERS 691 14th St. NW, Atl. 404/996-2623. Enjoy pintxos and wood-grilled meats and seafood inspired by the Basque region, as well as a wine, cider and cocktail program, in a vibrant, contemporary space. p }} cooksandsoldiers.com.

STEAKHOUSES

BLT STEAK 45 Ivan Allen Jr. Blvd. @ W Atlanta-Downtown. 404/577-7601. Chef Laurent Tourondel’s Bistro Laurent Tourondel combines traditional elements of a cozy French bistro with an American steakhouse. p }}} bltrestaurants.com. BONE’S 3130 Piedmont Road, Atl. 404/2372663. Award-winning menu features prime steaks, Maine lobster, lamb chops and fresh seafood complemented by an extensive wine cellar and discerning service. p }}} bonesrestaurant.com. ★★★★ CABERNET STEAKHOUSE 5575 Windward Pkwy., Alpharetta. 770/777-5955. Reminiscent of the classic steakhouses of New York, with a large open dining room, plush seating and exposed kitchen. p h }}} cabernetsteakhouse.com. ★★★ CHOPS/LOBSTER BAR 70 West Paces Ferry Road, Atl. 404/262-2675. Prime steak and seafood, including filet mignon, batterfried lobster tail and lump crab cake, are served on the upper level Chops steakhouse and lower-level Lobster Bar. p h }}} buckheadrestaurants.com. ★★★★ HAL’S 30 Old Ivy Road, Atl. 404/261-0025. Award-winning steak prepared over an open flame grill, plus fresh seafood, pasta, veal, lamb and fish, served in an expansive bistro-style venue with charming white tablecloth setting. p }} hals.net. ★★★ KEVIN RATHBUN STEAK 154 Krog St., Ste. 200, Atl. 404/524-5600. Enjoy USDA prime steaks, a mixture of Italian, Creole and Asian items, and fish, soups, salads and sashimi, as well as a list of 200 wines. p }} kevinrathbun.com. ★★★★ MCKENDRICK’S STEAK HOUSE 4505 Ashford Dunwoody Road, Atl. 770/512-8888. Feast on fabulous appetizers, enormous steaks, tender chops and succulent seafood in a clubby setting with oak walls and leather seats. p }} mckendricks.com. ★★★★ MORTON’S THE STEAKHOUSE 303 Peachtree Center Ave., Atl., 404/577-4366. Generous portions of USDA prime aged beef,

Oak Steakhouse as well as fresh fish, lobster and chicken entrees served in an upscale environment with tuxedoclad waiters. p }}} mortons.com. NEW YORK PRIME 3424 Peachtree Road, Atl. 404/846-0644. Dine on Midwestern USDA prime beef, live Maine lobsters or fresh fish, with classic sides ranging from creamed spinach to cheese mashed potatoes. p h }}} newyorkprime.com. ★★★ OAK STEAKHOUSE 950 Third St., Alpharetta. 678/722-8333. A fresh take on the classic steakhouse with inspired dishes served in a modern environment. p }}} oaksteakhouseatlanta.com. RAY’S ON THE CREEK 1700 Mansell Road, Alpharetta. 770/649-0064. North Fulton’s award-winning steakhouse delivers with prime steaks, fresh seafood and fine wines. p h }}} raysrestaurants.com. RUTH’S CHRIS STEAKHOUSE 11655 Haynes Bridge Road, Alpharetta, 770/777-1500. 267 Marietta St. @ Embassy Suites Centennial Park, 404/223-6500. 3285 Peachtree Road NE @ Embassy Suites Buckhead, 404/365-0660. Revered by steak connoisseurs for its USDA prime, aged Midwestern cornfed beef, Northwestern salmon and live Maine Lobster. p }} ruthschris.com. ★★ STONEY RIVER 10524 Alpharetta Hwy., Roswell, 678/461-7900. 5800 State Bridge Road, Duluth, 770/476-0102. 1640 Cumberland Mall, 678/305-9229. Enjoy

premium steaks in an inviting mountain lodge setting. p }} stoneyriver.com. ★★★ THE PALM 3391 Peachtree Road @ Westin Buckhead Hotel. 404/814-1955. Prime cuts of beef and jumbo lobsters are served in a casual setting, with a caricature gallery of famous faces. p }}} thepalm.com. ★★★

