Shree Krishna Paper Mill & Industries Limited Go the Brown way - Brown is the new White. Use PACKMATE and experience the beautiful world of Brown papers with us. 4830/24 Prahlad Street Ansari Road, Daryaganj, New Delhi-110001 Ph.: 011- 46263200, 3261728 & 23267253 Fax: 91-11-23266708, Website: www. skpmil . com Contact: Mr. Man Singh Ph.: 011-46263214 Email: man.singh@skpmil.com Mr. Devkishan Chanda Ph.: 011-46263210 Mobile: 8850105601 Email: devkishan.chanda@skpmil.com Regd Office: Mobile: 9311182389 Benefits of the PACKMATE range: • Environment friendly • 100% recycled products • Lesser water consumption • Great for scanning, writing, and printing • Cost-effective BROWN - the color of nature - represents Eco-friendliness. Other Products: • NotepadEnvelope•• Gift Wrapping Paper Dealer / EnquiriesDistributorSolicited A4BROWNCopier www.pack-mate.in BROWNTHEISNEW !WHITE
ALLIANCE INTERNATIONAL Sales / Service Agents Alliance International is a leading supplier of consumables, components, assemblies and new and used paper machinery. We representwell-knownmanufacturersinthepulpandpaperindustry who are known for their quality and reliable products. This enables ustoprovidecosteffectivesolutionstothepulp&paperindustry. G-32, Suite No. 201, Hansraj Sethi Marg, New Delhi-110019 (INDIA) • Ph.: 011-41315501/02/03 • Fax : 011-41315506 • Mob.: +91 9810102608 • E-mail : aneja@allianceint.co, info@allianceint.co • Website: www.alliancepapermachinery.com ALLIANCE INTERNATIONAL Also available used Equipments & Machines from Europe / USA info@tulip3pmedia.inby:Design STOCK PREPARATION • Drum Pulper • Centri Cleaners • High Pressure Screens • Baskets Slotted / Perforated • Screw Press • Hot Disperser • Poly Disc Filter(PDF) • Chest Agitators • Press Felts • Dryer Fabrics • C. I. Dryers / MG • C. I. Press Rolls • C. I. Pope Reel Drum • Granite Rolls • Suction Press Rolls • Calendar & Calendar Rolls • Pocket Ventilation & Hood • Online Felt / Screen Cleaners PRESS & DRYER PART • Forming Fabrics • Head Box- Pressurised • Suction Boxes & Ceramic Covers • Suction Couch Rolls • Doctor Blades & Systems • Shower System & Nozzles • Vaccum Pumps PAPER MACHINE • Rewinder • Simplex Sheeter • Reel Handling System • Complete Warehousing Solutions (ASRS) FINISHING HOUSE SHEETER for the PULP & PAPER INDUSTRY
Century Pulp & Paper: Riding the Waves of Innovation and Expansion.....12 CONTENTS June-July, 2022, Paper Mart Industry.....forofOpensPlasticSingle-UseBantheDoorOpportunitiesPaper 16
Pioneering Women in the Paper Industry.....28 Ruchira Papers: Striving to be More Inclusive PG Paper SuccessWorkConsistencyCompany:andHardaretheKeysto Ecoware: 30ConstituteWomenaboutPercentofthe Team ‘Industry is Male-Centric but I Never had Difficulty with That’ EnviroWay: Addressing Safety Concerns would Empower WorkforceWomen 29 32 34 36 38 JMC: Fostering Growth of Women in the Industry for Many Years 44 Saloni Paper Machines: Paper Industry Holds Immense Opportunities for Women 46 ‘We Still Have a Long Way to Go’ 52 ‘Kuantum Papers has given me the platform to showcase my abilities and empowered me to take on new challenges’ 54 Shree Rudra Lamkraft: ‘Mantra is to Never Give Up’ 50 EVENT HIGHLIGHT IPPTA, CPPRI Organise Workshop on Pulping, Bleaching & Recovery in Paper Mills.....62 Haber: At the Forefront of AI-driven Treatment.....Water 66 Factors Behind Resilience and Strong Performance of European Pulp and Paper Industry....58 Precise Castings – Seeing Great Growth Potential in Molded Segment.....Fiber70 Small Things Make Big Difference. 76 BASF: Creating Chemistry for a Sustainable Future.....68 INTERVIEWS ANALYSIS Heat Management’s HISS™ was Installed as Part of Södra Expansion 2.0 Project.....80 NEWS.....82 INNOVATION
EYEINGMILESTONE •••••••••••••
entury Pulp & Paper is the largest manufac-Cturer of paper, board, tissue, and pulp from a single location in India with a capacity of 500,000 + MTPA. With service centres and sales offices across the country as well as agents across the world, the company has been a major player in the domestic and export market for this industry.
CenturyPulp&Paper: RidingtheWavesof InnovationandExpansion
Mr. Vijay Kaul, CEO, Century Pulp & Paper
12 | www.papermart.in / June-July, 2022
Century Pulp & Paper has stayed committed to its values to create a positive impact and continuously strives to improve the quality of its products. In an interview with Paper Mart, Mr. Vijay Kaul, CEO, Century Pulp & Paper discusses recent developments and the future plans of the mill. In the next few years, we'll be investing around INR 500 crores in the Lalkuan facility which would help us take the overall capacity to about 600,000 MTPA.
PM: How would you like to strategically invest in the direction of – technology upgrades, product development, market expansions, and so on?
www.papermart.in / June-July, 2022 | 13
PM: Since the company has always been at the forefront of implementing efficient technologies, what are your key focus areas at the moment in this respect?
VK: On a regular basis, about INR 150 to 200 crores of investment essentially is done practically every year in improving the conditions of the machine, enhancing the capability of the machine, modernising, digitising, etc. In the next few years, we'll be investing about INR 500 crores which would help us take the overall capacity to about 600,000 MTPA. There are certain portions that are allotted for improving certain parts of the different paper machines, board machines, and tissue machines.
VK: Our strategy is very clear, first, is to invest in the plant in order to increase the capacity to get the maximum production out of it at a low cost, second, to develop new products, and the third is to look for expansion - whether it is an acquisition or putting up a new facility at a different location altogether.
Vijay Kaul: Century Pulp and Paper has been in operation since 1984 and has been a significant player in the export market, especially in the tissue and paperboard segment. The major factor which is driving this growth is the demand which has increased over the last few years. The company's existing production capacity is approximately 500,000 MTPA, which we intend to take to around 600,000 MTPA in a year or two, by doing some modification and rebuilding a few of the machines.
PM: Please share your strategy and the overall vision for elevating the company's standing to greater heights.
Paper Mart: Century Pulp and Paper is a major player in the domestic and export market for the paper, paperboard, and tissue sector; what is the major factor driving the growth? How the new management intends to take this growth story forward?
VK: We are talking to the leading global manufacturers of the paper industry who are in the technological arena about the new things happening and the cost optimisation techniques. We are in the process of exploring the new technologies and fitting those into our present system or implementing them in the new expansion.
EYEINGMILESTONE •••••••••••••
Another portion needs to be utilised in overall improvement of the cost structures, marketing, doing the market research, having the market intelligence department, creating a customer base which will always be with us, and creating loyalty among the customers - all this being a part of the whole gamut. The other part might go for a new expansion at a totally different geographical location. With 600,000 MTPA, this place will be totally saturated, and we may have to go to some other place. The Lalkuan facility in Uttarakhand is catering to the northern and central part of the country. We have not been able to provide a major quantity of products in western and southern India. There are various options being explored in these two parts of the country. In the long term, we need to see that we should be able to export from there, reduce the cost, have better logistics arrangements, and get the best human resource at a reasonable value. We are also evaluating technology and cost implications. It is difficult to determine the Capex at this stage, but within the next five to seven years, Century Pulp and Paper has set a target of clocking a turnover of INR 10,000 crores, which is currently about INR 3500 crores.
Currently, we are spending most of our time understanding how and where we need to expand the business. We are in the process of finalising the market surveys and evaluating the different technologies available. And once we get that, we'll be able to let the people know more about our expansion project. At present, we are looking at various options be it paper, packaging board or tissue. Cost reduction, technological upgradation, new opportunities, product development, and the right scale of the economy - are a few focus areas of Century Pulp and Paper in order to become competitive and grow this industry.
It takes about four to five years for the tree to grow in a position that we can use in making the pulp.
PM: How do you foresee the demand outlook of the Indian paper industry and the different industry verticals –paper, paperboards, tissue papers, and so on?
Secondly, we need to create a system in our organisation, which captures the trends shaping global development so that we plan our strategies accordingly.
