

Students are riding high
Truganina South Primary School students got on their bikes for Ride2School Day last week.
Students were encouraged to travel to school by riding, scooting or walking in the name of promoting healthier lifestyles, easing traffic congestion and reducing carbon emissions.
The event, which has run at the school for seven years, was held on March 21 and also included a ‘decorate your bike’ competition.
Werribee Men’s Shed volunteers visited the school to conduct basic bike maintenance.
Truganina South vice principal Cass Beckman said the day was a huge success.
“The most rewarding part of the event was seeing the smiles on children’s faces travelling to school with their family and friends,” she said.
“Lots of families spoke about actively travelling to school more often.”
Crime surges in Wyndham
By Laura Michell
Crime in Wyndham has reached a 10-year high, latest crime data has revealed.
DatafromtheCrimeStatisticsAgency(CSA) revealed that 23,045 offences were recorded in Wyndham during 2024 – an increase of 23.7 per cent from the 18,628 offences recorded in the previous 12 months.
The total number of offences recorded in the municipality was the highest in the north-west metropolitan region and the fourth highest in the state behind the City of Melbourne (42, 742 offences), Casey (27,285) and Geelong (25,086).
CSA first began recording the state’s crime data in 2015. Its data shows that the number of
offences recorded in Wyndham has increased dramatically, with 14,303 offences recorded in 2015. However the rate of offences per 100,000 people has increased at a much slower rate, rising from 6689 in 2015 to 6847 in 2024.
Victoria Police Regional Operations
Deputy Commissioner Bob Hill described the overall crime rates in Victoria as “totally unacceptable”.
“The sad reality is that more crime equates to more victims involving members of community, who in some cases, will be impacted for life,” he said.
Stealing from a motor vehicle was the most common crime in Wyndham in 2024, with 3622 offences recorded. This was an 83.3 per cent increase from 2023 when 1976 offences



were recorded, Police said stealing from a motorvehiclewasalsothemostcommon–and fastest growing – crime across the state, driven by theft of number plates and power tools.
‘Other theft’ offences (taking in theft of petrol or personal belonging when the owner putsthemdown)wasthesecondmostcommon offence recorded in Wyndham (2644 offences), followed by breaches of family violence orders (1955) and criminal damage (1745).
Motor vehicle thefts rounded out the top five offence categories in Wyndham. There were 1398 offences recorded in 2024, up from 890 in the previous 12 months.
Policesaidthatacrossthestate,motorvehicle theft had reached its highest level since 2022.
Mr Hill said technology was playing a part
in the rising number of vehicle thefts, with offenders using electronic devices to exploit vehicle security systems and steal cars.
“Victoria Police continues to engage vehicle manufacturers around this issue, while vehicle owners can protect themselves from falling victim by installing cheap and easy crime prevention measures.”
According to CSA, the highest number of offences were recorded in Werribee (5911), followed by Tarneit (3801).
Offenders aged 18-24 were the most likely to commit crime in Wyndham, accounting for 1112 offences, followed by those aged 30-34 (1038). There were 957 youth offenders aged 10-17 – down slightly from 964 offenders in 2023.


Truganina South Primary students Katie and Kiyan got on their bikes for Ride2School (Damjan Janevski) 464907_02
Your Questions Answered
HOW DO I DO THIS?
Show your items to our expert buyers. After we have calculated the price based on its resale value, you can then decide to sell them to us or just walk away with a free assessment of your jewellery! WHY SELL?
Is it worth keeping old jewellery that you will never wear again? The extra cash may help now or in the future rather than unwanted jewellery sitting in your drawer!

“Your Jewellery maybe worth a lot more than what you think!”
Ison Road major works to start
Major works are underway to build the Ison Road Extension in Werribee, which will help provideavitalnewlinktothePrincesFreeway.
Crews have begun earthworks for the extension, which will connect with the Ison Road Overpass to form the link to the freeway.
The extension project will build a 1.3-kilometre, four-lane road between the overpass and Geelong Road at the Werribee Main Road-Princes Freeway interchange.
Major Road Projects Victoria (MRPV) said the link will help enhance connectivity, improve safety and reduce congestion, particularly in central Werribee.
With the overpass also under construction, drivers will be able to use the link by the end of 2026.
Thelinkwillalsoincludewalkingandcycling paths along the overpass and the extension to Geelong Road, boosting local active transport opportunities.
MRPV program director Tim Price said crews were excited to start major works on the Ison Road Extension.
“This project will deliver real benefits by improving safety and creating better connectionsforlocalresidentsandbusinesses,” he said.
MRPV and construction partner Decmil willbuildtheextensiononbehalfofWyndham council.
The $80 million extension project is jointly
funded by the state government and council, with $60 million from the government’s Growth Area Infrastructure Contribution (GAIC) fund.
Mayor Mia Shaw said the transport link will improve access to jobs, schools and essential services.
“The Ison Road Extension will be a vital investment in Wyndham’s future to improve connections for our rapidly growing communityandhelpeasecongestionincentral Werribee,” she said.
To build on the benefits of the new link, the state and federal governments recently announced joint funding for the Werribee Main Road – Princes Freeway Interchange

Rotary takes a swing for Reclink
Werribee Rotary hit a hole-in-one for charity
Reclink at its annual golf day.
In its 38th year, the club made a day of it at the Werribee Park Golf Course on Friday, March 21, to raise money for charity that is worth getting behind.
Reclink’seffortstohelpgetelderlymembers of thecommunity out and socialising through physical activity was lauded by Werribee Rotary president Robert Fava.
“We found the organisation has struck a resonance with our members, this time they identified a need within Wyndham for assistingisolatedmembersofthecommunity,” he said.
Mr Fava said the golf action may happen in one day, but it can take months of preparation to have everything teed up for the fundraiser, and it takes a community effort to coordinate.
“The whole thing is supported 100 per cent
by nothing but the local community and organisations,” Mr Fava said.
Friday’s golf day included a lunch attended bymorethan150people,andaseriesofraffles, announcements, giveaways.
The annual event has raised money for causes such as youth sporting and cancer research in the past.
Jaidyn Kennedy
Upgrade.
This project will build an improved Geelong-bound exit ramp and city-bound entry ramp, a new lane to the Werribee Main Road bridge and add traffic lights at key intersections.
These improvements are expected to cut peak travel times by over 10 minutes, increase capacity,andreducebottlenecksanddangerous queuing in peak periods, making it safer and easier for the 10,000 motorists who use the interchange daily.
Planning work is continuing on the interchange upgrade. Construction timelines will be known once planning has progressed further.
Number plate theft hot spot
Wyndham is among the Victorian municipalities hardest hit by number plate thefts.
According to the latest crime data, in Wyndham 1121 number plate theft reports were made to police in the 12 months to September 2024 – placing it in fourth position behind Casey (1987), Hume (1408) and Greater Dandenong (1374). Brimbank rounded out the top five with 1110 reports.
Only 22 per cent of stolen registration plates are recovered, according to police. Police said they regularly see offenders using stolen plates to commit further offences, including burglaries, petrol drive offs, drive-by shootings, arson and even homicides.
Tohelpreducethelikelihoodofhaving number plates stolen, residents are encouraged to place their cars in garages where possible, and to use anti-theft screws.
According to police, these can be purchased from hardware stores, automotive parts stores and petrol stations for just a few dollars.
The screws are an easy way to deter thieves — they are really difficult to remove in a hurry and while they can be removed with brute force, it often damages the plate and renders it unusable.
Commander Inspector Stu Richards said “Having to replace your plates is not only an inconvenience, it’s also costly. That’s why we encourage vehicle owners touseanti-theftscrewstodeterthievesin the first instance.”
Upcoming weekend West Gate Freeway closures
Plan ahead for upcoming weekend lane and ramp closures on the West Gate Freeway outbound, from the West Gate Bridge to Williamstown Road in March and April. Major delays expected - check before you travel and avoid the West Gate Bridge if possible.
Reclink chief executive Dave Wells and Werribee Rotary president Robert Fava and president-elect Lyn Fava. (Damjan Janevski) 59196_01
Outbound to Williamstown Road
Footage released of dumping
Images and footage has been released of two menillegallydumpingwasteontheFederation Trail in Laverton North earlier this year.
The men were captured on CCTV dumping a load of what appears to be household construction waste along the public walking and cycle path on January 24.
The men drove along the Federation Trail in an Isuzu Tradepack tray truck using fake number plates, before getting out and dumping the entire load on the nature reserve.
Environmental Protection Authority
Victoria (EPA) chief executive Lee Miezis said he hoped releasing the CCTV footage and images would help them track down the offenders.
“If you recognise either of these men, or the truck, we would love to hear from you, anonymously if you wish,” said Mr Miezis

who believes the offenders’ actions were pre-meditated and deliberate.
“The debris was cleaned up quickly by the
manager of the trail, but the fact that fake plates were used on the Isuzu heavily suggests thiswasn’taspurofthemomenttransgression