THAI

HUNAN GOURMET 6070 Sandy Springs Circle NE, Atl. 404/303-8888. Authentic cuisine in a relaxing setting. p } ★★ NAN THAI FINE DINING 1350 Spring St. NW, Atl. 404/870-9933. Rich, tasty Thai and Thai fusion dishes with an artistic flair, reminiscent of the grand style of the ’40s and ’50s. p h }}} nanfinedining.com. ★★ RICE THAI CUISINE 1104 Canton St., Roswell. 770/640-0788. Authentic street-style Thai. p } ricethairoswell.com. TAMARIND SEED 1197 Peachtree St. NE, Atl. 404/873-4888. Authentic Thai, from roasted duck breast to braised lamb tenderloin, in an upscale setting. p }}} tamarindseed.com. QUICK GUIDE p reservations h dress restrictions } entrees $10-20 }} entrees $20-30 }}} entrees $30+

SOUTHERN SEASONS STARS ★ great ★★ excellent ★★★ superb ★★★★ the best

Southern Seasons Magazine

| 135

Purple Reign by gail o’neill

RememberIng

ans who attended two soldout shows for Prince’s Piano & A Microphone tour at the Fox Theatre on April 14 had no way of knowing it at the time, but they would be the last to see the prolific writer/singer/producer (who played over 20 instruments) perform in concert. But when word of his passing was confirmed one week later, the response was swift. Allan C. Vella, president and CEO of the Fox, released a statement calling the 57-yearold “a music pioneer, innovator and cultural icon,” before concluding, “We, along with the world, mourn the loss of a music legend.” On April 21, city fathers across the country, including Atlanta’s Mayor Kasim Reed, honored Prince by having municipal buildings, bridges and stadiums bathed in purple light. The Broadway casts of The Color Purple and Hamilton paid homage to their fallen hero during curtain calls in New York City. NASA paid its respects by tweeting an image of a purple nebula. And Saturday Night Live announced that a one-hour tribute titled “Goodnight, Sweet Prince,” would air two days later. In classic Madison Avenue fashion, Chevrolet managed to sum up in eight words what the world was struggling to express by tweeting a picture of a 1963 red Corvette with a caption that read: “Baby, that was much too fast.” 1958 - 2016. Like all shooting stars, Prince’s arc through our galaxy was much too fast. But as anyone lucky enough to have lived, loved and partied during His Majesty’s Purple Reign can tell you… it was one hell of a ride!

136

Prince

www.southernSeasons.net

2016 KIA

OPTIMA LX

189

PER MO 36 MOS.*

1999 DOWN INCLUDES 3 YEAR MAINTENANCE

770-423-4404 1221 Auto Park Drive, Kennesaw, GA 30144

cobbcountykia.com

1 Your

VOLUME KIA DEALER

IN GEORGIA

BASED ON KIA MOTORS OF AMERICA 2010-2012 ANNUAL SALES RANKINGS.

Closed-end lease based on new 2016 Optima (Model #53222) subject to credit approval, dealer participation, and vehicle availability. Offer shown based on $1,999 due at lease signing including $199 first monthly payment, $1,205 capitalized cost reduction, $595 acquisition fee, plus tax, title, license and registration fees, dealer conveyance fee, processing fee or optional service fee and any emission testing charge. No security deposit required. Offer shown total lease payments are $8,964. Actual payments may vary. Purchase option at lease-end for offer shown of residual value of $13,247.20. Lessee is responsible for insurance, maintenance, repairs, $.20 per mile over 12,000 miles/year, excess wear, and a $400 termination fee*. Lease offer applies to Optima (MSRP $22,840, includes freight, and excludes taxes, title, license, additional options and retailer charges). Actual prices set by dealer. Must take delivery from retail stock by 5/2/2016. Dealer contribution may vary and could affect actual lease payment. See dealer for warranty and lease details or go to kia.com.

LUXURYREDEFINED .COM

404.671.4195

Berkshire Hathaway Homeservices Georgia Properties

©2016 An independently operated subsidiary of HomeServices of America, Inc., a Berkshire Hathaway affiliate, and a franchisee of BHH Affiliates, LLC. Berkshire Hathaway HomeServices and the Berkshire Hathaway HomeServices symbol are registered service marks of HomeServices of America, Inc.® Equal Housing Opportunity. www.BHHSGOERGIA.COM. APRIL 2016.