VK: There are several innovative ways to create higher value. The approach would be to enter into a new product category, a smart way to handle SCM, which has value or has the potential to create value for the customers as well as for the organisation. We also need to strengthen the marketing team so that we know what is happening in the market around us and plan our strategies. These will be the key strengths that would help us to expand the markets, expand the base and create value by having market intelligence.
Last year, we planted almost 1.63 million trees. We plan to reach 2.60 million this year too. In fact, even the Uttarakhand forest department has also approached us to give them the saplings. They also want to plant Eucalyptus and poplar trees. It's the question of making the raw material available in order to get it at the right price. However, in the last one year, the price has been fluctuating because of international logistics, the RussiaUkraine war, factories being closed during the COVID pandemic, etc. The price is gradually becoming stable and in the next six, or seven months, it should be at a reasonable level. Coal prices have gone up which is again impacting the paper industry, as here, we need to import coal and use different types of coal. Since these are all natural resources, the price will fluctuate every two-three years and you can't do much about it, but only plan well so that it doesn't affect you much.
14 | www.papermart.in / June-July, 2022
VK: In line with changing dynamics on sustainability, the emphasis on replacing plastic in packaging products has been increasing. We have worked on the bio-PBS coating that could replace the PE coatings. Similarly, a leading FMCG Company, which is in an elite segment in their industry, approached us with a demand for a customised product. They wanted us to commission a base board that could be used as a mosquito repellent after chemical treatment at their end. Our R&D team set to work, and we were successfully able to create the product, meeting all the compliance requirements at the customer's end. We have already launched these products commercially in the market
PM: What do you think are the various challenges and stumbling blocks in the paper industry with regard to factors like raw material availability, price fluctuations of key inputs, and so on? Also, how do you think these challenges can be addressed in the future?
EYEINGMILESTONE •••••••••••••
The government has decided that by 2024, the furnace oil has to be replaced. So we are looking for alternative fuels that are environmentfriendly and do not create pollution. We have started using some amount of compressed methane gas in the plant. That, however, also has a cost element, which needs to be borne by the industry.
VK: As regards tissue paper, we are a leading player in the country and have just one competitor, but almost, 10000 –12000 tonnes of tissue paper get imported into the country. So that means there's a demand, which neither our competitor nor we have been able to fulfil. After the COVID pandemic, people have become more aware of hygiene. Similarly, the paper board segment is growing at the rate of 12 to 15 percent and expected to grow fastest in next 5 years. As gender diversity improved in urban working professionals, people are ordering more food from outside and that has increased the demand for sustainable packaging in the food industry. Moreover, with the ban on single-use plastics, paper is touted to be a possible alternative. Hence, the demand is already there; the paper industry just needs to grab this opportunity. It needs to develop new products and add more quality, strength, and rigidity to the paper. We have to see that the paper industry is on a growth trajectory and that depends on how fast the industry can adapt to the new changes and adopt new technologies in order to produce new products.
Within the next five to seven years, Century Pulp and Paper has set a target of clocking a turnover of INR 10,000 crores, which is currently around INR 3500 crores.
PM: In line with your key strengths, how will you harness the capabilities to bring in further value creation in the pulp and paper segment?
VK: Price fluctuation is not only being faced by the paper industry; rather, it is being faced by all industries. Wood availability has not been a problem, but definitely we want people to cultivate more wood. We have embarked upon giving saplings to people so that they can plant them irrespective of the fact whether they want to sell the wood to us or not as that completely depends upon the price at that particular point.
PM: Talking about the new product development, we came to know that you are trying to replace the PE coatings with bio-PBS. Also, you have made a paperboard for an FMCG company, which could be used as a mosquito repellent. Could you shed some more light on these products?
While PET bottles can still be used, the list of items that would be banned includes plastic carry bags, earbuds and balloons with plastic sticks, plastic flags, candy and ice-cream sticks, polystyrene for decoration, disposable crockery (plates, cups, glasses, forks, spoons, knives, trays), wrapping or packaging films around sweet boxes, invitation cards, and PVC banners under 100 microns.
As per a report published in a leading newspaper, JK Paper Ltd., Andhra Paper Ltd., West Coast Paper Mills Ltd., Tamil Nadu Newsprint & Paper Ltd., Satia Industries Ltd. and Emami Paper Mills Ltd. is up by 7 percent, 7 percent, 13 percent, 16 percent, 12 percent and 10 percent respectively in the last six Meanwhile,sessions.companies like Flipkart, Nestle, Starbucks and McDonald's have already switched to paper
PROMISINGFUTURE ••••••••••••• 16 | www.papermart.in / June-July, 2022
finding ways to develop innovative and eco-friendly alternatives to plastic, the simplicity and convenience of the 'good old paper' cannot be ignored. According to the industry experts, there are various applications where the paper industry can chip in such as paper bags, straws, and cutlery. Even the investors have recognised the immense opportunity as there has been an upward trend in the shares of leading paper companies.
While different industries are still
Single-UsePlastic BanOpenstheDoor ofOpportunitiesfor PaperIndustry
n line with the clarion call givenIby Prime Minister Shri Narendra Modi to phase out single-use plastic items, India is all set to ban the manufacture, import, stocking, distribution, sale, and use of identified single-use plastic items, which have low utility and high littering potential with effect from July 1, 2022.
The ban on single-use plastic has suddenly triggered the need to find sustainable alternatives to plastics.
Accordingtotheindustryexperts,therearevariousapplicationswherethepaperindustrycanchipinsuchaspaper bags,straws,andcutlery.Eventheinvestorshaverecognised the immense opportunity as there has been an upwardtrendinthesharesofleadingpapercompanies.
– –
with Paper Mart, Mr. PK Suri, Technical Advisor, JK Paper Ltd. revealed that the company has been developing aqueous-based, biodegradable foodgrade and food safety packaging products and will introduce them soon. While most analysts are bullish on paper-based products, the industry has its own risks and challenges. The prices of pulp, coal, furnace oil, chemicals, and freight rates have surged that have led to input cost pressure. Moreover, the infrastructure needs a strong push.
PROMISINGFUTURE •••••••••••••
2022 | 17
Mr. Vadiraj Kulkarni, Chief Executive, ITC Ltd. – Paperboards & Specialty Papers Division.
Mr. Pavan Khaitan, Managing Director, Kuantum Papers Ltd.
– – – – – –
“The ban on single use plastics (SUPs) with effect from July 1, 2022 is a welcome decision by the Ministry of Environment, Forest and Climate Change. Not only will it allow India to cut down on its plastic waste generation by almost half but also encourage industries and brands to hasten their
I am confident that the Indian paper industry has enough capacity and technological know-how to manufacture a wide range of products which can effectively replace plastic. It is heartening to see many companies, especially in the FMCG and food packaging sector, embrace this change and commit themselves to a future free of single-use plastic. We, at Kuantum Papers, support this initiative and are committed to serve the society by providing eco-friendly and sustainable paper products for industries and consumers alike, thereby meeting India's climate and environment goals.”
– – – – – – – – – – – – – – – – – – – – – –
Here's what the industry has to say:
packaging. In a case study released a few months ago by WWF India, the sustainable packaging designs of Flipkart led to a transformation in the Indian e-commerce ecosystem. Titled “Designing sustainable packaging in E-Commerce: A WWF India Case Study on Flipkart Group”, the study outlined measures that businesses in the same space need to undertake and the ecosystem support needed to incorporate targets towards plastic reduction and its management in their value chain. The case study also outlined measures for businesses to venture into different designs of packaging and distribution models to improve recycling and recovery rates.
– –
www.papermart.in / June-July,
“The Government's recent regulation on single-use plastic is a significant step in India's sustainability journey. This has also opened up new avenues for the paper industry in India. ITC has always been at the forefront of the sustainability movement and continues to do so. We have been able to leverage our R&D capabilities to launch several paper-based alternatives in the market, with many more in the pipeline. We are also working closely with printers and end-users to help them transition to more ecofriendly substrates.” – – – – – –
The Flipkart Group, including ecommerce marketplace Flipkart and leading fashion destination, Myntra has undertaken a series of initiatives to accelerate progress towards eliminating 100 percent single-use plastic in its own supply chain by 2021 for owned and operated facilities to replace it with suitable paper-based alternatives. In the pilot phase, Flipkart's team conducted pilots to identify sustainable alternatives to reduce single-use plastics and the most efficient way of implementing them. As the program evolved, the company scaled up its processes to adopt the identified alternatives and deploy them across day-to-day operations. The invoice polybag has been replaced with recycled kraft paper pouch, airbags are replaced with shredded paper fillers, and plastic used for secondary packaging is replaced with paper bags. Also, shrink and pouches are replaced with paper stickers, and paper pouches, Inrespectively.arecentconversation
– – – – – –
“This new ban on single-use plastic is effective from 1st July 2022 and will be closely monitored by the Central and State Pollution Control Boards, and directives have been issued at the national, state, and local government levels to withhold raw materials to industries that operate in banned items. Non-compliance with this new piece of legislation will warrant penal consequences of a fine of up to INR 100,000 or jail, or both.