‘World-class’ elephant trail opens
Werribee Open Range Zoo’s new elephant trail has opened just in time for the school holidays.
Premier Jacinta Allan and Environment Minister Steve Dimopoulos officially opened the 21-hectare elephant trail on Sunday, March 23.
The trail is a habitat for the nine Asian elephantsthatmadethetrektoWerribeefrom Melbourne Zoo.
The elephants have spent the past few weeks settling into their new home after making the move to the west, but now they’re ready to welcome visitors.
“The beautiful new elephant trail makes the
Werribee Open Range Zoo even better, and it’s open just in time for kids to visit free these school holidays,” Ms Allan said.
The new habitat is the size of the entire Melbourne Zoo, giving the herd plenty of room to roam, and includes two mega pools to keep the elephants cool.
The pools are connected to the Werribee Recycled Water Plant by a 2.5-kilometre pipeline that delivers 150 million litres of recycled water to the habitat.
Awalkingtrailconnectstheelephant’sopen space,barns,megapoolsandacafe,soevenin their spacious new environment, families can still see the animals up close.
“Kids, parents and animal lovers alike will go wild for this new experience and will travelfromallovertoseeourincredibleAsian Elephant family in their world-class habitat,” Mr Dimopoulos said.
The state government contributed $88 million investment towards the project and new habitat. Zoos Victoria chief executive Dr Jenny Gray said the migration to Werribee had been years in the making.
Childrenunder16havefreeentrytoallfour of Victoria’s zoos during the school holidays under the state government’s Kids Go Free program.
Details: zoo.org.au/werribee
and the culprits had given real thought about proceeding with a criminal activity,” he said, adding that the Isuzu had unregistered Tasmanian number plates that had either been stolen or forged.
Illegal waste dumping is considered a growing problem as more people try to avoid the cost of legally disposing of waste.
According to the EPA, reports of illegally disposed waste have risen from eight a day in 2023 to 11 a day so far in 2025.
Footage of the incident is available at: https://youtu.be/5Gx_tFdem9A
Anyone who recognises the men or the truck in the footage or images is urged to call EPA Victoria 1300 372 842.
Anyone who witnesses illegal waste dumping can report it to the EPA by calling the same number or via the Snap, Send Solve website: https://www.snapsendsolve.com/
Station name is West Tarneit
West Tarneit has been unveiled as the chosen name for Tarneit’s second station.
The name was chosen following hundredsofpeoplesubmittingfeedback on five proposed names, with locals showing a strong preference for a place-basedandeasilyidentifiablename, according to the state government.
West Tarneit station, which is scheduled to open to passengers next year, will include a pedestrian underpass, 400 car parks and a four-bay bus interchange.
The surrounding precinct will feature a landscaped area equipped with seating, separated walking and cycling pathways, bike storage and bike hoops.
Located near the corner of Davis and Leakes roads, the state government said the new station will ease pressure on nearby Tarneit Station, which services almost two million passengers a year in one of Melbourne’s fastest-growing suburbs.
The naming announcement comes as crews wrapped up early site investigations of the new station, ahead of construction kicking off later this year.
There are more than 700 scheduled services on the Geelong Line which pass through Tarneit and Wyndham Vale, the stations Tarneit West sits between.
Tarneit MP Dylan Wight said the new station will make it easier for the growing community to catch public transport.
Five charged following investigation into drug trafficking
A Williams Landing man and a Point Cook man have been charged following in relation to drug trafficking.
Police seized commercial quantities of Cocaine, various other drugs of dependence and a hydraulic press following a 14-month investigation in drug trafficking in Melbourne.
On Thursday, October 31 a 41-year-old Williams Landing man was intercepted by the VIPER Taskforce after he was observed in what will be alleged was a drug trafficking deal.
A search of his vehicle located quantities of cocaine and ketamine.
The man also allegedly told police he had cocaine in his underwear.
Consequently, seven search warrants were executed at residential addresses in Williams Landing, Malvern East, Airport West, Laverton, Reservoir and a business address in Truganina.
Cocaine, MDMA and cash were allegedly seized from one Williams Landing address and approximately $60,000 was seized from the Truganina premises.
Zip lock bags of various drugs of dependence, a revolver and a hydraulic press were located inside the Laverton address.
The 41-year-old Williams Landing man was charged with traffick cocaine, traffick MDMA, possess proceeds of crime and possess psychedelic.
He was bailed to appear at Melbourne
Magistrates’ Court on April 30.
On Tuesday, March 18 detectives from the Major Drug Squad arrested a 35-year-old MalvernEastmananda29-year-oldReservoir man.
The Malvern man was charged with traffickinglargecommercialquantitycocaine, traffick cocaine, possess cocaine and commit schedule 1 offence whilst on bail.
The Reservoir man was charged with traffickinglargecommercialquantitycocaine, traffick cocaine, possess cocaine and possess cannabis.
The Reservoir man was bailed, while the Malvern East man was remanded.
A 41-year-old Williams Landing man self-presented to police later than morning.
He was charged with traffick large commercial quantity cocaine and traffick methylamphetamine. He was bailed.
A 47-year-old Williams Landing man in his company at the time was arrested in relation to allegations of drug trafficking. He was released pending further inquiries.
On Wednesday, March 19 a 42-year-old Point Cook man was arrested at an address in Laverton.
He was charged with possess and traffick methylamphetamine and bailed to appear at court at a later date.
Anyone with with details can contact Crime Stoppers on 1800 333 000 or www. crimestoppersvic.com.au
The new crew at the Werribee Open Range Zoo taking a dip. (Supplied).
A man captured on CCTV illegally dumping waste on the Federation Trail in Laverton North on January 24. (EPA)
Pavilion upgrade ‘game-changer’
Werribee’s Galvin Park Sexton Pavilion has levelled up in a massive expansion.
Construction of the $6.1 million cricket, netball and football pavilion upgrade is now complete, featuring a second storey extension with a social room, committee room, kitchenette, timekeeper area and office.
Other improvements include four new change rooms that will be accessible for all participants, new umpire rooms, first-aid roomandstorage.Allgasapplianceshavebeen replaced with electric and more than 60 solar panels have been added to the pavilion.
Wyndham mayor Mia Shaw said the expansion was a game-changer for the clubs who call Galvin Park home.
“These modern facilities will enhance the experience for players, officials, and spectators alike, while also supporting the continued growth of grassroots sports in Wyndham,”
Cr Shaw said. “The expansion of the Sexton Pavilion also complements upgrades to the Galvin Park soccer and tennis pavilions undertaken in recent years.”
The state government provided $2 million for the upgrade from its Growing Suburbs

Fund and $1 million from its Local Sports Infrastructure Fund. The federal government provided $500,000.
Lalor MP Joanne Ryan said “As a local who lives just a few drop punts away from Galvin Park and a long-term supporter of the club, I know how much these facilities will be valued and utilised by the Werribee Centrals community”.
“This facility is more than just a sports hub – it’s a space that brings people together and strengthens the bonds within our community. With the redevelopment now complete, we


Airshow flies in for thrills in the sky
The southern hemisphere’s premier airshow and aerospace and defence expo is ready for takeoff.
The biannual Avalon Australian International Airshow returns to Geelong this week,showcasingmilitaryandcivilianaircraft, aerobatic displays and the newest innovations in aviation technology.
With three-and-a-half trade days and three days of public displays, the airshow will transform Avalon into an aviation Mecca from Tuesday March 25 to Sunday March 30.
are building Wyndham’s future, one that is inclusive, vibrant, and supportive of local clubs and residents alike.”
The Werribee Centrals Sports and Youth Club also made a contribution to the fit-out. ClubchairmanVincentKeoghsaid“Notonly isthisafacilityforoursportsclub,whichisone of the oldest and biggest in the municipality, with an increasing emphasis on female participation, but it is also a much-needed community facility that will be the home for RecLink and host many other school and sporting groups throughout the year”..
The organisers of a two-day New Year festival at Werribee Mansion have been fined by the Environment Protection Authority (EPA) Victoria.
The Let Them Eat Cake concert organisers have found themselves eating a $9880 slice of humble pie in the form of a fine after failing to comply with an EPA order.
TheWerribeeMansionconcerttook place on December 31 and January 1 and brought in thousands of revellers for the late night party.
The EPA said that part of the organiser’s duties was to manage the event’s noise to minimise impacts to nearby homes, and be able to report to the EPA within 30 days on how they did that.
The EPA followed up on the concerns requiring the organisers to show what they had done to mitigate excessive noise levels and manage complaints.
However, they did not provide the information, failed to meet the deadline and have been fined.
The 2023 edition of the event was a huge success,drawingmorethan80,000membersof the public through the turnstiles from Friday to Saturday, but traffic jams created hours-long waits for some.
In response, the airshow announced it had revamped its transport and parking systems to improve the visitor experience this year, including a park-and-ride shuttle bus option.
Chief executive of organisers AMDA Foundation Justin Giddings said the “sheer scale” of the event meant it couldn’t go ahead without great support from the community.
This year’s attractions include the Friday night flying demonstration Night Alight, performances by the Royal Australian Air Force’s F35A Lightning II and F/A-18F Super Hornet, Matt Hall Racing’s high performance aviation unit and fan favourites the military working dogs.
“We are indebted to the Victorian state government and the City of Greater Geelong for their long-term support of this event, and the teamwork that makes it successful,” Mr Giddings said.
“With exhilarating flying displays, interactive experiences, and the chance to get up close and personal with aircraft on the ground, we look forward to welcoming visitors from across Australia and the world to one of the world’s great airshows.
“We are proud of the Avalon Australian International Airshow, and Geelong should be too.”
“The return of the live music scene in Victoria following Covid has been very successful, but noise is always going to be an issue. We need to know what was being done to reduce noise impacts, which the Cake organisersdidnotproduce,”EPAwest metropolitan regional manager Jeremy Settle said.
“We’ve also put them on notice that we will be giving them even closer scrutiny for 2026”.


Left: The Skycats wing walking display. Top right: F/A-18F Super Hornet in the air. Right: A Hercules aircraft and crowd. (Pictures: Ivan Kemp) 322448
Matt Hewson
IVF, endometriosis help cheaper
By Luke Costin, AAP
A new treatment for a common painful condition and two other drugs will be made cheaper to improve thousands of Australian women’s lives.
About 8500 Australian women are expected to benefit annually when Ryeqo is listed on the pharmaceutical benefits scheme on May 1.
The drug is a new endometriosis treatment option for people who have experienced moderate to severe pain and cannot get adequate relief from other hormonal treatments and painkillers, according to the federal government.
About one in seven Australian women suffer fromendometriosis,wheretissuesimilartothe liningofthewombgrowselsewhereinthebody, affectingfertilityandcausingdebilitatingpain.
Symptoms are variable and contribute to an average delay in diagnosis of six-and-a-half years, according to Endometriosis Australia.
New subsidies will also cut the costs of a progestogen-only contraceptive pill and an IVF hormone therapy.
Women with low levels of specific hormones will be able to access Pergoveris for $32 per treatment cycle from their first IVF cycle, ratherthanhavingtowaitformultiplefailures.
Each unsubsidised cycle costs about $3500. HelanaShehadehusedPergoverisduringher secondIVFcyclein2023,whichresultedinthe birth of baby Zayn.
“Anyone who has been through IVF understands the agony of multiple cycles,” she said. “Earlier access to this fertility treatment will alleviate some of the burden for women undergoing IVF.”
The announcement was welcomed amid Australia’s birth rate falling to a record-low 1.5 babies per woman.
“The cost of assisted reproduction remains a major barrier for many families, particularly

amid the ongoing cost-of-living crisis,” Fertility Society of Australia and New Zealand president Petra Wale said
“Fewer financial and logistical hurdles mean more families can focus on what truly matters - having a baby.”
The listings would improve the quality of life for hundreds of thousands of Australian women, Health Minister Mark Butler said.
“Womenhaveaskedgovernmenttotaketheir health care seriously, and we have listened,” he said. “These listings could save women and their families thousands of dollars across their lifetimes.”
He dismissed criticism about delayed action after a government advisory committee recommended in March 2024 that Ryeqo be added to the subsidy scheme.
“They’ve all been dealt with expeditiously,” Mr Butler told Weekend Today.
“Over the nine years of (the coalition) government, not a single new pill, not a single endometriosis treatment, not a single menopause treatment (was added).”
The opposition said it was not good enough toleavewomenwaitingformorethanayearfor “potentially life-changing medications”.
“Prioritising women’s health remains a top
‘‘ Fewer financial and logistical hurdles mean more families can focus on what truly matters - having a baby ’’ - Petra Wale
priority of the coalition, as we remain strongly committedtoourlongstandingpolicyoflisting allPBAC-recommendedmedicinesonthePBS, and in a timely manner,” opposition health spokeswoman Senator Anne Ruston said. The price of a contraceptive pill used by about 80,000 women will also be slashed. UnderthePBS,theannualcostofSlindawill drop from about $320 to about $94 for general patients or $22 for concession card holders. The absence of estrogen in the pill makes it particularlysuitableforolderwomen,smokers, women at increased risk of blood clots and those who suffer migraine attacks.
Study finds women are reluctant to call triple-0
A new study found that women are less comfortablecallingtriple-0whenexperiencing symptoms of a heart attack, providing a possible reason why women who have heart attacks have a worse outcome than men.
The study by Monash University researchers involved more than 34,000 Australian men and women, questioning whether they would call triple-0 if they suspected they were having a heart attack and their actual use of these services.
Conducted by Monash University honours studentAnnieShiandledbyassociateprofessor and former mobile intensive care paramedic of 25 years Kathryn Eastwood, the study found that while women were more likely to call triple-0ifexperiencingheartattacksymptoms, they were significantly less comfortable to make the call.
In their responses, over a third of women saidtheydidnotwanttoburdentheambulance service compared to a quarter of men.
More women than men said that they wanted to be certain that it was a heart attack before calling, preferring to instead contact their general practitioner.
Women were also more likely to hesitate calling because they believed that they were at low risk of having a heart attack.
Associate professor Eastwood said that for some women – especially older women – the fear of burdening the ambulance system is due to previous medical experience.
“There is plenty within the literature already

Zero and more likely to hesitate when they experience symptoms of a heart attack. (Supplied).
around why women in particular feel like they might be a burden … when you think how some of the older women might have been treatedinmedicalcareinthepast…according to the research, there’s a bit of a sense that they’ve been made to feel silly and that they’ve had a bad experience – ‘there, there, you’ll be
OK, stop being hysterical,’” associate professor Eastwood said.
She said that symptoms of a heart attack in women can often be more subtle than those experienced by men.
“When a lot of research has been done in the past,itisgenerallydoneonmenandthatisjust because they were concerned about causing anyharmtowomenintermsofreproduction... so unfortunately when we’ve all been told what a heart attack is, we’ve been taught the more traditional male symptoms of a heart attack … the central chest pain, sudden onset crushing moving into the left arm, that sort of picture that you’ll see on TV,” she said.
“For women, chest pain can present in their back, not in their chest. It can present in betweentheirshoulderblades…itcanactually come on a little bit more slowly and just be a little bit less debilitating, and the problem with that is when things come on more slowly, you tend to acclimatise to them and tend not to register them.”
Sheclarifiedthatthesesymptomscanalsobe experienced by men.
Associate professor Eastwood said she encourages people to “call first, and decide later” if they are having a heart attack when experiencing symptoms, adding that the symptom of chest pain can include more than just pain in the literal sense.
“[I was] an intensive care paramedic for 25 years, and when we’re talking about pain, we meananyfunnyfeelinginthechest…ifyou’re
asked about pain by a health professional, they’re using that as an umbrella term for anything different. Just report everything and let the health professional decide what’s important and what’s not.”
She said symptoms in women could include feelingsickfordays,havingnoenergy,sleeping on extra pillows because they find it hard to breathe, not being able to walk to the letterbox, back pain, palpitations or sinking feeling in the chest, dizziness, or shortness of breath –including mild shortness of breath.
She said that any cluster of these symptoms together would warrant receiving an electrocardiogram.
“Every minute that they delay, more of their heart can be damaged or even die. And if that happens to enough of the heart, then they will have permanent damage,” she said.
She said calling an ambulance means that paramedics can begin treatment before a person experiencing a heart attack arrives at hospital – helping to prevent the heart attack from advancing – and that the hospital can be notified and prepare for a patient’s arrival, ready to clear a blockage from the heart.
She said people can be proactive with their health by regularly visiting a general practitioner to test blood pressure, cholesterol levels, and have an electrocardiogram to have on file to compare and see what has changed in the case of a cardiac event.
Oscar Parry
Monash University associate professor Kathryn Eastwood led a study that found that women are less comfortable calling Triple
New subsidies will also cut the costs of a progestogen-only contraceptive pill and an IVF hormone therapy.
MY PLACE
Abiola Akinbiyi is a healthcare professional and community advocate who is the founder of Changepreneurs, an organisation that aims to help women of diverse backgrounds reach their full potential. She speaks with Jaidyn Kennedy.
Tell us a little bit about yourself and what you do?
My name is Abiola, but many people call me Abi,amumtotwobeautifulyoungladies.Iam a community advocate and health professional with over 20 years of experience in the health sector, contributing extensively to CALD communities and not-for-profit organisations across Australia. From 2021 to 2023, I had the privilege of serving as a commissioner with the Victorian Multicultural Commission. As a registered nurse, non-executive director, and entrepreneur, my journey has been fuelled by an unwavering passion for improving the healthcare system, community development andsocialjustice.Healthcaremanagementand advocating for multicultural communities, aged care, women, and youth is at the heart of mywork.Iamgratefultohavetheopportunity to serve on many boards where I dedicate and volunteer my time and skills to enhancing healthcare and promoting social cohesion.
What is your connection to Wyndham?
I’ve called Wyndham home for nearly 17 years, raising my two daughters, both of whom attended local schools. I run an event planning business and work in Wyndham, cherishing its vibrant multicultural atmosphere. I’ve collaborated with locals, organisations, and multicultural groups on empowering initiatives and campaigns. I’ve also spoken at manyWyndhameventsthatpromotediversity, equity, and inclusion. Wyndham, for me, reflects my passion for social cohesion.
What about Wyndham do you most like?
My favourite thing about Wyndham is its people – it has a wonderfully multicultural

community that feels like home, unlike many suburbs in Australia. I also love Wyndham’s many parks, open spaces, and walking tracks. Whether exploring a new park or taking a

Social housing boost
Residents of newly built social housing in Melbourne’swestwillsoonreapthebenefitsof their energy-efficient, two and three bedroom homes.
The completion of all 18 social homes was marked at a celebration held on Monday, March 17.
Located at Riverwalk Estate in Werribee, residents will have access to two schools, a town center, sports and recreation facilities, and a community hub.
The site is also conveniently connected to the Werribee shopping precinct, public transport, walking and cycling tracks, and green spaces.
The project is part of the Victorian Government’s initiative to create more high-quality and sustainable housing options for families in need.
The homes are designed to meet Livable Housing Australia Silver Level standards and boast an average 7-Star NatHERS energy
rating to help residents save on energy costs while reducing environmental impact.
Housing Choices CEO David Fisher said it is rewarding to see the excitement and pride in the residents as they now have a safe, affordable, and stable home in a well-planned community, close to essential services, public transport, and job opportunities.
“With families preparing to move into these homes, this milestone marks another important step toward tackling housing insecurity and ensuring more Victorians have a place to call home,“ Mr Fisher said.
Housing Choices Australia will provide both tenancy and property management services, alongside programs to help residents engage with their local community and build strong social connections.
The modern homes were delivered by Housing Choices Australia in partnership withHomesVictoriaandEveryOne,adivision of Metricon Homes, in a 14-week timeframe.
Where are some of your favourite places in Wyndham?
It’s hard to pick just one favourite place in Wyndham,butifIhadto,itwouldbeSanctuary Lakes for its relaxing views of water, greenery, and nature. I also love the vibrancy of Watton Street, the convenience of Pacific Werribee as analternativetoHighpoint,andtheexcitement of Werribee Open Range Zoo. In my opinion, each spot offers something unique and special, making Wyndham a genuinely wonderful place to live and explore.
Can you explain how Changepreneurs came to be?
Changepreneurs is a female-led not-for-profit organisation dedicated to mentoring and empowering African Australian female youth and CALD women to reach their full potential througheducation,training,andnetworking.I starteditasaself-fundedpassionprojecttoguide young women in navigating career pathways and providing leadership opportunities. Now, an incorporated organisation that provides programsandnetworkingeventsforyouthand CALDwomen,ithasbeenarewardingjourney because we’ve had many success stories. What, if anything, would you change about Wyndham.
peaceful walk along rivers or lakes, there’s always a place to connect with nature and enjoythewelcomingatmosphereofthisdiverse suburb.
If I could change anything about Wyndham, the top priority would be improving the public transport system. Currently, commuting just 15 minutes can require both a train and a bus, takinguptoanhourandsometimesevenalong walk. Additionally, I would focus on securing more funding for local schools and enhancing healthcare access for residents to better serve the community’s needs.

I'm passionate about a connected, well serviced, and safe community. I would like to understand what challenges you face using public transport and specifically buses.
Please fill out this survey so I can understand the biggest challenges you face, so that I know what to ask the government in order to improve your bus service.


CEO of Housing Choices Australia David Fisher, Werribee MP John Lister, development manager Housing Choices Australia Michael Mikulic, general manager Sam Gribble BDM and EveryOne Homes (a division of Metricon) representative James Carnell. (Supplied)
Abiola Akinbiyi is the founder of Changepreneurs. (Ljubica Vrankovic) 446661_03

A role model for others
Environmental advocate Anamika Pushilal has been named as Wyndham’s young person of the month for March.
Anamika was named as the ‘One Wyndham’ recipient for the month in recognition of passionate advocacy of climate change and participation in tree planting for Reconciliation Week and National Tree Day.
Anamika also helps out at Love our Street 3030, to keep litter off the streets, parks and natural spaces, and to contribute to creating a sustainable future for our planet.
Previously,partofcouncil’sClimateFutures program, Anamika organised clothing swaps to reduce textile waste, encourage sustainability and highlight that fast fashion is wasteful and contributing to landfill and omissions.
Wyndham mayor Mia Shaw said Anamika was a passionate young role model who contributes meaningfully to the community


through volunteering.
“Wyndham City appreciates Anamika’s commitment to the community that helps make Wyndham a better place,” Cr Shaw said.
Anamika said being named as the One Wyndham recipient for March was exciting and motivating.
“It felt great to have my efforts recognised and I hope that people from similar backgrounds can see me as someone to look up to, just as I had role models growing up. This also inspires me to continue giving back to the community and to encourage other young people to believe in their ability to create positive change.”
OneWyndhamrecipientsareresidentsaged between 12 to 25 who positively contribute to the Wyndham community and are role models to other young people.
Winners are awarded a $300 gift voucher of their choice and other prizes.







The
Briefs
‘Shaun the Sheep’ stumbles A lost sheep was shepherded to safety by emergency services in Mount Cottrell on the night of Sunday, March 23. The ewe fell about two metres down an open manhole at the intersection of Sewells and Leakes roads shortly after 5pm. After her bleats were heard, Wyndham council rounded up the likes of local police, Fire Rescue Victoria and State Emergency Service workers to come up with a rescue plan. Dubbed Shaun by its rescuers, the emergency workers created a make-shift sling and managed to lift her from the pit to safety. It’s not known where ‘Shaun’ came from but she’s now in the hands of the council ranger to return it to her flock.
Cultural festival
Cultural sports, food, dancing, singing and calligraphy from across the globe were on display when St Peter Apostle Primary celebrated its cultural festival on Thursday, March 20. Rain did not dampen a parade that included Mexican flower making, Pisanski Easter egg decorating from Poland, flag-making, beading, henna, rangoli, Burmese Thanaka, cooking demonstrations, chopstick challenges and a lunar new year stall. All students learnt a dance during Earth studies with music inspired from either India, Philippines, Italian, Ethiopian, Poland, Central America or Japan.
FOR BREAKING NEWS, VISIT
Web: starweekly.com.au
Wyndham Star Weekly @starweeklynews @star_weekly






It













Anamika Pushilal is the One Wyndham recipient for March.