Mr. R N Agarwal, Chairman & Managing Director, N R Agarwal Industries Ltd.
adoption of eco-friendly alternatives, such as paper. I am hopeful that the paper industry will leverage this opportunity to the fullest and will give the nation a sustainable future by replacing many low utility high littering SUPs with paper-based carry bags, cups, straws and packaging material. There is an upbeat sentiment in the industry as paper is the best alternative to plastic material and is biodegradable which will allow our future generations to live in a world with lower levels of plastic pollution.
– – –
“The single-use plastic ban is going to benefit not only the paper industry but the overall environment. Be it plastic or any other material, we should be conscious of whether it is environmentally sustainable or not. We have to use it very responsibly as it is going to have a long-term impact.
Paper is highly biodegradable and environment-friendly. It has no negative impact on the environment. Replacing plastic implies more use of paper and the Indian paper industry is prepared for that and has permission. The quality and the products which we have can replace plastics, especially single-use plastics in the best possible –manner.”–––––
The largest share of single-use plastic will be taken over by paper bags. It is said, manufacturing paper bags uses 3/4th the amount of energy consumed than plastics. On top of it, this has a benefit for the environment due to the easy circularity of paper. This ban has been positive for the paper industry as another opportunity to replace singleuse plastic with paper options. However, we have to also keep in mind that to satisfy this need, an increase in capital investment in new capacity will be inevitable.”
Mr. Pawan Agarwal, Managing Director, Naini Papers Ltd. Mr. Ved Krishna, Vice-Chairman, Yash Pakka Ltd.
Some of the banned items include earbuds, flags, candy and ice cream sticks, polystyrene, thermocol, plates, cups and glasses, eating utensils, straws, trays, wrapping or packaging films, invitation cards, cigarette packets, plastic or PVC banners of less than 100 microns, and stirrers.
The alignment of governance has a huge impact on the adaption of materials and changes the speed of
Mr. Akshay Jain, Director, Silverton Pulp and Paper Pvt. Ltd.
“At Yash Pakka, we are in service to the planet. We firmly believe our role is to build on impact at scale through innovating, producing and disseminating regenerative packaging. We believe human ingenuity needs to ensure the creation of better biomaterials both in terms of pricing and performance. We are completely dedicated to that singular goal.
Although, some large FMCG and agrofood companies have already begun removing integrated plastic straws from small tetra packs of fruit juices as well as dairy products and are beginning to shift to paper-based straws and other alternative sustainable solutions. Some of the leading companies in India coming up with these alternatives include Parle Agro, Dabur, Amul, and Mother Dairy.
– – – – – – – – – – – – – – – –
Below is a brief overview of some of the different replacements from the P&P industry that retailers can use and producers can focus on to address India's Wheneverban.a new piece of legislation impacts large swaths of the consumer segment, it's important to look at the probable effects that may arise. As we turn our backs on single-use plastic, paper is one of the main contenders to take its place. The last few years have seen numerous retailers announce that they are switching to paper bags, while paper-based chocolate wrappers, ready-meal trays and water bottles have also started to emerge.
18 | www.papermart.in / June-July, 2022 PROMISINGFUTURE •••••••••••••
– – – – – – – – – – – – – – – – – – –
“In the war against pollution, the government's directive to ban singleuse plastic was much-needed. It would open numerous opportunities for the paper industry as being an ecofriendly product, paper is one of the best alternatives that can replace plastic bags, straws, and cups among other disposable items. Silverton Pulp & Papers Pvt. Ltd. is a rapidly growing group that holds a diversified portfolio in manufacturing various kinds of papers. We specialise in making the most durable kraft paper from 18BF to 40BF and provide the best quality kraft paper for high-class packaging and paper for carry bags and e-commerce bags. We also manufacture wedding card base paper and cup stock paper. With world-class Infrastructure, we are aggressive in developing new grades for new emerging markets and keep working in the direction of saving forests and the environment!”
– – – – – – – – – – – – – – – – – – – – – –
However, one issue that arises is that most paper companies in India do not manufacture substitutes for any of these items and may be wary to venture into producing them in the near term.
innovation. It is deeply impactful. We completely support any measures that lead to positive change and a better future for humankind. That said, we will need to work harder to ensure that our customers keep receiving better solutions at the capacity needed by them. We will further enhance our efforts.”
I
– – – – – – – – – – – – – – – – –
“Single-use plastic ban is positive news for the paper industry as the opportunity to replace single-use plastic with paper is immense. At Edicon Paper Products, saving the environment has always been a priority. Our papers are apt for all kinds of paper packaging in every sector including FMCG and pharmaceuticals. Not only are our products made from recyclable material, but they can also be 100 percent recycled after use which makes it apt for a sustainable –future!”––––nationwide ban on single-use plastics is a good effort to combat pollution and the perils of global warming. As a company that cares about the environment, welcome this move by the government! bags, packaging films are now Mr. Ayush Bansal, Executive Director, Nikita Papers Ltd. Mr. Dinesh Kavar, Products
www.papermart.in / June-July, 2022 | 19 PROMISINGFUTURE •••••••••••••
– – – – – – – – – – – – – – – – –“The
straws, spoons, trays, and
banned from use, there are numerous eco-friendly alternatives that are available and paper is one of them. We, at Nikita Papers, manufacture various grades of kraft paper that cater to the growing demand for high-quality paper packaging in India as well as internationally. We process waste paper to produce 100 percent recycled high-strength kraft paper with high compression and great folding resistance and toughness even at the lowest GSMs. Our finished kraft paper is put to use as corrugated boxes, paper bags, and paper cups. Paper, in itself, may be one product, but has limitless potential and uses. We thank the present governance for taking ecofriendly actions and helping promote the use of biodegradable products manufactured from kraft –paper.”––––
CMD, Edicon Paper
While plastic
Pvt. Ltd. GETTOKNOWUSCHANGECHOICE PRODUCTHIGHLIGHTS: l Straightpaperstraws l Widerangeofsizes,patterns&designs available l Customizationforyourbrandisalways possible l Waterproofhighqualitypaperensuresno colorbleedinginyourbeverage l Highdurability:staysstiffinliquidsfor upto24hours. Address: B-90, Sector 63, Noida, Uttar Pradesh 201307 Phone: +91 120 499 4532 Mobile: +91 98111 30519 Email: amayapaperproducts@gmail.cominfo@amayapaperproducts.in Website: www.amayagroup.in WemakewiderangeofPaperStraws,PaperBagsand otherDisposableProductsthatarebetterforthe environmentandlastlongerthanyourdrink.
While theplastic bans in Indiaseem to bea turning point forthepaper industry, thechallengesahead with respect tocost & durability to replace. Thus papermakers are devoting time and efforts todevelopadvanced manufacturing technologies for the low-cost production of high-performance products. In addition, self-assembled nanostructures from nanocellulose, e.g. CNP and bulk structural plate, show great promise in replacing plastics for high-end applications.
Dr. Deepak Kumar Khare, Vice President- Raw Material, BGPPL, FIP, Gurgaon
20 | www.papermart.in / June-July, 2022 PROMISINGFUTURE •••••••••••••
Happy to note, Paper industry is gaining its value back with People realising the truth that the “paper Industry is inherently sustainable”. As the government has implemented the plastic ban-SUP from the first of July 2022, newer opportunities for the pulp and paper industries are rising. Paper companies are looking to capitalize on the plastic bans in India by bringing on greener and more sustainable alternatives for consumers.
Indian paper industry is unique in terms of its farmer-friendly approach which has always been acclaimed to generate raw material through its supported farm forestry programmes, “A New Horizon for the Paper IndustryduetoPlasticBaninIndia
– – – – – – – – – – – – – – – – – – – – – –
With the implementation of plastic ban, the demand for disposable paper boxes, paper cups, straws, paper bags, paper cans, and other related paperbased products for food packaging will increase. By this, the paper industry is bringing on multiple alternatives for plastic products and the introduction of paper packaging solutions seems to be the next big step for the industry. Paper industry is ready to take 25 per cent market share of single-use plastic by 2025 if totally banned by the government.
Effectively, we feel that this year, we could see the market for paper-based solutions, in particular, the disposable tableware segment like paper cups, paper plates, etc., having about 25 percent upswing in growth. We expect the segment to clock 17-18 percent CAGR over the next two-three years.”