Rollercoaster of rarer dementia
Little is known about a form of dementia that affects more than 100,000 Australians but researchers are looking to build knowledge on the debilitating illness as Melissa Meehan explains.
Two years ago, Annette was running a thriving small business and planning her next solo holiday.
Today she’s mostly confined to her aged care facility, unable to go out unchaperoned.
She can no longer trust her legs to keep her upright, relying on a four-wheel walker or sometimes a wheelchair to move around. Her ability to swallow her favourite foods is gone, she cannot control her body temperature or blood pressure.
When she is tired, her body slumps and speech is slow and slurred.
Annette’s memory is pretty good for the most part. She recognises the faces of loved ones and can hold a conversation. But sometimes she talks to people who aren’t there.
She does her hair and puts on make-up every day, but cannot always remember why she’s sick and the reason for her new limitations.
Such is the rollercoaster of a Lewy body dementia diagnosis for Annette, one of 100,000 Australians living with the condition that affects memory, thinking and bodily functions.
For members of Annette’s family, a rollercoaster is the only way to describe it.
Somedayssheseemsreallywell,likeshewas beforeshegotsick.Otherdayssheexperiences hallucinations, cognitive decline, a range of movement issues and other symptoms that make the condition so challenging.
But those good times can change in a moment, and Annette can go from walking and talking to a frail, confused version of herself.
“It (the diagnosis) has been difficult to get my head around, because most days I feel good and I don’t remember the bad days.” she said.
“Sowiththatinmind,Igetreallyfrustrated with the limitations I’m now living with - like not being able to go out on my own, I really value my independence and that feels like it’s been taken away from me.
“But I also understand that I am not well, and it’s a constantly changing beast. It’s a horrible diagnosis and I’m just trying to live my life the best I can, while I can.”
To everyone that knows her, it’s understandable that Annette sometimes feels like a prisoner.
In 2023 she took herself on solo trip to Tasmania and Queensland after closing her local business a year earlier. She played pickleballweekly,caredforhergrandchildren

‘‘ I get really frustrated with the limitations I’m now living with ... I really value my independence and that feels like it’s been taken away from me ’’ - Annette
and was always out and about.
But over the course of 2024 she suffered as many as eight strokes, more than 20 mini-strokes and spent much of the year in hospital. In November she was diagnosed with Lewy body dementia and the symptoms came on thick and fast.
Lying in a hospital bed after another stroke, Annette lost strength in her left side, was unabletomoveherleftlegandspoketopeople who weren’t there.
She could not stay awake long enough to finish a sentence and whatever she said was slow, slurred and nonsensical.
Months later, her neurologist marvelled at her recovery and said he did not expect her to leave the hospital alive.
Lewy bodies are a protein that attack and then eat away at the brain, affecting memory, thinking, behaviour and bodily functions.
The prognosis isn’t great for those who are
diagnosed. Life expectancy is around seven years and many die before the disease takes hold from infection, falls or other illness.
It is not as well known as Alzheimer’s disease but more than 100,000 Australians live with it, according to Dementia Australia.
And while not the same as Parkinson’s disease it shares a number of symptoms including hand tremors, slowness, stiffness and walking problems.
There is no cure and Annette has been prescribed dementia and Parkinson’s drugs to slow her decline and relieve some symptoms.
FloreyInstitutefellowPratishthaChatterjee isamongAustralianneurobiologyresearchers who attended a recent international conference on Lewy body dementia held in Amsterdam.
She is working on blood biomarkers to enable timely diagnosis, prognosis and long-term study of the disease, and says such co-operation and sharing of knowledge matters.
“It underscored the importance of a multidisciplinaryapproachinadvancingLBD research and care, highlighting the need for continued collaboration among clinicians, researchers and stakeholders,” Dr Chatterjee said.
More funding is needed for research into Lewy body dementia, Parkinson’s Australia CEO Olivia Nassaris said.
“Currently, there is no cure for LBD and
Dementia | Explainer
Range of symptoms signal onset of Lewy body dementia
Lewy body dementia is relatively unknown despite more than 100,000 Australians living with the diagnosis that affects both the brain and body. Lewy body dementia is a disease associated with abnormal protein that eats away at the brain and causes issues with thinking, movement, behaviour and mood. There is no cure and little is known about the disease, with no definitive way of making a medical diagnosis until an autopsy is performed, leaving doctors to diagnose sufferers based on medical history, a physical exam and symptoms.
What is lewy body dementia?
• “Lewy body dementias” is an umbrella term describing two forms of dementia: dementia with Lewy bodies and Parkinson’s disease dementia
• Lewy body dementias cause changes in thinking, movement, behaviour and bodily functions
• There is no known cure for the Lewy body dementias yet, but the conditions are manageable and some symptoms can be treated. What causes Lewy body dementia?
• Anyone can develop Lewy body dementia, but it becomes more common as people get older
• More than 100,000 Australians have Lewy body dementia
• Right now, it’s not known why Lewy bodies form
Signs and symptoms of Lewy body dementia
• Changes in thinking, behaviour, movement and bodily functions are symptoms of both types of Lewy body dementia
• Symptoms depend on which brain area is affected and the stage of the dementia. They can change over time
• Many of the changes can come and go, which are called fluctuations. There can be changes to abilities that last a few hours or a few days
• It can also change the way an individual thinks, concentrates and their behaviour
• Some also suffer from hallucinations that can feel very real for the person at the time - it can include loved ones, spiders or snakes
Source: Dementia Australia
Parkinson’s Australia strongly supports investment in research to help us improve our understanding of the condition, to improve treatment and care for people living with LBDandtheirfamiliesandhopefullytofinda cure,” she told AAP.
* AAP journalist Melissa Meehan is Annette’sdaughter.
Lewy body dementia sufferer Annette.
(Melissa Meehan, AAP)
Kaleidoscope Festival returns
Celebrate Wyndham’s cultural diversity at Point Cook Pop-Up Park throughout April.
The celebrations form part of the KaleidoscopeFestival,whichisrunbyCoLocal, developer Stockland and Wyndham council.
The festival is a colourful celebration of unity and diversity and will feature food, performance and culture.
The festival will have a different theme each week.
On Saturday, April 5, attendees can enjoy a Greek Festival from noon-4pm, featuring dance and music performances by Manasis SchoolofGreekDanceandCulture,foodstalls, kids activities and a photobooth.
A Harmony Day celebration organised by
the Wyndham Volunteers Association will be held on Saturday, April 12, from 11am-4pm, showcasing the talent and diversity of the community.
Activate Youth will host an Eid Festival on Sunday, April 13. Running from noon to 3pm, the event will include market and food stalls and cultural entertainment.
On Saturday, April 19, the Easter Bunny will makeanearlyappearanceinPointCookforan Easter-themed festival from noon-3pm.
Junubi Wyndham will host the Africa Festival on Saturday, April 26, from 2-9pm, featuring love performances and food and market stalls.
The Kaleidoscope Festival will wrap up on
Sunday,April27withanAussiebarbecuefrom noon-3pm.
Stockland senior centre manager John Cooper said Kaleidoscope was created by the community. “We’re looking forward to hosting our third Kaleidoscope Festival here at Point Cook Pop Up Park,” he said. “Each year the event brings together thousands of people to celebrate the cultural diversity in the area.
“We encourage the community to come along with their friends and family and enjoy live entertainment, delicious food and market stalls, as well as activities for the kids.”
Point Cook Pop-up Park is at Stockland Point Cook, Murnong Street, Point Cook.
Details: https://tinyurl.com/22d82rtw

Engraving the beauty of the Ranges
Using his engineering background, Riddells Creek artist Grant Medbury creates intricate laser-engraved artworks – with a range of his work currently on display at Art on Piper gallery in Kyneton.
An electronic engineer by profession, Medbury said he enjoys combining his design and technical skills to create the artworks.
“My wife Kathy is an artist … I’m surrounded by art so I’ve just been experimenting and creating a few things and I
thinktheguestroomatArtonPiperjustgives you the opportunity to display what you’ve done,” Medbury said.
He said he enjoys the contrast and the immediate results of laser engraving as a medium.
“[It] must be the engineer in me. Kathy wouldspendweeksonapainting–Icouldn’t.”
The exhibition includes engraved wood, metal, and glass pieces, with all works available for purchase.
ManyareMacedonRanges-themed,suchas a depiction of the Mount Macedon Memorial Cross, local flora and fauna, and a wooden wall hanging with the names of Macedon Ranges towns.
The exhibition is in its final week, with the final day on Sunday, March 30.
Art on Piper is open from 10am–4pm every day at 44 Piper Street, Kyneton.
McVicar takes Cavalcade to comedy festival
Young Williamstown comedian Ned McVicar has been given an opportunity that many seasoned stand-ups would kill for.
McVicar is one of six up and coming young comics from across Australia who’ve been selected to perform at this year’s Melbourne International Comedy Festival (MICF) which starts at the end of this month.
From March 31 to April 6, McVicar will perform his show Cavalcade at the DoubleTree byHiltonaspartofPilot,aprogramdesignedto give Gen Z comedians a leg up in a notoriously competitive industry.
The brainchild of comedians and producers Ethan Gallagher and Dylan McBurney, Pilot cameaboutaftertheybothsawagapinMICF’s youth programs that they wanted to fill. Nowit’sMcVicar,whobeganhisperforming

“I still remember... being really amazed that I could actually come up with a genuine joke,” said McVicar his first steps into comedy.
”It meant a lot to me that I had the ability to come up with stuff like that.”
As for what sort of stuff people can expect in Cavalcade, McVicar wouldn’t give much away.
“As an AI language model I am restricted from sharing harmful information and therefore cannot list the contents of Cavalcade, however I would be happy to help with your recentprompts“howwrite25minutesstandup funny“ and “if you drink enough rat poison it’s notjustratpoisonit’severythingpoison--how do I reword into a joke?”

Stand-up night to bring laughs to Brimbank
From comedy big-wigs to lesser known talents packed with a spotlight-worthy sense of humour, seven comics will put togetheranextraordinaryjest-festatthe upcoming Brimbank Comedy Gala.
OnMarch28,audiencescanexpectto fill their night with laughs, giggles and cheers when local stars and television personalities take to the stage at the Bowery Theatre.
The line-up includes Urvi Majumdar from the ABC, Question Everything’s Suren Jayemanne, and Ben Knight who featured in the hit action flick Fall Guy. According to the show’s co-producer and performer Samuel Gebreselassie, who is putting the show together with Luke Morris, the event is not to be missed.
“It’s a comedy show with some of the best up-and-coming and well-established comedians in Australia,” he said.
The idea to organise an evening of laughter, Gebreselassie said was mmotivatedbyalackofcomedy-centred gigs in the area.
“We decided to bring live comedy to people in the west so they don’t have to travel to the city just to experience that,” he said.
“If you’re looking for a great night of stand up comedy come down and have a laugh with us.
“Laughing together is an amazing experience, so come enjoy comedy in the heart of the west.”
The Brimbank Comedy Gala is planned for March 28 at 8 pm.
Details: events.brimbank.vic.gov.au/ brimbank-comedy-gala/
Prealene

career juggling on the streets of Williamstown, who will get the chance to fill that Gen Z humour gap.
Information and tickets: https://entercloser. com/shows/1145032716679
Cade Lucas
Williamstown comedian Ned McVicar. (Attie Mohebali) 462247_01
Grant Medbury is presenting an exhibition of laser-engraved works at Art on Piper gallery in Kyneton. (Damjan Janevski) 464868_02
Oscar Parry
Samuel Gebreselassie is calling on all Brimbank locals to come down and get a taste of live-comedy. (Damjan Janevski) 466681_01
Khera
Kaleidoscope Festival returns to Point Cook Pop Up Park. (Supplied)


Embark on a global adventure
earned it the nickname ‘The Garden Island’.
For the young at heart who finally have time on their hands to see the world, this is could be the cruise of a lifetime -at the very least one to seriously consider.
The Viking World Voyage III will journey around the world in 170 days, visiting 41 countries with 82 guided tours and overnight stays in 18 cities.
Setting sail on Viking’s award-winning 930-guest ship, the Viking Sky from Fort Lauderdaleon22December,2026,theitinerary will include ports of call across six continents beforeitsdestinationofStockholmon 10June, 2027.
Viking CEO and chairman Torstein Hagen saidthecompany’sapproachineverythingthey do has always been to focus on the destination, from their thoughtfully curated itineraries to their elegant small ships, which are designed to bring guests closer and enable exploration,”
“Extended voyages like our World Cruises allow curious travellers to experience dozens of destinations, iconic landmarks and rich cultures in one seamless journey, making them truly the adventures of a lifetime,” he said.
World Cruise guests can explore ports of call in Hawaii and journey through the isles of the South Pacific, including French Polynesia; traverse New Zealand and Australia; sail to iconicdestinationsthroughoutAsia;andtravel upthewesterncoastofAfricatoEuropebefore concluding in either London or Stockholm.
A shorter, 153-day portion of the sailing,
Viking World Voyage IV, departs from Los Angeles on 8 January, 2027, and visits 37 countries with 18 overnight ports of call before ending in Stockholm.
Guests may also choose the 142-day Viking World Cruise 2026-2027 itinerary from Fort Lauderdale to London visiting 31 countries, or the 125-day voyage, Viking World Discoveries, which departs from Los Angeles and visits 27 countries before ending in London.
The World Cruise itineraries include a visit to dozens of the world’s most iconic cities alongside lesser-known destinations in one continuous journey.
Overnight stays in iconic ports such as Zanzibar, Cape Town, Casablanca and many others allow guests to delve deeper. Viking will also visit Africa’s western coast, including LagosinNigeria,aswellasAccraandTakoradi in Ghana.
While on board, Viking offers cultural enrichment through onboard lectures and entertainment such as the Viking Resident Historianprogram,whichprovidesguestswith a high-level historical and cultural education specific to their journey.
Guestscanimmersethemselvesintheworld’s rich cultures during included excursions that provide unmatched insight into daily life, as well as Privileged Access visits to cultural institutions.
Highlights of the new 2026-2027 Viking World Cruise itineraries include:
• Kauai (Nawiliwili), Hawaii - Nawiliwili is the gateway to the oldest and greenest of the Hawaiian Islands, Kauai. The lush vegetation and wildflowers of this tropical paradise have
To many, this is the most authentic of the islands; town ordinances forbid buildings taller than coconut trees and the culture of ancient Hawaiians lives on in respect for the mana, or spiritual essence, of their land.
• Mombasa, Kenya - Kenya’s chief port and coastal gem, Mombasa, is a melting pot of traditions. Located on a coralline island and linked by a causeway to the African mainland, it boasts a rich tapestry of Middle Eastern and African cultures, having been a key Indian Ocean port since the 14th century.
Agadir, Morocco - Situated on the shores of the Atlantic Ocean, Agadir is the capital of Amazigh culture—the Indigenous peoples of North Africa. Historians believe the Amazigh migrated to Morocco from the Middle East and are descendants of the pre-Arab population. Today, there is a resurgence to promote greater recognition of the Amazigh ethnic identity, with images and music infused in modern culture.
Phuket, Thailand - The Thai island of Phuket offers more than picturesque beaches and sweeping vistas of sparkling azure waters. The island was long a major stop on trade routes between India and China, often mentioned in ship logs of European sailors. Today, old SinoPortuguese shop-houses and monuments to Buddha dot the island.
• Lisbon, Portugal - Lisbon has inspired explorers for centuries with its stunning setting at the Tagus River’s mouth. Its labyrinthine streets carry echoes of 16th-century navigators who sailed on the winds of the Age of Discovery. Savouring local cuisine and port wine are favourite pastimes here. On any evening,
the strains of fado spill from clubs in the historic Alfama District.
London (Greenwich), England - Greenwich, a borough of London, is home to the Royal Observatory. From here, the world’s longitude is measured from the prime meridian, and Greenwich Mean Time sets the global time standard. At the port, the clipper ship Cutty Sark, one of Greenwich’s renowned historic landmarks, is preserved as a fascinating museum. Upriver, London is home to Buckingham Palace, the Houses of Parliament and Westminster Abbey. In addition, this major economic and cultural hub boasts a long tradition of arts and architectural innovation— from Shakespeare’s Globe Theatre to West End musicals.
• Stockholm, Sweden - Elegant Stockholm is nestled where Lake Malaren’s cobalt waters meet the Baltic. This stunning cultural capital extends over 14 islands linked by 57 graceful bridges. Hailed as one of the world’s cleanest cities, it boasts numerous green parks. The well-preserved 13th-century Gamla Stan, or old town, boasts gabled merchant houses and an array of architectural styles, from the enormous baroque Stockholm Palace to the art nouveau Royal Dramatic Theatre.
• Strandvägen is one of Europe’s loveliest waterfront esplanades and the ideal place to sample some traditional smoked salmon.
If this sounds like a journey the perfect journey, visit www.viking.com or call (AU) 138 747.

Lisbon Portugal, enjoy the strains of fado spiling from clubs or enjoy an aperitif on the terrace.
Watch the world go by in perfect comfort from any of the loungers or relaxing settings onboard Viking as you cruise from Fort Lauderdale to Stockholm.
LEE MCCARTHY
Admire Caribbean sunsets
Few cruises tick all the boxes however Viking World Cruises do it brilliantly and whether travellers are seeking adventure, rest and relaxation, sumptuous food and beverages, time out in the spa, a chance to explore unspoilt destinations or all of these, Viking has it covered.
On offer is a magnificent voyage from Antarctica to inland waterways on a 69-day Longitudinal World Cruise VI in 2026 with the option to add pre and post cruise extensions.
Maximize the value of an overseas flight and enjoy additional days to explore the embarkation or disembarkation city or see a new destination altogether with a choice of exciting cities.
(Pre and Post Cruise Extensions vary)
Set sail on 24 February 2026 or 2 March 2027 on this epic journey to explore Antarctica, calling at remote outposts in the South Atlantic.
AdmireCaribbeansunsetsinTheBahamas, traverse the Panama Canal and witness majestic glaciers in Chile.
Enjoy more time to immerse yourself in the unique wildlife of the Galápagos or delve into the fascinating cultures of Peru and Rapa Nui, with optional overland excursions and extension programs that are sure to inspire.
Purpose-built for expeditions, Viking’s state-of-the-art ships provide superior handling, comfort and stability even in the roughest seas. A fleet of military pro zodiacs, Special Operations Boats, two-seater kayaks and two yellow submarines enhance guest’s experience.
Viking Australia and New Zealand Managing Director Michelle Black said the extended ocean voyages provided plenty of reason for travellers wishing to travel The Viking Way.
Longer ocean voyages make travelling for longer periods accessible, offering a relaxing pace and allowing guests time to explore and enjoy the amenities Viking ships have to offer.
“Longer itineraries can vary, but the ones that offer real value generally have fewer port stopsandmoretimeatsea,makingthesetypes of journeys perfect for relaxing or providing the time needed to explore the amenities and activitiesoftheshipbeforereachingtheirnext destination,” she said.
“Many of our guests value the additional time they get on the ship to relax and enjoy themselves, so Viking focuses on onboard cultural enrichment programs,



performances and Nordic wellness within the elegant surroundings of our ship’s serene Scandinavian spaces.”
“Our onboard offering includes a cultural enrichment program hosted by guest lecturers and Viking Resident Historians, Munch Moments and Nordic art collection, musical performances, theatre, cooking classes and sommelier-hosted wine tastings, a library curated by Heywood Hill and seven options for destination-focused dining. Our pools, Nordic spa sanctuary and state-of-the-art fitness centre offer the ultimate in onboard relaxation.”
For the traveller looking for a cruise option,
some ask what value is there in choosing a repositioning cruise ie fares; inclusions; multiple destinations to explore or time to chill and luxuriate?
The answer is this, the cost per day is less, so these itineraries are a more affordable way to experience Viking. Viking All Inclusive offers guests the chance to step on board with nothing more to pay including beer, wine and soft drink with lunch and dinner, with specialtyteas,coffee,andfilteredwateroffered all day. The Nordic spa and fitness centre is free for all guests to use. Wi-Fi, gratuities and all port charges are also included.
Some travellers value the additional

time on the ship to relax so Viking onboard offerings are as important as its destination ports.
Pricing starts from $80,195 per person in a Nordic Balcony with included Business Class airfare and transfers. Plus US$4,000 shore excursion and US$2,000 shipboard credit per couple, free Visa service and Silver Spirits Beverage Package. Up to US$40,000 additional value per couple included. Offer ends 31 March 2025. (conditions apply) Don’t waste time as this offer closes soon, visit www.viking.com or call (AU) 138 747 for further information.
Caminito is one of the most colourful streets in Buenos Aires.
Take in Bartolomé Island, a volcanic islet in the Galápagos Islands group during the 69-day Longitudinal Viking World Cruise VI leaving in 2026.
Visit the much-loved and bucket list location of Machu Picchu, site of ancient Inca ruins in Peru, in the Cordillera de Vilcabamba of the Andes Mountains during the Viking cruise.
LEE MCCARTHY
EXPL RER




& PROVENCE

Amsterdam to Avignon or vice versa
15 DAYS | 4 COUNTRIES | 14 GUIDED TOURS
SET SAIL: JUL-NOV 2025; MAR-NOV 2026; 2027
From $9,595pp in Standard Stateroom
From $12,395pp in Veranda Stateroom
Lyon to Avignon or vice versa
8 DAYS | 1 COUNTRY | 7 GUIDED TOURS SET SAIL: JUN-NOV 2025; MAR-NOV 2026; 2027
From $6,395pp in Standard Stateroom
From $8,195pp in Veranda Stateroom
Amsterdam to Basel or vice versa
8 DAYS | 4 COUNTRIES | 6 GUIDED TOURS SET SAIL: JUN-NOV 2025; MAR-NOV 2026; 2027
From $5,395pp in Standard Stateroom
From $6,595pp in Veranda Stateroom
STRASBOURG, FRANCE
GERMAN DANCERS