Mr. Ganesh Bhadti, Director (Operations), Seshasayee Paper and Boards Ltd.
The current ban is on items which have high littering potential like plastic cups, plastic glasses, poly bags, etc.
Mr. Partha Biswas, Chief Sales & Marketing, JK Paper Ltd.
– – – – – – – – – – – – – – – – – – – – – –
The present ban has limited impact on SPB, but may affect the cup stock market. Thus, alternate biodegradable coating chemicals are being explored to retain the product. The new products launched like the Paper bag (kraft bags), Flora have a good market and well received. These are being considered an alternative to SUP. As a part of R&D, the other products in discussion are for the paper straw & paper mulch which are eco-friendly products.”
Though the paper/paperboard industry was always there in these segments, the ban has given the paper industry a tremendous opportunity to move ahead with encouragement, with an assured positive outcome in a potential market of about INR 85-90,000 crore.
“There are a number of emerging opportunities in the paper industry because of the plastic ban. To start with, paper straws will be extensively used as an alternative to plastic straws. These paper straws will not only be used as a substitute for straight plastic straws, but also for U-shaped straws for small aseptic liquid cartons. Moreover, paper bags have the potential to replace all kinds of plastic carry bags. At the same time, candy sticks, which are made from plastics, are also getting banned. Even the sticks of cotton earbuds, which were made from plastics, are getting replaced with paper and other biodegradable sticks. Moreover, plastic cups are getting replaced with paper cups. The cups of various sizes, including 50 ml, or even 500 ml sized cups, which are extensively found in coffee outlets like Barista and Starbucks, will be paperbased. Besides paper, the moulded pulp is also used in making food containers, and tableware. Over a period of time, the plastic food containers/tableware, in which our meals from food delivery platforms like Swiggy, Zomato, etc. are packed, would be replaced with paper-based solutions.
“Single-use plastic ban is a welcome step and a boon to protect the environment so as to give way to the normal course of nature and the chain which gets broken with the presence of polythene which causes menace to the ecosystem and becomes lethal to the organisms into which it gets entangled.
The paper industry envisages and has the capacity to favourably utilise it by about 25-30 percent by way of enhancing paper cup production, producing better quality and improved strength paper bags and bringing other innovative interventions.environment-friendlyThiswilldirectlygive a boost to the environment-friendly image of the industry.
– – – – – – – – – – – – – – – –
Previously, retail markets, malls, and grocery stores were using plastic bags but now the single-use plastic bags would be replaced with paper carry bags either duplex or kraft paper and other environment-friendly packing materials. This is a huge opportunity for the paper industry and many paper mills have already increased their production to fulfill this –demand.”–––––
– – – – – – – – – – – – – – –providing –featherplastic/polythenesustainableenvironment-friendlysolutions.Substitutingwilladdanotherintheircap!”––––––––––––––––––– – –
Bluecraft Agro Pvt. Ltd. manufactures specialty starches, modified starches, and starch derivatives obtained from agro-based commodities. Our wide range of starches functions as beneficial ingredients in various products and industries, including the paper industry.”
“With the single-use plastic ban, the demand for paper would multiply manifold. The paper industry will grow and the paper recycling rate will improve in the coming times. Gradually, people will switch to paper bags for shopping. Paper and paperbased materials would soon be used in the packaging sector, especially in the food packaging industry, including the take-away packaging where the inside contents need to be safe and –non-toxic.”––––––
Mr. Shankar Patel, Managing Director, Sukraft Group
Mr. Vinay Jain, Director, MLM India Ltd.
PROMISINGFUTURE ••••••••••••• www.papermart.in / June-July, 2022 | 23
Mr. Ramesh Vaghela, Head of Overseas Operations, Spento Papers India LLP
Mr. Siddharth Chowdhary, Executive Director, Bluecraft Agro Pvt. Ltd.
“The ban on single-use plastic will give a boost to the paper industry as the demand for paper would rise in the coming times. This ban is a significant step towards building a sustainable environment that we can hand over to the next generation by curbing pollution caused by littered and unmanaged plastic waste.
Mr. Kishan Jitendrabhai Kaila, Director, Bell Multi Kraft Pvt. Ltd.
“As a company that cares about a clean, green, and sustainable ecosys-
– – – – – – – – – – – – – – – – – – – – – –
“Being one of the largest manufacturers of kraft liner board in West India, Bell Multi Kraft believes that there is a need to recycle today for a better tomorrow. The single-use plastic ban is a necessary step to reduce plastic pollution and we welcome this directive of the government. This has also opened endless opportunities for kraft paper manufacturers like us. At Bell Multi Kraft, we produce different ranges of fluting medium, testliner, kraft liner & white top liner that could be used for various market applications such as corrugated board & boxes.”
“This ban on single-use plastic was a long-awaited move that the entire country was expecting from the Government of India. Though there has been a delay, I am happy that the government has finally taken a very good decision. This is a promising time for the paper industry. The way quality of paper is improving day by day, the paper will replace plastic very soon and I don't see any hurdles in the time to come. I am very much assured that an extra quantity is going to be added to the industry. Sukraft Group is already producing food-grade paper, and we are very much ready for this brilliant move by the Government of India.”
– – – – – – – – – – – – – – – – – – – – – –
– – – – – – – – – – – – – – – – – – – – – –
tem, we stand by the government's directive to ban single-use plastic bags, which have harmful effects on the environment. This regulation creates further possibilities for innovative products such as biodegradable plastic that can be made from plant-based ingredients, including maize starch, that have compostable and non-polluting properties. Besides this, it is also advantageous for our business as we anticipate higher demand for paper bags as a substitute for plastic bags and subsequently a higher demand for our modified starches for the paper and packaging industry.
“This is a very welcome move from the Indian Government. A move like this, while looks and sounds like a bitter pill, impacts not only the current generation but also the generations to come. We, at Chuk (Compostables division of Yash Pakka), are working hard towards supporting the country through this shift.
PROMISINGFUTURE •••••••••••••
Mr. Gunjan Saxena, Director, Ecosure Pulpmolding Technologies Ltd.
Mr. Vaibhav Anant, Founder & CEO, Bambrew
– – – – – – – – – – – – – – – – – – – – – –
24 | www.papermart.in / June-July, 2022
–
– – – – – – – – – – – – – – – – – – – – – –
– – – – –
– – – – – – – – – – – – – – – – – – – – – –
Mr. Satish Chamyvelumani, CEO, CHUK Mr. Vijay Baliyan, Director, Amaya Group
Over the last 4 years, Chuk has established itself as the leader in the compostable tableware space with innovative designs and products that are 100 percent backyard Movingcompostable.from single-use plastics to a fully compostable alternative takes not just one company but a multitude of companies to join hands and work towards the shift. To affect this, Chuk is building a network of manufacturing partners via supply of critical raw materials as well as capacity utilisation, while continuing to push the envelope on its design, technology, manufacturing, and supply capability.”
“The paper industry has bright prospects as the demand for paper bags, paper straws and other disposable paper products is set to increase with the single-use plastic ban. At Amaya Group, our mission has always been to make our environment plastic-free and give this country a better way of living. We are known to produce high-quality paper products such as paper straws, twisted handle paper bags and flat paper handle paper bags. Our biodegradable paper straws are printed with food-safe bioink and we ensure that our products remain intact, waterproof and solid for at least 12 hours. We expect to receive more orders for our products in the coming times.”
“We welcome the decision of the government in these trying times, when the world is fighting many severe challenges of not only COVID but also the economic crisis, always the problem of environment takes a back seat, but not this time. We need to understand that the rest of everything can be managed with time but the environmental issues need to be addressed with promptness and on an immediate basis. The ban will not only help in the reduction of plastic wastage but also will prevent production to a large extent. The only and best possible alternative is paper which is proven and scalable too. The paper industry is witnessing its golden era and is on the bull run today. The demand has surged and we are looking at the economy being built in the industry. We feel we should be conscious about the kind of paper being used. More recycled papers will further add up to the sustainability quotient, and Bambrew proudly uses a lot of recycled papers in its products along with Bamboo and Hemp-based papers. There are umpteen possibilities of developing paper from stubble too but we will need to organise and optimise the supply chain. Thus, yes, we foresee a great future for paper and paper products which have the potential to replace almost all SUP from the Today,environment.55percent of the waste generated in SUP comes from the packaging industry. I hope and wish to see many companies coming forward to develop the sack kraft grade papers in India soon.” – – – – – – – – – – – – – – – –
“The single-use plastic ban will give a boost to the pulp & paper industry and is a remarkable step in India's sustainability journey. We, at Ecosure Pulpmolding Technologies, India's 1st and largest sustainable solutions providers, offer micro pulp mills to produce in-house pulp fiber from nonwood resources using chemical-free technology and convert agro-waste into molded fiber pulp products that can replace single-use plastics. With the recent announcement on the single-use plastic ban, many companies across the country are looking for eco-friendly alternatives to plastics and we are looking forward to collaborating with them and support throughout presales, on-sales & after-sales services in terms of design engineering & consulting, capacity planning, mold selections, product quality enhancement, installation, and commissioning of the plant not limited to tableware but also in protective packaging, medical dispoware, and other pulp molded utility articles.”
26 | www.papermart.in / June-July, 2022 PROMISINGFUTURE •••••••••••••
– – – – – – – – – – – – – – – – – – – – – –
“Ever since the Plastic-Ban has come into effect, the pulp and paper industry has become the ultimate replacement source. The industry has been getting a variety of enquiries from all sectors, including – FMCG, electrical & engineering, and HORECA, to name a few.
“Paper has always been a more environment-friendly alternative to single-use plastic in many applications, with more and more environmentconscious users gradually moving towards it globally. With the recent government ban on several single-use plastic items, we expect the momentum to accelerate further. This will give rise to significant opportunities for the Paper Industry, and we expect the demand forpaperto increase inexisting applications, and also in newer ones.”
– – – – – – – – – – – – – – – – – – – – – –
Badruka Exim deals with all of these paper product offerings and is committed to continuously diminish the share of SUPs in the market by playing a crucial link between paper mills and our customers, as well as end users. We as an organisation have always believed and advocated paper and paper products as the future of sustainability and we are here to promote and grow these paper products as successful SUP substitutes to ensure the growth of the paper industry and to tackle the pollution caused by these plastic products on our beautiful planet.”
Mr. Bhavesh Gala, Hon. Secretary, FPTA, and Director, Infinity Industries Pvt. Ltd.
“The countrywide ban on single-use plastics including the manufacturing, usage and imports is certainly beneficial for the whole community, environment, and the future generations. In the recent past, we have witnessed the transition of several FMCG companies, e-commerce majors, etc. toward sustainable or paper-based packaging materials. This recent move by the government will further give an impetus to this favorable trend. Moreover, the paper industry and the whole corrugated boards industry will greatly benefit and grow further as an outcome of the recent restraint on the usage of plastics.”
– – – – – – – – – – – – – – – – – – – – – –
– – – – – – – – – – – – – – – – – – – – – –
“The impact of the single-use plastic ban would be positive on the paper industry. It would increase the demand for paper by approximately 3 to 4 lakh tonnes per annum. As the paper mills gear up to fulfill the requirements in the domestic market, it would give more businesses to local paper traders like us. Paper would soon be replacing plastic straws, plastic food plates, and plastic cups. The packaging used by food delivery services such as Swiggy and Zomato would also be paper-based in the coming times. We will soon see papers of higher GSM. Also, PE coating would be replaced by recyclable barrier coating.”
Mr. Pradyumna Bangur, Director, Raj Dealers & Distributors
Mr. Sanjeev Sureka, President, MPCBMA
The R&D team at the mill is working closely with the customers to develop sustainable and eco-friendly solutions for replacement. Segments like moulded grade pulp tableware, paper straws, high BF carry bags, and primary & secondary packaging in the FMCG products, have already started using paper-based solutions. In these changing times, we foresee the Indian pulp and paper industry to be playing an instrumental role in a GREEN and CLEAN future. There will be some bottlenecks and critical issues to address, but that is what happens in revolutionary times! We are fortunate to be a part of this whole CHANGE.”
– – – – – – – – – – – – – – – – – – – – – –
Mr. Rohit Pandit, Secretary-General, Indian Paper Manufacturers Association (IPMA)
“The government's decision and implementation to ban single use plastic items from July 1, 2022 was a vital step towards sustainability. Our environmental quality is to gain in the long run and so will the Indian paper industry and its stakeholders. The paper industry has already started innovating and experimenting with substitutes for SUP items in all industry verticals with successful paper products already in the market. Almost all the major Indian paper and board manufacturers have a diversified product mix to cater to this large market that had been dominated by SUP items for the longest time. These include paper straws, paper sticks for ear buds and confectioners, water (aqueous coated) based paper cups instead of polycoating, high strength kraft paper for carry bags, ecommerce bags and pouches and there is even a substitute for bubble wrap in paper form that can be used to wrap fragile glassware and jars.
Mr. Parth Badruka, Director, Badruka Exim Pvt. Ltd.
As it is not only a moment of great pride but also a big boost to the women in India's progressing economy, we thought there could not have been a better time to honour the women who are making their mark in the pulp,paper,andpackagingindustry.
T
28 | www.papermart.in / June-July, 2022 WOMENINPOWER •••••••••
he appointment of Smt. Draupadi Murmu as the President of India is the nation's homage to womanhood. From a school teacher to the first citizen of the world's largest democracy, her inspirational journey is a glowing example of women empowerment and a story of struggles, challenges, and heart-wrenching incidents.
According to a report released by Avtar and GE last year, “Women'sworkforceparticipationglobally has been demonstratedtobeapotentdriverof theeconomic growth and development of a country. Research shows that there is a significant association between a country's GDP and female labour force participation.” The report further revealed that women make for 12 percent of India's manufacturingsector,whichemploys27.3millionpeople.While the representation in the sector has increased from 8 percent in 2019, it is still abysmally low. However, the good thing is that companies have now become inclusive and looking to induct women even into job profiles that challenge gender stereotypes. In fact, a whopping84percentofthemalerespondentsbelievedthat the manufacturing, operations, and engineering services sectorwouldbenefitfromemployingmorewomen.
PioneeringWomenin thePaperIndustry
Women are breaking barriers and contributing immensely to every manufacturing industry and pulp & paper is not an exception. Once regarded as maletiondominant,thepulp&paperindustrynowseestheparticipa-ofwomeninbothblue-collarandwhite-collarjobs.
More Women in Workforce Signalling Inclusiveness
Ruchira Papers is a contemporary paper farm in the heart of Himachal. We strive to be among the greenest papermakers in the industry. We manufacture 100 percent tree-free paper using agricultural waste and pride ourselves in our commitment to the environment – not only do we save a tree with every 3000 papersused butalso byreusing agricultural waste andgivinglocalfarmersanadditionalincome.
Ruchira Papers: Striving to be More Inclusive ” “ Ms. Ruchica Garg Kumar, Vice President – Marketing, Ruchira Papers Ltd. Paper Marton this special edition. Thank you forcelebrating a small but important representation of women in the paper sector. It is time to craft the paper industry into a more environmentallyandsociallyconscioussphere.
Meanwhile, with this Editorial Feature, wepresentten leading women whoarealreadyshaking up the industry through their inventions,innovations,orleadership!
www.papermart.in / June-July, 2022 | 29 WOMENINPOWER ••••••••• such strong, close relationships with all my customers and enjoythateventoday.”
The Indian paper industry has come a long way. It is an important sector of the country that has a huge scope for growth. According to the industry body Indian Paper Manufacturers Association (IPMA), paper consumption in India is likely to witness 6 to 7 percent annual growth and will reach 30 million tonnes by FY 2026-27, largely driven by emphasis on education and continued demand for quality packaging of FMCG products, pharmaceuticals, e-commerce, etc. The single-use plastic ban will further act as a catalyst for this growth. The rising demand for paper and paper-based productsisexpectedtogeneratemoreemploymentopportunitiesinthenearfuturepavingthewayforwomenintheindustry.
“Women constitute about 30 percent of our team,” informed Mrs. Rhea Mazumdar Singhal, CEO, Ecoware Solutions Pvt. Ltd., manufacturerof naturally compostable and biodegradable disposable tableware. This indicates that people have started identifying the true potential of a gender-diverse workplace. “JMC hasbeen involved infostering thegrowthof women in the industry for many years. Women are involved in every department at JMC,” added Dr. Yesha Patel, Chief ExecutiveOfficer,JMCPaperTechPvt.Ltd. Women Leading the Way Talking about the paper industry and the specialty chemical industry being predominantly male-centric, Ms. Jyotsana Shrivastava, Senior Vice President, Paper & Packaging Specialties, India, Archroma, says, “The industry is quite male-centric but I must admit that I have never had any difficulty with that – in fact, I have been fortunate to have I would say that my most important advice is to make your mark by fostering professional relationships and building a reputation based on a strong work ethic… I hope to see many more women in the paper industry in the coming years and believe we can all do our bit to make the world a more equal place.