The vibrant capital of New South Wales captivates with its iconic landmarks, stunning harbour and cosmopolitan
Your holiday includes
Full-Board Cruise
10 night full-board cruise on board Discovery Princess®
15 Nights | 27 March 2026 | Prices fr $7,799pp
Embark on the ultimate Australian adventure, combining a Princess cruise of the Queensland coast with a three-night, all-inclusive journey on board the Indian Pacific.
Fly to Sydney for a one-night hotel stay before embarking on a 10-night Discovery Princess® cruise, uncovering the coastline of Queensland. Sail to the remote Willis Island, a speck in the coral sea, bask on the beaches of Port Douglas and, in Airlie Beach, explore the beautiful Whitsunday Islands before your ship returns to Sydney.
Here, you’ll disembark to enjoy an additional one-night hotel stay. Then, board the legendary Indian Pacific train for an all-inclusive, three-night transcontinental journey to Perth, traversing Australia’s dramatic landscapes as you savour fine cuisine and explore iconic Outback destinations during Off Train Experiences.
Visiting: Sydney, Willis Island (scenic cruising), Port Douglas, Yorkeys Knob, Airlie Beach, Brisbane, Sydney
Upgrade to Princess Plus from $65pppd, including: MedallionNet® Max Wi-Fi, Crew appreciation, Plus Beverage Package, Unlimited juice bar, Premium desserts, Fitness classes, Two casual dining meals per guest, OceanNow® delivery, Room service delivery
Discovery Princess® incorporates a sleek and sophisticated design with state-of-the-art amenities. With a diverse range of on board activities on offer, Discovery Princess® will captivate you along your journey to the many different destinations to which it sails.
Rail Journey
3 night all-inclusive Gold Service rail journey on board the Indian Pacific from Sydney to Perth with all meals, fine wines, and beverages
Off Train Experiences and short stops in Adelaide, Cook, and Rawlinna
Hotel Stay
2 nights four-star hotel stay in Sydney at the Rydges World Square with breakfast
All Flights, Taxes & Transfers
Sydney, Willis Island (scenic cruising), Port Douglas, Yorkeys Knob, Airlie Beach, Brisbane, Sydney, Adelaide, Nullarbor Plain, Perth
COMMUNITY CALENDAR
WANT YOUR EVENT LISTED? Community Calendar is made available free of charge to not-for-profit organisations to keep the public informed of special events and activities. Send item details to Star Weekly Community Calendar, Corner Thomsons Road and Keilor Park Drive, Keilor Park, 3042, or email to westeditorial@starweekly.com.au by 9am Wednesday the week prior to publication
Kiwi lunch
Come to the Youth Services Centre in Hoppers Crossing on Sunday, March 30 and learn about pathways to dual Australian and New Zealand citizenship over a light Kiwi lunch. Listen to and ask questions of guest speakers from the Department of Home Affairs and the Wyndham Health, Housing and Homelessness Alliance. Starts at 11.40am.
h3@wyndham.vic.gov.au
National seniors meeting
On the first Wednesday of every month at 1.30pm, the metro west branch of national seniors meets at the Deer Park Club, with meals available to purchase. The group also holds lunches on different Fridays each month, as well as activities such as theatre visits, bus trips and more.
0425 713 004, or lesley1.collins@ outlook.com
Laverton Community Choir
Open to new members and everyone is welcome. If you enjoy singing, and are curious about joining a choir, come along and try out your vocal cords with our fun and inclusive group. No audience or musical knowledge required. Meets on Thursday evenings during school terms at Laverton P12 College, 91 Bladin Street, Laverton from 7-9pm, with supper provided.
Sue 0418386147 or lavertoncommunitychoir@gmail.com
Rotary Club of Wyndham Harbour
Assist with service projects in the local community and overseas. The club meets at 7pm on the first Tuesday of the month at the ‘By the Bay Cafe’ in Wyndham Harbour.
Mamode, 0469 888 126
Lions Club
The Lions Club of Point Cook meets at the Featherbrook Community Centre on the third Monday of the month at 7.30 pm. The club is seeking to grow the Lions free vision screening in schools team. Volunteers needed to work with the region’s schools in combating undiagnosed children’s vision issues. You do not have to be a Lions member but must obtain a working with children check.
Robert Eyton, 0417 549 684, or robeyton@bigpond.com
Adult drumming classes
If you ever wanted to try out your rhythmic skills, the first class is free and concessions apply for other classes. All hand drums supplied or BYO. No

experience required, just bring an open heart and mind and enjoy making some great rhythms together. The class is friendly and welcoming to everyone. Thursdays, 7.30-8.30pm, during school terms, at Saltwater Community Centre, 153 Saltwater Parade, Point Cook.
0411 028 077 or bfmusic15@gmail.com
Watton Group
A support group providing a social space for carers to get together in a safe and compassionate environment. Gives carers an opportunity to connect, share their experiences and offers emotional and practical support. The group meets at the Eco-Living Centre at 10am, every fourth Tuesday of the month.
Patricia, 0434 487 360, or wattongroup131@gmail.com.
With One Voice Wyndham Choir
With One Voice Wyndham Choir is a community choir open to all. The community choir welcomes all ages, abilities, faiths, cultures and genders and is directed by a very experienced and friendly professional conductor. Fun weekly rehearsals and amazing performance opportunities are provided. They sing for an hour and then have a cuppa. The first two visits are free;
and then payment is by tax-deductible donation. Tuesday evenings, 7-8.30pm, at Wayaperri House, 106 Duncans Road, Werribee.
wyndham@withonevoice.org.au
Adult community garden group
The group meets on the first Wednesday of the month, 10-11am, at Iramoo Community Centre, 84 Honour Avenue, Wyndham Vale. Head down and join them as they maintain their rejuvenated community garden. Planting and harvesting produce that they grow.
8742 3688
Seniors House of Fun
The Grange Community Centre invites seniors of Wyndham to its weekly Seniors House of Fun. This is a free program running every Friday, 11am-12.30pm, at The Grange Community Centre, 260-280 Hogans Road, Hoppers Crossing.
Vanessa, 8742 8000, or enquires@ grangecommunity.org.au
Seniors club
The Werribee Senior Citizens Club meets at 80 Lonsdale Circuit, Hoppers Crossing. The group is open to all people 55-plus and it runs on Wednesdays, 10am-noon.
Entry: $2, includes morning tea.


Diabetes Support Group
The Werribee Diabetes support provides an opportunity to hear from experts on how to manage your diabetes, to share information on diabetes and to engage with other diabetics Meetings are at the old council shire buildings at 10am every second Friday of the month.
Bob, 0409 252872.
Hoppers Crossing Ladies Probus
The friendly and vibrant group meet at Hotel 520 on the second Wednesday of each month from 10am. They have a guest speaker each month as well as social lunches, outings and theatre trips.
0408 123 669
U3A Werribee
The group is a not-for-profit community organisation for semi-retired and retired Wyndham residents. They hold a variety of classes-activities specifically designed for seniors, including, light physical and mental wellbeing sessions, arts, games and craft, and general classes such as current affairs, history and lunch groups. Most classes-activities are held at Wyndham community centres.
Rick, 0402 299 220.

This week’s photographer’s choice picture is of Samarth, Parth and Inyraah who are gearing up for colourful fun at the Women in Brimbank Colour Festival on April 5. (Attie Mohebali) 466942_01







Dr. Tony Stubbs Eye Surgeon

Dr. Tony Stubbs, Eye Surgeon, says that just about anyone can have their vision restored and be rid of their glasses for most of the time. And this is without the use of laser surgery. Dr Stubbs formerly at the Royal Victorian Eye Hospital who has worked with the Fred Hollows eye department at the Prince of Wales Hospital in Sydney, says he began his career through the inspiration of his father, Dr Maxwell Stubbs.
“My father was a pioneer in cataract implant surgery from 1963! He has now passed away but some of his patients still come in for a check-up. Not only is this inspirational, it also demonstrates that good surgery outlasts the surgeon,” Dr Stubbs says.
A specialist who helps people who have been advised they are unsuitable for laser surgery, Dr Stubbs is also committed to demonstrating that age, corneal distortion or astigmatism are no barriers to eliminating the need for glasses.
One of my best moments was treating a 12-year-old girl who was struggling at school because of poor vision due to congenital cataracts even with the use of thick glasses. Now 10 years later, she still has 20/20 vision without glasses. That inspires me.
“Seeing my patients’ bright smiles after surgery, as they stop squinting and can read without glasses, is definitely the best part of my job.”
No referral is needed and no out-of-pocket expenses are incurred for an assessment to enable all options available to be considered.














The application is for a permit to:

The application reference number is: WYP14986/25
The applicant for the application is: Wyndham City Council
Responsible Authority: Wyndham City Council: 8736 5503
You may look at the application and any documents that support the application at; - The Council website https://www.wyndham.vic.gov.au/advertising
- By Contacting the Town Planning Unit on the contact number above
Any person who may be affected by the granting of the permit may object or make a submission to the Responsible Authority by post or in person or; - Online: www.wyndham.vic.gov.au/planningobjection
- Email: statplanning@wyndham.vic.gov.au
An objection must be made to the Responsible Authority in writing, include the reasons for the objection and how the objector would be affected. If you object, the Responsible Authority will tell you of its decision.
The Responsible Authority will not decide on the application before: 14 April 2025









Star Weekly seeks an enthusiastic Full or Part time Sales Executive to work across our print, digital, social and online platforms.





Star Weekly is an independently owned company which prides itself on its long history of community experience but also its investment in the future.
The successful applicant will need to possess good people skills to enable them to meet with local businesses to sell solutions through our advertising platforms to help promote their business.
Applicants will need their own reliable vehicle for which we will provide an allowance.
The position is salaried, plus we offer an open ended commission scheme.


Send your application letter and resume to: Advertising Sales Manager, Mandy Clark mandy.clark@starnewsgroup.com.au www.starnewsgroup.com.au



PUZZLES
To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.
ACROSS
1 Alarm (7)
5 Instructs (7)
9 Aloofness (11)
10 Formerly (3)
11 Oration (6)
12 Activators (7)
14 Wading bird (4)
15 Hostile (10)
17 Law-maker (10)
19 Book ID (1,1,1,1)
20 Reticence (7)
22 A seat for riding an elephant or a camel (6)
25 Hearing organ (3)
26 Containing an abstract meaning (11)
28 Depressants (7)
29 Those who derive pleasure from inflicting pain (7)
DOWN
1 StarWars:EpisodeIII –Revengeofthe – (4)
2 Complying (9)
3 Honorific (5)
4 Pottery (11)
5 Digitally generated imagery (1,1,1)
6 Whenever (7)
7 Follower of the main Indian religion (5)
8 Identifying (9)
12 Ancient coffin (11)
13 Partner (10)
16 Lengths (9)
18 Family name (7)
21 Virago (5)
23 Hyper (5)
24 In addition (4)
27 Guitarist, – Paul (3)

1 In The Chronicles of Narnia series, which Pevensie sibling is granted the regnal title of 'The Just'?
2 What is the national flower of the US?
3 Which act
7 Saoirse Ronan (pictured) starred opposite Emory Cohen and Jim Broadbent in which period drama film?
8 How many constellations are recognised by the International Astronomical Union?
9 According to urban legend, how long does it take to digest a piece of gum?
10 Apteryx are a species
Nissan X-Trail passes the road test
By Alistair Kennedy, Marque Motoring
Petrol/electric powered vehicles have been around for nearly a quarter of a century when Honda and Toyota launched their Insight and Prius models respectively.
Over the years more hybrids have arrived to the stage where now almost every brand has a variety of them. Indeed, most Toyota passenger vehicles are only available as hybrids.
Along the way batteries and electric motors have evolved while the price surcharges have made them much more affordable than the early models.
Although Nissan was an early adopter of fully-electric cars, mainly the Leaf hatchback, it didn’t offer hybrids until 2023 when the Qashqai and X-Trail e-Power variants were added.
There is a significant difference between the conventional petrol/electric powertrains of other hybrids and that of the e-Power models.
Whereothersusethebattery-poweredmotor to drive the car at low speeds before switching over to their relatively large petrol engines, the e-Power operates in reverse where two large motors always drive the wheels and are constantly being charged by a smaller engine.
It’s a bit like an electric car with a range extender, minus the capacity to store the power generated. Because the engine is always running it sounds like a petrol car but drives like an EV.
It delivers responsive performance thanks to the fact the electric motor powers the wheels, providing EV-like instant, linear and smooth throttle response. The power for the electric motor is generated by a turbocharged 1.3-litre three-cylinder advanced variable compression turbocharged petrol engine.
Our test car was the X-Trail hybrid or, to give it its full name, the X-Trail e-Power e-4orce with the latter tag describing the all-wheel drive system that controls torque and braking for each wheel individually.
The X-Trail hybrid comes in three variants, ST-L, Ti and Ti-L, priced at $50,765, $55,465 and $58,465 respectively plus on-road costs.
Styling
The fourth-generation X-Trail follows the distinctly Nissan angular design direction, sharing several sharp lines with the Pathfinder and Qashqai. Only a revised V-Motion grille and badging distinguish the e-Power hybrids from the petrol variants.
Lighting is up to present-day standards with auto LED headlamps, LED tail-lights, daytime running lights and fog lights.
ST-L rides on 18-inch alloys wheels, Ti and Ti-L have 19-inch alloys as standard while Ti-L gets the option of 20-inch alloys.
Depending on variant, there are 13 colours from which to choose. Only one, red, is standard; all others are cost options including a number of two-tone.
Interior
All X-Trail hybrids are five-seaters with the two extra rear seats only available with the petrol variants.
Inside,thesurroundingsareablendofquality craftsmanship and materials highlighting comfort and convenience all round. Comfort is covered by 10-way power-adjustable (and heated) front seats, three-zone climate control, six-speaker audio (with digital radio), leather-accented trim and a leather-trimmed steering wheel.
Specialattentionhasbeenpaidtoergonomics and tactile feel of the switchgear and buttons used in the cabin to lend them a high-quality feel.
A two-tier centre console provides plenty of space to stash items, with a charge pad in more expensive models for mobile devices. Move to the back and the first thing you notice is the rear door opening to 85 degrees,