In thepast, women, asacollective, have beendisregarded in the workplace. For centuries, the professional world has been gate kept at almost every level – be it through educational rights or casual misogyny. Despite this, we now find ourselves in the middle of a changing world. The steady incline of representation of women in the workplace has influenced most institutions and the percentages of men who are allies are increasing. The paper industry, being a primarily male-dominated field, is no exception. We, at Ruchira Papers, strive to be more inclusive and make more space for women – and publications such as this one help bolster this necessity. For this, I would like to congratulate
Since 1981, we've taken pride in creating a quality range of papersforwriting,high-volumeprintandpackaging.Ruchira Papers is actively involved in integrating earth-friendly practicesateverystageof theproductioncycle. Ourmaterials come from the earth. Locally-sourced agricultural waste; sugarcane (bagasse), wheat straw and wild grass create the fibersof ourpaper. Ourplantisequippedwithmodernpower and water-conserving features that keep theconsumption of natural resources to a minimum. Our processes are engineered to carefully treat any effluents before they make their way back into the earth. We hold integrity, respect and appreciation for our surroundings at our core while valuing the pursuit of uncompromised quality. From our lands to your hands – we deliver a rich, bountiful range of papers suitableforallprinting,stationeryandpackagingneeds.
As a woman in the workplace, Ruchira Papers has always supported my growth and potential. As a mother, it supportedmyneedforaflexibleschedule. I lookbackatmybiggestperiodsof professionalgrowth–and see that it has been the times when I've been in close contact with the dynamics of the market through our channel partners. I have watched the industry evolve in its business structureand focus. In 2019, theglobal Pandemiccrisis hitso manyindustries,includingours.
Despite the desire to incorporate more female roles in the papercommunity,weseethatsocialprejudicehaslimitedthe number of women who fill blue-collar roles. This is specifically because people make assumptions about the capabilities of women and do not see their careers and desires at the same level as men. As a result, they find it hard to get technicaljobsorrelocate.Thissentiment,however,mustchange. Theprocessof papermaking isbeautifuland ingeniouswhile also being highly scientific and technical. Some argue that because of this technical aspect, specifically the heavy machineryand mechanics – womenare notemployed in this process at the blue-collar level. On the other hand, a few heavy industry stalwarts observe that “It's impressive how women take care of their machines. They keep them clean and don't leave trash in the cabs. If there was a drop of oil coming out of a wheel or something small like that they let you know about it… very thoroughly.” This, of course, suggeststhattheperceptionofwomenoutweighstheiractual Theabilities.otherdeterrentisthelocationofpapermills–specifically because they are typically found in remote regions. This makes it challenging forwomen to situate themselves, either with family or even alone, in these neighbourhoods. Despite this, it is important to note that women's careers are just as important as men's, and we hope to see a trend towards relocationinfavourofawoman'sjob. Additionally, the key to successfully integrating women into your workforce is to ensure that the men you employ do not harbourprejudice. This,of course, issodeeplyingrained into the system – but every step towards equality counts. It is imperative to establish an environment where women operators never have any problems with sexual harassment andbigotry.Themessagehastobeloudandclear–thesiteisa professional sphere and people must hold each other to a professionalstandardregardlessofgender.
Asa team, weat Ruchira, wentall out ingenerating ideasand solving problems with uncensored and nonlinear thinking, usually performed through group participation in a spontaneousdiscussionwhereall ideasare noted withoutassigning them value, and no proposal is selected or discarded until after the conclusion of the creative exercise. All voices were heard. I am proud to say that we were able to ensure that the plant ran smoothly and we were not forced to terminate a single employee. We have nurtured our desire for open thinking and are excited to see more diverse faces and hear a largerrangeofvoices.
Asforwomenwhowanttojointhepaperindustry,Iwouldsay that my most important advice is to make your mark by fostering professional relationships and building a reputation based on a strong work ethic. Setbacks and challenges areanormalpartof life,andweallexperiencethem. Mistakes are a part of the learning process, and they can provide rich material forreflectionand learning. Iwouldalsoadd thatitis important to support the development of the talent around you. Your role and power both set an example for younger women inyourorganisationand pavetheway forthem, too. I hope to see many more women in the paper industry in the coming years and believe we can all do our bit to make the worldamoreequalplace. ¢
30 | www.papermart.in / June-July, 2022 WOMENINPOWER •••••••••
Maintech’s technology has been contributing recycled paper making for more than 30 years. We address various areas of issues in SDGs such as circular economy, low environmental impact, labor health and work safety through our innovative approach. We propose the Best Practice against your problems based on on-site inspection. We are Specialists in Dryer Section Deposit Prevention DRYER CYLINDER SURFACE PASSIVATION BEFORE • OCC Derived Fluff • Production Loss • Quality Problems AFTER • Surface Kept Clean • No trouble Due to Contamination Effective against 100% Recycled Furnish • Corrugating medium •••TestlinerPaperbagDuplex BENEFITS HeatImprovedefficiency SheetReduceBreak CleaningNo SpeedUp PRESENCE IN Japan, Australia,France,Philippines,Thailand,Indonesia,China,Vietnam,Malaysia,India,Spain, USA, Romania, Emphasize, India A LOT OF SUPPLY • More than 800 equipment • More than 260 Machines in 13 Countries www.maintech-papertech.com Maintech Co., Ltd. Marunouchi Kitaguchi Building 2F, 1-6-5 Marunouchi, Chiyoda-ku Tokyo, 100-0005, Japan E-MAIL: endo@maintech.co.jp | TEL: +81-3-5220-4710 | FAX: +81-3-5220-4810 Marubeni India Private Limited Unit No.01, 3rd Floor, Building A-2, Shaheed Jeet Singh Marg, Qutab Institutional Area, New Delhi-110067, India E-MAIL: Shashank-S@marubeni.com | MOB: +91-9672308030 Channel Partner for Indian Market TEL: +91-11-41295555 | FAX: +91-11-41295585
PM:Whatwouldbeyourmessagetoyoungwomen,who wouldwanttofollowsimilarfootsteps?
PG: Challengesweremoreprominentduring thestart-upphase wherepeopledidn'ttakemeseriouslyduetomyage,thefactI am awoman, and PG Paperwasa newcomer in the market. It took around fiveyearsorso toget the industry's respectand I wouldputthatdowntoconsistencyandhardwork.
PG:Themarketisveryvolatileatthemoment,especiallypostCOVID period after 2020-21. Costs for manufacturers are still high, unpredictable, and rising. The logistics costs are very uncertainandequipmentavailabilitystill fluctuates.Theseare tough market conditions for the entire supply chain. Plus the industry itself is going through a rapid change where sustainability is more important than ever before. The graphicalusageisreducingandpackagingisontherise.Bynext year,theremaybesomemarketstability.
PM: In brief, tell us about your journey that led you to thepaperindustryalongwithyourexperience.
PG Paper
PM: What are your views on the paper industry in terms ofchallengesandopportunities?
Paper Mart: Could you present a brief overview of your company and its product portfolio along with your dayto-daylifeintheorganisation?
PG: I would say work hard and stay focused. Try and do your homework before going to the meetings so you have the answers to any questions that are put to you. Respect comes withknowledge! ¢
WOMENINPOWER ••••••••• 32 | www.papermart.in / June-July, 2022
PM: Could you shed some light on the future potential for the pulp & paper industry along with the key trends thatarecatalysingthegrowthofthemarket?
“ ” Try and do your homework before going to the meetings so you have the answers to any questions that are put to you. Respect comes with knowledge!
Mrs. Poonam Gupta, Chief Executive Officer, PG Paper Company Ltd.
PM: Paper mills are generally located in remote areas and considered less lucrative than other sectors. What areyourthoughts?
SuccessWorkConsistencyCompany:andHardaretheKeysto
PG: Itisallaboutconnectivityinanyproductand manufacturing. Paper mills need a large amount of freshwater supply and pulp which makes sense in remote areas. However, if the transport connections and networks are good, this doesn't impact where a manufacturer is located. There can be advantagesinthelocalareaforamilllikeloweroperationalcosts.
Poonam Gupta: PG Paper Company Ltd. is a global paper trading companywith business in 60 countriesand offices in 8 countries. We cover almost all different grades of papers thatareusedandtraded.Thecurrentglobalturnoverisabout INR600crore.
PM: Paper is a predominantly male-centric industry. What are the challenges you strive to overcome every day?
PG: Label and packaging industry is the future with a focus on recyclable and sustainable packaging is where I see the future of the industry. Reducing overall packaging weights, and 100 percent recyclable packaging technologies which may allow for less water consumption can all have a positive impact on the industry. Drawing energy such as heating and electricity through renewable resources and replacement of plasticforpaperareallopportunitiesfortheindustry.