which makes it easier to get in and out. The rear seats (split 40/20/40) can slide forward for more boot space, or back for maximum passenger room.
Withallseatsupright,cargospaceis575litres andtoaround2000litres.Apowertailgateeases loading. Note that these dimensions are to the roofline rather than the normal seat height.
There’s no spare wheel of any sort, only a puncture repair kit.
The centre console has a floating design, with room for large items in a rubberised section underneath. A shift-by-wire gear selector is compact and user-friendly. Also on hand are buttons for EV and e-Pedal modes, as well as a rotary dial to access drive and terrain systems.
Infotainment
The entry level X-Trail hybrid ST-L comes with an 8.0-inch touchscreen, with Bluetooth, AM/FM and DAB+ digital radio, wired Apple CarPlay and Android Auto and six-speaker audio (but no navigation).
TiandTi-Lgetalarger12.3-inchtouchscreen withsatellitenavigation,andwirelesscharging.
There are four USB ports: USB-A and USB-C in the front and charge only USB-A and USB-C intheback,with12-voltoutletsinthefrontand luggage area.
There’s also a 10.8-inch head-up windscreen display and 12.3-inch digital instrument cluster, with customisation of information clearly and easily accessible.
Smartphone integration has been upgraded withwirelesssmartphonechargingandwireless Apple CarPlay for seamless connectivity, along with additional USB-A and USB-C charge ports for keeping smartphones and tablets topped up.
Engines/transmissions
As mentioned, the e-Power system uses motors at the front and rear. Outputs are 150 kW and 330 Nm at the front and 100 kW/195 Nm at the rear for a combined 157kW.
The 2.1 kWh electric motor delivers power
RATINGS
Looks: 8/10
Performance: 8/10
Safety: 8/10
Thirst: 7.5/10
Practicality: 7/10
Comfort: 8/10
Tech: 8/10
Value: 7/10

directly to the wheels, using energy stored in the battery pack.
The e-Power with e-4orce system consists of a high-output 2.1 kWh battery together with a power generator, inverter and twin electric motors – 150k W for the front and 100kW for the rear (with a combined system output of 157 kW).
The turbocharged 1.5-litre three-cylinder charges the battery pack or the electric motor, thepetrolengineandsoeliminatestheneedfor an EV charger.
Like most SUVs it operates predominantly in two-wheel drive most of the time with drive to the front-wheels through a single-speed reduction gear.
Towing capacity for the e-Power models is rated at 1650 kg, compared to 2000 kg for petrol versions.
Safety
The X-Trail hybrids earn a five-star ANCAP rating under 2021 test conditions and added information and testing.
Active safety is covered by forward autonomous emergency braking (pedestrian and cyclist), adaptive cruise control, lane departure warning and ProPilot lane keeping, traffic sign recognition, rear cross-traffic alert, driver attention alert, and reverse autonomous emergency braking (pedestrian).
In Ti and Ti-L variants, pedestrians close to the vehicle are alerted by an external audible warning when it is in almost silent EV mode. Seven airbags include a centre airbag between front seat occupants.
Driving
Aswithallvehiclesthatstartoffwithanelectric motor the Nissan X-Trail e-Power delivers smooth and almost instant acceleration off the mark. Add excellent noise cancelling measures within the cabin, it’s almost silent.
When called on for more power, the petrol engine and generator chime in with a non-too unpleasant hum, keeping the battery pack
charged and, if needed, directly powering the electric motor.
EV or e-Pedal controls are instigated by means of buttons on the centre console. EV is what it says – no petrol engine input here – and can be operated for a short distance.
Ontest,pressingtheEVbuttonwasanswered byamessagesayingthebatterywasnotcharged enough to sustain electric-only operation.
The e-Pedal had no such impediment, leaving the accelerator to apply the brakes automatically when the foot was lifted off, calling on the regenerating capacity to slow the car almost to a halt.
A drive and terrain mode selector offers five different modes: Auto, Eco, Sport, Snow and Off-Road.
With a 55-litre tank, fuel consumption is a claimed 6.1L/100km using premium 95 unleaded and it generates 139g/km of CO2. Nissan claims combined urban/highway fuel consumption of 6.1 litres per 100 kilometres using 95 RON fuel. The test car recorded 5.7 litres per 100 kilometres in urban driving where the battery is dominant but jumped up to 7.1 L/100km on a motorway due to the extra engine usage.
Summary
The X-Trail hybrid is an outstanding long-distance cruiser with the benefits of an electric vehicle but without any range stress. The instant response delivers fast and safe acceleration to make overtaking or merging onto a motorway easier.
In its performance it does lean more to the full electric vehicle rather than the hybrid SUV. However, there’s the added running cost of buying petrol.
Thepremiumpurchasepriceoverpetrol-only models is covered somewhat by the increased Ti/Ti-L equipment
As of 1 February 2025 all new Nissan vehicles come with a 10-year, 300,000km standard warranty but with the stipulation that all servicing is carried out at dealerships.
The X-Trail hybrid is an outstanding long-distance cruiser with the benefits of an electric vehicle but without any range stress. (Pictures: Supplied)
The new lot of cricket premiers were crowned on Saturday, while other teams started their finals round as the FV state league seasons kicked off. Star Weekly photographer LJUBICA VRANKOVIC was out shooting the action.
Premiers crowned, shocks galore













Woodend’s Harry Lawson. 466957_01
Tarneit Central’s Pradeep Ajara. 466964_16
Sunbury United’s James Hughes. 466957_25
Romsey’s Jamie Taylor. 466960_01
Mernda celebrates a wicket. 466962_07
Laverton’s Matias Arriagada and Sunbury United’s Ubeyde Cicek. 466967_08
Laverton’s Cristian Segura. 466967_02
Mernda’s Michael Edwards. 466962_04
Merrifield’s Talwinder Prince. 466964_06
Rivergum’s Matthew Perri. 466962_02
Gisborne’s Matthew Barake. 466960_08
Fans enjoy the again at Gardiner Reserve. 466960_21
Mernda supporters. 466962_09
Bees seeking consistency and a touch of luck
By Tara Murray WerribeeCityhasn’thadtheluckithasneeded
as its new squad tries to come together in the Victorian Premier League 2 competition.
Having dropped a division in the off season, the Bees have been faced with many new challenges facing it this season.
Coach Craig Moore said it hadn’t been easy in the early parts of the season.
“We’ve been struggling with a few injuries,” he said. “Our captain got a tough challenge on Saturday night and had half a dozen stitches in his leg and is out for two to three weeks.
“Stress fractures, ankle ligaments; it has been tough to get a full squad out there.
“But it opens up opportunities for the kids to come up from the under-23s. It’s good for them and the development for some of those players.”
Moore said they would love some consistency within their side instead of having to make three or four changes each week. He said they had shown some really good
signs but it was able to put it all together.
“We have the best defensive record in the league,” he said before the weekend’s match. “We’ve got some good defensive match ups. We have to go out and score some goals.”
The Bees were able to gain some confidence in their opening round of the Australia Cup with a 7-0 win.
Moore said while it was a match they expected to win, it was still a good test for them.
He said they gave some of their under-23s and bench players a go in that game.
“We gave them a chance to see what that level looks like and what it felt like,” he said.
“One guy got a hat-trick, another got two goals.
The good thing about that game was giving more of the younger players first team football and rest some of the other players.
“They got to experience senior football and the pace is quicker than what they are used to. They got to see who we want to play as a club right across the board.”
Moore said the win would build some belief
in a side that hadn’t had many wins in the past few years.
He said they need to get that into not only the playing group, but also in the club and the supporters.
“We want them to take that confidence and freedom to express themselves,” he said. “Hopefully it’ll lead to some positive results and the boys understand how we want to play on the pitch.”
On Friday night, the Bees faced ladder leaders Eltham Redbacks.
The Redbacks led 1-0 at half time before going on to win 3-1 as the Bees ended the game with 10 men.
Kojo Brown was the goal scorer for the Bees.
After seven rounds the Bees sit in 13th spot.
Meanwhile, the FV state league season got underway on the weekend.
In state league 3 north-west, Hoppers Crossing beat the Sebastopol Vikings, 2-0.
In state league 4 west, West Point lost to Balmoral, while Point Cook shared the points with Keilor Wolves and in state league 5 west, Tarneit United lost to Maidstone United, 8-1.