PG: I was exploring the recycling industry during 2002 which wasamuchtalkedabouttopicatthattime.Thatiswhatbrought metothepaperindustry!Theaimthenwastotryandrepurpose or recycle the waste that mills were generating as paper standards formanufacturingareveryhighinwesterncountries.
RMS: Our raw material is waste, so, the concept of waste to wealth is very much embedded in our company vision. After the pandemic, start-ups like Ecoware have become more pertinent because everyone wants disposable as it has less risk of transmitting diseases. Our focus has predominantly been food & beverage, but now, we're innovating with other industries such as e-commerce and pharmaceuticals to help them reduce their plastic footprint. We are also getting a lot of global contract manufacturing enquiries because the worldiskeentomoveitsoperationsfromChinatoIndia We are India's first and largest sustainable food packaging company. Hence, we are seen as the market leaders. Our strengthisthatwehaveall theaccreditationsrequired forany sort of collaboration, whether it is the railways, airlines, or
Currently, we have a team of over a 120 people, 16 sales partnersglobally, 23 distributors in India, and more than 500 point-of-salesshops. Ourclients include majorfirms like the fast-food chain Haldirams and the Indian Railways. In terms of our range of products, we have six different categories including plates, cups, bowls, boxes, trays and cutlery. The Ecoware solution is a sustainable alternative that is 100 percentnatural, biodegradableandcompostable. Madefrom waste of annually renewable crops such as sugarcane, wheat and rice, Ecoware offer all the utility of plastic plus added benefits of being microwave and freezer safe. Ecoware degrades naturally in soil within 90 days and is affordably pricedonparasmostsingle-useplastics.
I am the founderof theorganisation and I work in theareaof business development to create new opportunities for the organisation. Talking about my day-to-day life, exercise is an integralpartof mydayandthathelpsmefocus.
PM: Kindly guide us through some of the key strengths of the brand and your product offerings. What challenges did you overcome?
Rhea Mazumdar Singhal: Ecoware was founded in 2009. With our facility based outof Greater Noida, wecommenced our production in 2010 and created a new category of packaging by using bagasse to make naturally compostable and biodegradable disposable tableware . Our aim was to replace single-use plastics which eventually end up in landfills causing untold damage to the environment and human health. We had three key priorities with safety being thefirst, i.e.,whateverthecompanycreatesshould besafefor people and planet. Our second priority was to be purposedriven and create positive impact. We have generated employment by creating an industry that never existed before. Moreover, women constitute about 30 percent of the team. Ecoware creates around USD 2.5 of Environmental, Social, and Governance (ESG) impact for every dollar invested by the company. We have displaced over a billion piecesof single-useplasticinourjourney. A hundred percent of our revenue is derived by applying principles of a circular economy. The third key priority for us is authenticity, every claim we make against our product is certified. This helps strengthenourbrandandbuildstakeholderconfidence.
Don't limit yourself, you don't have to pick just one thing as long as you are happy doing the multi-tasking.
WOMENINPOWER •••••••••
34 | www.papermart.in / June-July, 2022
Mrs. Rhea Mazumdar Singhal, CEO, Ecoware Solutions Pvt. Ltd.
Ecoware: 30ConstituteWomenaboutPercentofthe Team ” “
The biggest injustice is not trying. I would ask all women to take the first step and pursue their goals.
Paper Mart: Could you present a brief overview of your company and details about its manufacturing facility along with your day-to-day life in the organisation?
WOMENINPOWER ••••••••• FEW OF OUR COMPLETED PROJECTS: CRAFTING PARTNERSHIPSEVERLASTINGONPAPER Reotech Process Equipment Pvt. Ltd. (RPEPL), formerly known as Enmas Pulp & Paper Projects Pvt. Ltd is in the business of design, engineering, project management, manufacturing, supply, erection, commissioning and services of Process Equipment, plant & Systems for the pulp, paper and process industry in the area of chemical recovery and power. The products that Reotech supplies to the Pulp & Paper Industry on a turnkey basis are as follows: Our services for Chemical Recovery Plants: • Black liquour Evaporator plant • Chemical Recovery Boiler • Foul condensate Stripping System • NCG Handling & Burning System (LVHC & HVLC) • Re-causticizing Plant • Lime Kiln • Electrostatic Precipitator • Power Boiler • Design & Engineering Services • Retrofits - Renovation & Modernization • Rebuild & Capacity upgrades • Field Inspection services & troubleshooting • Process studies & Performance Optimization audit • Condition Assessment studies & Health Restoration • Spare parts Seshasayee Paper & Boards Ltd., Pallipalayam, Erode JK Paper Ltd., CPM, Songadh, Gujarat BL Evaporation Plant Capacity Augmentation BL Evaporation Plant JK REOTECH PROCESS EQUIPMENT PVT. LTD. Old No. 484-485, New No. 28-30 1st Floor, Pantheon Plaza, Pantheon Road, Egmore, Chennai, Tamil Nadu 600008 Mail : proposals@reotechglobal.com Tel. +91 4461332100 Web: www.reotechglobal.com TRICHY MANUFACTURING FACILITY Plot No.: 233A/ 7 & 8, Pudukudi village, Thanjavur District, Tamil Nadu - 613402 E-mail: manufacturingfacility@reotechglobal.com Mob: +91 9025400481 Chemical Recovery Boiler - Rebuild & Capacity Upgrade Satia Industries Ltd., Muktsar, Punjab
www.papermart.in / June-July, 2022 | 35 Quick Service Restaurants (QSRs). As the world is moving away from plastics, and looking to create sustainable supply chains and produce betteralternatives, they want to collaboOurratewithus.products sustain a temperature range from -20 °C to 180 °C - that meansyou can bake, refrigerateor microwave them. The products give you a lot of versatility in terms of usage. Besides dining, we also have a takeaway portfolio and that's alsooneof thestrengthsof Ecoware. We did not want anyone to use plastics as better alternatives were available but we had to work really hard to spread this message. Convincingpeopletouseourproductshascertainly been a challenge. However, the credibility that we brought withtimehasgivenusalotof recognition.Ihadthehonourof receiving the Nari Shakti Puraskar, the highest civilian honour for women, from the President of India in 2019. This has allowed me to work at the cross-section of climate change,sustainabilityandwomenempowerment.
Moreover, consumers are constantly changing, evolving, and aligning themselves and their purchasing power to businessesthataremoreresponsible.
Theotherthing Iwould liketomention isthatpeoplewantto make healthy choices when it comes to food. People are turningvegan,goingorganictoconsumehealthyingredients andgethealthynutrition.Theyarethinkingaboutfoodinthe purest form. Hence, you need packaging that truly complements it. You can't be serving healthy food in plastic!
RMS: I think there are various growth drivers in the disposable tableware market. There is a post-COVID opportunity andthereisalotof need fordisposables. Secondly, Indiahasa goodpotentialtobethemanufacturerof suchproductsasthe world moves out of China. Thirdly, the government banned the use of 'single-use plastic' from July 1 and in a way, forced people to start thinking about sustainability as an opportunityandcollaboratewithenterpriseslikeEcoware.
PM: What else can be done to facilitate the growth and consumption of compostable tableware in our country?
RMS:Thebanonsingle-useplasticsontheJuly1 isawelcome step by the government. However, to change a consumption pattern, you need to penetrate all parts of our country. Also, thegovernmentshould lowertheGSTratesfrom12percentto 0 percent to make a product more affordable and encourage massconsumption.
PM: What are the chief growth drivers of the sustainable disposable tableware market?
Archroma is well-known for its innovations and solution systems aimed to help packaging & paper manufacturers to optimise productivity and create value in their markets. We have introduced over 70 systems designed in line with the principles of “The Archroma Way to a Sustainable World: Safe, efficient, enhanced, it's our nature”, for paper, packaging, fashion, technical textile, and many other applications.
PM: Both the paper industry and the specialty chemical industry are predominantly male-centric. What are the challenges you strive to overcome every day? Women today are already advancing into various fields and we see more women now in the paper industry also including on the shopfloorwhich is very heartening.
RMS: I am a pharmacologist. After working for Pfizer in the UK, I moved to India in 2009. I was shocked to see so much plastic being disposed of without a thought of recycling and decided to become an entrepreneur. The journey started as a bitof anexperiment. I neverexpected Ecowaretobewhatitis today but I'm really proud of the threefold impactwecreated andtheliveswehavechanged.