Cats into the grand final
By Tara Murray
It was a rollercoaster of emotions for Hoppers Crossing as it won through to the Victorian Sub-District Cricket Association south-west grand final.
There were plenty of ups and downs in the Cats semi final with Oakleigh, but they were able to find a way to get across the line and into their first Subbies first XI grand final.
It was a relieved Cats captain-coach Simon Lambert who went through it all on the weekend.
“Obviously it’s really pleasing but it was sort of a bit of a rollercoaster,” he said. “It’s nice to have a home grand final. We haven’t lost there since round one.
“Not many teams have come here and have had some success. We’re pretty confident that we can get the job done.”
The Cats made 9-292 from their 80 overs after being sent in. Lambert said they didn’t look like making that for most of the game.
“We got off to a flier and was 0-70 and then
slipped to 4-80 and I thought we were in a spot of brother,” he said.
“We kept getting partnerships and then losing a wicket. I thought we needed at least 250 as the pitch was good and it was going to get better.
“It didn’t look that great.”
The Cats’ tail though showed a lot of resistance and pushed the score past 250 and closer to 300.
BhaumikJani,whocameinatnumbereight, made 42, number 10 Wajh e Ali Bangash made 33 not out and number 11 Abbas Faiyaz made 50 not out off 24 balls.
Lambert said every time they’ve needed the lower order to step up this season, they’ve been up to task.
“Our ninth and 10th wicket partnership put on 120 between them,” he said. “That was beyond our wildest dreams.
“Our numbers eight, nine and 10 are a lot better than that and could bat in the top six or seven.
“To get 70 off the last partnership from

Panthers prove too strong
A determined Tarneit Central fell short in the North West Metropolitan Cricket Association George Luscombe Shield grand final on Saturday.
Despite being set a massive task on day one of the match, Tarneit fought hard against the best side all season, the Merrifield Panthers.
Both sides were playing in the top grade for the first time this season, with Tarneit aiming to win a second titles having claimed the Western Suburbs Churches and Community Cricket Association T20 title.
The Panthers had lost just one game for the season to Tarneit, which gave the underdogs some hope it could knock them off.
The Panthers made 307 on day one of the match, before day two was postponed until Saturday after rain last Sunday. Anil Bhatia was the pick of the bowlers for Tarneit, taking 4-40.
On Saturday, Tarneit was in trouble early with its top four batters all out cheaply and looking like the Panthers would run through them.
The middle order led by Gurpreet Singh started a turnaround to put the pressure back on the Panthers.
With the run rate starting to increase, Tarneit had to find some more runs quickly.
seven or eight overs, was incredible.”
Lambert top scored with 60 at the top of the order.
Day two was a mirror of the first day.
Oakleigh started well with the bat and was on top early on.
“It was a rollercoaster and it was a good pitch and it was better than day,” he said.
“It flattened out and there was nothing for the spinners. I thought here we go again.
“They were 0-70 and then 4-100.”
Lambert said the run rate was the biggest thing in their favour but Oakleigh kept pushinG.
There were some nerves for the Cats but despite some late hitting an from Oakleigh it wasn’t enough.
Oakleigh was bowled out for 253 in the third last over. Harshit Takkar finished with three wickets for the Cats.
Lambert said their lower order batting was what got them the win.
The Cats will face Caulfield in a two-day grand final this weekend at Hogans Reserve.
As it did, wickets started to fall including Singh, who made well fought 101.
Tarneit ended up all out for 241 in the 74th over.
Chanpreet Singh Dhaliwal, who came in at number nine, was the other key batter as he scored a handy 40.
Satnam Singh took three wickets for Tarneit in the loss.

Gurwinderjeet Singh. (Ljubica Vrankovic) 466964
Ismael Mohamed. (Ljubica Vrankovic)
Abbas Faiyaz. (Ljubica Vrankovic) 452930
Three premierships for a delighted Thunder
Glen Orden made three grand finals last season, but wanted to go even better this time round in the Western Suburbs Churches and Community Cricket Association.
After one senior premiership last season, the Thunder claimed three this season much to the delight of the club.
Thunder secretary Vimal Chatrati said they were still living in a dream after the big weekend a couple of days later.
“Last year we won division 2 and finished runner-up in a couple of others,” he said. “This year we were in division 4, 5, 8. 9. 10 and 14.
“The aim was to get back to at least three grand finals and win them.
“Our division 4, 5 and 9 teams claimed the premiership.”
In division 4, the Thunder beat Vic Bangladeshi in the grand final.
Vic Bangladeshi were bowled out for 124, with the Thunder finishing 2-129 in reply.
Pranay Burri took six wickets for the Thunder, while Dilip Kumar Challagulla finished unbeaten on 86 not out.
Chatrati said half way through the season it didn’t seem like they would have success.
“We started off really badly,” he said. “We were rock bottom of the eight teams.
“There were some changes of players here and there and a change of strategy. We then started winning every match and I think we won 10 matches in a row.”

In division 5, the Thunder beat Truganina United’s second XI.
The Thunder made 8-234 from its overs with Kiran Lakkapragada top scored with 91.
Vice-captain Arun Pandiyan made 76.
Truganina fell well short, bowled out for 174 in the 33rd over. Devang Patel top scored with 54.
Kiran Parepalli took three wickets for the Thunder.
In division 9, the Thunder upset minor premiers Grand United in the semi finals to
win through to the grand final.
The Gorillas had won all their games throughout the season and were 36 points clear on top of the ladder, while the Thunder had finished fourth.
Chatrati said it had been a miracle for the side to even win through to the grand final.
In the grand final, the Thunder accounted for Laverton.
The Thunder made 9-191 with Hiral Desai top scoring with 57 at the top of the order.
Laverton was restricted to 145. Sravan
Storm claim div 1 title
By Tara Murray
Manor Lakes pulled off an upset to claim the Western Suburbs Churches and Community Cricket Association E.Cocks and B.Haining Shield.
Manor Lakes finished the regular season in third spot and won through to the grand final against Williams Landing with an upset win against West Point Titans.
The upsets continued into the grand final, with the Storm able to overcome the minor premiers.
Secretary Debasis Dash said it was a massive moment for the club.
“Last season we made the semi finals but due to weather conditions it had to be called off and we missed out as we were the lower ranked side,” he said.
“This time round we had a couple of close matches and we qualified for the semi finals and then the final.”
Neeraj Kush was star for the Storm in the final series with his batting help taking the game away from the opposition in both matches.
Dash said he wasn’t in the greatest touch heading into the finals, but found form when it mattered.
In the grand final, Williams Landing batted first and made 7-150 from its 35 overs. Dash said they were happy to chase that score.
“With the heat and everything to restrict them, it was really good,” he said. “We thought to keep them to a 150-180 score would have been a good job.
“They had some dangerous bats in the middle and we were able to restrict them and we were really happy with 150.”
Vishal Modi top scored for Williams Landing with 50.
Taranjeet Singh took three wickets for the Storm.
Kush set the tone early with the bat for the Storm.
He finished 84 not out off 69 balls as he helped guide his side to 3-153 in 24 overs.

Kush had made 85 in the semi finals as well.
Dash said while anything can happen in a run chase, Kush made the job easier from everyone else.
“He took the pressure off,” he said.
“When someone is striking at more than 100 per cent you just support them and make singles.
“You don’t need to play big shots.”
The premiership was the Storm’s first in division 1, having won lower grades before.
Dash said it was a massive achievement for the club.
The division 2 team just fell short of
making the grand final, while the club’s division 6 side and two under-13 teams, girls and boys, who won premierships.
Dash said the aim of the club was to push up some of their lower sides up the grades to close the gap.
“They would love to have sides in division 3 and 4,” he said. “We would also love to have a couple more teams.”
The club is always keen on growing its junior program as well and adding some more experienced coaches.
Peyyeti took three wickets.
“It’s the first time we’ve won three championships,” Chatrati said. “We couldn’t have done it without the support we got from the families and sponsors.”
The club has also seen massive growth in its juniors, which Chatrati has played a massive role in.
He was named the Cricket Victoria volunteer of the month in October.
Tara Murray
New role for Kyle Hartigan
Kyle Hartigan’s journey at Werribee is headed in a new direction after being appointed the club’s new football manager.
This will be Hartigan’s second season at Werribee following his 135-game AFL career.
He joined the club as an assistant coach, where he took charge of the Victorian Football League’s best defence during Werribee’s premiership-winning year.
Having already built strong relationships with players, staff, and coaches in the 2024 campaign, the club said he is well-placed to take on this leadership role.
For Hartigan, this next chapter brings his football journey full circle.
After missing out on the 2009 AFL draft, he joined Werribee for the 2010 season.
He played 48 senior games between 2010 and 2012 before being selected with Adelaide’s first pick in the 2012 rookie draft.
In addition to his new responsibilities, Hartigan will continue as an assistant coachongamedays,whileMarkMicallef returns to the club to assist with match day operations.
Micallef is no stranger to Werribee, having served as football manager from 2021 to 2023.
Hartigan said it was a privilege to be part of the Werribee Football Club.
“First as a player, then as a coach, and now as football manager,” he said. “It’s a club I’m really passionate about, and I’m committed to continuing building that sustained success on and off the field for the foreseeable future.”
Glen Orden’s division 4 team. (Supplied)
Manor Lakes division 1 and 6 premiership sides. (Supplied)
Tigers stumble in title defence
By Tara Murray
It was a frustrating start to Werribee’s Victorian Football League title defence as it fell short in the grand final rematch with Southport on Saturday.
The two sides have played in some close matches the past couple of years and round one was no different.
The Sharks extra polish proved to be the difference as they came away with a 13.11 (89)-10.11 (71) to get some small revenge for last year’s grand final defeat.
Tigers coach Jimmy Allan said it was a bit frustrating watching on the sidelines.
“It was our own errors on the weekend and it makes it hard to swallow a little bit,” he said. “Upon reflection we did a lot of things right and we’re confident the way we will play will stack up each week.”
The Tigers headed up to Queensland with a very different line up to the one that tasted success on that one day in September.
There were nine debutants playing for Werribee, with many of the families also making the trip up to Queensland.
Myles McCluggage, Jackson Grundy, Brady Wright, Ben Kellett and Noah Tullio made their VFL debuts, while Ryan Eyers, Jake Lohmann, Jedd Longmire and Mace Cousins made their Werribee debuts having crossed to the club in the off season.
Allan said it was good for them to all get their chance to step out with the side after good pre-seasons.
“Nine debutants got to experience this level,” he said. “With the turnover of players we know we’ll be nowhere near our best until later in the year.”
Allan said they were in a position to win the game, with the margin at one point 16 minutes into the last quarter.
The Sharks kicked the last three goals of the game as rain started to fall to ensure they got the four points.
Allan said there were moments in the middle two quarters which would have made things look very different on the scoreboard.
“We squandered a lot of scoring opportunities in the second quarter,” he said. “We could have had a substantial lead.
“In the third quarter we made a lot of errors inside 50 that led to turnovers which led to it going down the other end and them scoring.
“There were a couple of two goal turnarounds. Sometimes it was 20 metres kicks, where we didn’t execute the fundamentals when we weren’t under great pressure.”
Jack Riding had 28 possessions and 10 clearances, while Dom Brew had 26 possessions and eight clearances in the middle of the ground.
Brady Wright in his VFL debut kicked three goals, while Flynn Young and Bior Malual kicked two goals each.
Allan said Wright gave them a good target down forward, while Ryan Eyers was strong down back.
Harry Grintell played in a new position as a running defender, Malual on a wing and



The vision for a vibrant Tarneit is outlined in the draft Tarneit Centre Urban Design Framework which Wyndham City has community feedback.

Clark leads the side out for the first time. (Deion Menzies/@highflyer_images)
Young were the other standouts according to the coach.
Allan said the win was the only thing they didn’t get out of the weekend that they

The Tarneit Major Town Centre is designed to be a hub of prosperity, that is beautifully designed with green corridors, capacity to accommodate a centre for art, health and education.
It offers quality recreational and retail opportunities and celebrating the area’s Indigenous and cultural heritage –dynamic destination of choice.
The framework will be a guide for staged development in attracting investment over the next 30 years.
It will help to ensure the town centre meets the needs of population in Tarneit with the centre ultimately providing 8,000 jobs and a home to more than 10,000 people.
Please register for an information session to find out more:
wanted. He said as a new group it was good to get on the road early in the season and further get to know each other, which they were able to do.

Werribee is back in action on Saturday against Essendon at the NEC Hangar. Allan said it would be another good test for them.
Questions can be emailed to tarneitudf@wyndham.vic.gov.au and feedback shared on the Loop by 20 March on https://theloop.wyndham.vic.gov.au/tarneitudf
































































Brady Wright celebrates goal number one. (Deion Menzies/@highflyer_images)
Jesse