RMS: The biggest injustice is not trying. I would ask all women to pursue their goals. If they have an idea or want to do something, they need to take the first step. Don't limit yourself, you don't have to pick just one thing as long as you are happy doing the multi-tasking. I want to tell every woman out there to use her voice and speak her mind.
PM: Tell us about your journey that led you to this industry along with your experience.
Paper Mart: Could you present a brief overview of your company and its product portfolio for the packaging and paper sector along with your day-today life in the organisation?
‘Industry is Male-Centric but I Never had Difficulty with That’ ” “
Ms. Jyotsana Shrivastava, Senior Vice President, Paper & Packaging Specialties, India, Archroma
Whiletheroutineactivitiesof business managementarepart of my regular responsibilities, my focus is on working closely with our customers and identifying areas where Archroma can add value to their business. Building a robust and sustainable business is critical and for that, it is important thatweareclosetothecustomers,understandtheirchanging needsandcontinuallyinnovatetomeettheserequirements.
¢ 36 | www.papermart.in / June-July, 2022 WOMENINPOWER •••••••••
At Archroma, we believe that we can help transform packaging & paper making by providing solutions that bring value, including sustainable value, whilst optimising costs and resourceutilisationinproduction.
At Archroma, I am responsible for businesses of Paper chemicals, Coatings, Home care and New Market in India, along with textile business for Sri Lanka. The spread of various businesses and markets offer me a unique opportunitytoengagewithcustomersacrossindustries.
Jyotsana Shrivastava: Archroma is a global specialty chemicals company committed to innovation, quality, service, cost-efficiency and sustainability. We serve many markets like packaging & paper, textiles, paints, industrial & construction, and homecare. Archroma isa leaderincolours andspecialtychemicals,withexpertiseinthemanagementof whiteness, coloration, special coatings and strength for all kindsofpackagingandpaper.
PM: What would be your message to young women who would want to follow similar footsteps?
PM: What would be your message to young women, who would want to follow similar footsteps?
The industry is quite male-centric but I must admit that I have never had any difficulty with that – in fact, I have been fortunate to have such strong, close relationships with all my customersandenjoythateventoday.
JS: It's true that the paper industry is perceived as less attractive and this can be a challenge to attract talent to the industry. Most paper mills are located in remote areas and travelling to these sites and getting reasonably good hotels was quite a challenge. However, this has been improving rapidly and we now have many of these areas getting connected by flight too. But I have enjoyed the experience thoroughlyandithashelpedmetoevolveasastrongerperson. I havealsobeenveryfortunatetohaveworked withverygood organisations throughout my career spanning across erstwhile Cibaand then BASF and nowat Archroma. I would like to give credit to my team and industry associates who havehelpedmyjourneytobesuccessfulandenjoyable.
PM: Paper mills are generally located in remote areas and considered less lucrative than other sectors. What are your thoughts?
JS: The paper industry in India has various challenges faced on raw material, energy and infrastructure costs. Despite paper being a sustainable product, the paper industry is still perceived as a polluting and resource-guzzling industry. We have seen the industry has been working on thesechallenges continuously and have come a long way to make paper makingmoresustainable.
JS: My journey in the last 25 years in the area of specialty chemicals and largely in the paper industry has been very enriching and fulfilling. I had not planned to be part of the paper industry but have had the opportunity to work in this industryandhavereallyenjoyedmyjourneyhere.
PM: What are your views on the Indian paper industry in terms of challenges and opportunities?
PM: Could you shed some light on the future potential for the pulp & paper industry along with the key trends that are catalysing the growth of the market?
JS: With only 5 percentof theworld's production shareand a massive gap in per capita paper consumption, the long-term growthof the Indian paperindustry ispromising. The Indian paperindustryisthefastest-growing papermarketintheworld. The packaging industry is booming and we can see so many new plants coming up. Increasing consumerism, retail, and enhanced focus on sustainability are driving the growth. Sustainable packaging is one of the key drivers for the paper industry.Indiahasimposedabanonsingle-useplasticwhichis a boost forthe paper industry. This isa uniqueopportunity for allchemicalsupplierstodevelopsuitablesustainablesolutions andcontributetomakingtheworldmoresustainable.
JS: Women today are already advancing into various fields and we see more women now in the paper industry also including on the shopfloor – which is very heartening. My advice to them is that they should continue to pursue their career in areas of their interest and not get discouraged by somehurdles–theseareeverywhere. ¢
Archroma has recently launched a brand-new innovation in the area of barrier coating for food packaging under our Cartaseal trade name. The new barrier will complement the established Archroma portfolio of coating solutions such as Cartacoat® RM rheology modifiers with FDA- and BfRcompliance for improved runnability, Cartacoat® B range of binders, Cartabond® crosslinkers and Cartacol® surface sizing agentsforimprovedprintabilityofmultipurposepapers.
EnviroWay: Addressing Safety Concerns would Empower Women Workforce “ ” I would say that anybody can achieve anything they wish to – nothing is impossible!...
If the focus, belief and emotions are properly channelized, one would be able to work in a positive manner and can achieve anything in life. Mala Mohini: EnviroWay Bioscience Pvt. Ltd. is one of the premier companies of India in wastewater treatment and reuse, with a strong industrial presence. From inlet (untreated wastewater) to outlet (treated wastewater), we Paper Mart: Could you present a brief overview of your company and its product portfolio for the pulp & paper sector along with your day-to-day life in the organisation?
WOMENINPOWER ••••••••• 38 | www.papermart.in / June-July, 2022
MM: The plastic is now banned and the government will be stricter related to the environment. With that, there lies a huge opportunity for the paper and the textile sector. The challenge is that the paper has to be more advanced to hold the liquid product. None of the products come without packaging. And even in that packaging, one needs togive the manualwhichisagaininthepaperform.
While COVID brought education to digital forms, the education system in India cannot be completely online. It bringshealthissuestokidsinthelong term,andasaparent, I would never want that for the children. Education, in the offlinemode, needsbooks. Hence, therearehugeopportunities in the paper industry. Even as we go to a restaurant or travel inatrain,wewanttohavefood indisposableplatesthat could be thrown. However, we should look forward for more recycled raw materials in the production and reduce the use ofwoodortreesintheproductionprocess.
Regarding the challenges, the competition is tough in the paper industry. Initially, it was easier to understand the dynamics and grow in the paper industry. Hence, a lot of peopleventured into the industry. In 2012-13, the rules were more lenient. However, presently, the government has come up with stringent rules in the direction of their responsibilities towards the environment, and society. This has significantly brought down the profit margin of paper mills. Additionally, after the COVID-19- pandemic, the market has also given them other set of challenges. The positive part is the opening of the global markets. While China has been dominant in the market, the Indian paper industry can also grow significantly if the Indian government provides support and increases the opportunities of paperand paperproductexportstodifferentcountries.This can enable the paper industry to have better profitability. Further, the employment opportunities in the industry wouldalsogrow.
PM: Both the paper industry and the water treatment industry are predominantly male-centric. What are the challenges you strive to overcome every day?
provide a complete portfolio of advanced environmental solutions - products, services and technology. We have provided economical solution to several clients in the pulp and paper industry, such as Bilt, Kuantum Papers, Orient, Sangal, Star Paper Mill, and Emami Pulp & Paper, among Water,others. as the major raw material of the pulp and paper industry, is used extensively during production. We've been providing the paper companies with the solutions to treat wastewaterforalmosttenyears now. Based outof Gurugram, we are technically supported by EnviroWay, Canada. Most of the paper mill owners know our organisation, and they personally know me as well. I am, at present, managing the entire India operation. I'm the single woman here, and around 250 men, of differentexpertise, areworking with me. Treating wastewater is not an easy task as it requires a lot of expertise – the knowledgeof biology, chemistry, mechanical, electrical, civil instrumentation, and automation. Hence, you require a diverse team. I get calls from paper companies when they have the challenges in their treatment plant. I provide them with the solutions on phone, messages, or throughtechnicalvisits.
PM: What are your views on the Indian paper industry in terms of challenges and opportunities?
PM: Paper mills are generally located in remote areas and considered less lucrative than other sectors. What are your thoughts?
MM: In most of the seminars, conferences, and workshops, I happen to be the only woman sitting. People normally get surprised to see me lead it because they all know it is a field work. Women are sensitive, loyal, dedicated to their pursuits, and have the grip and study a lot; however, they have been reluctant to join the paper and water treatment industries because it entails field work. Also, the industry has been reluctant to bring morewomen at the factory level since safety is a concern. Managing the workforce was initially a challenge for me as I lacked the confidence. However, with the experience I have gained over theyears, I have acquired the necessary skills. Now, if they approach me with their water and wastewater problems, I have answers to their queries. With time, I have earned the respectandconfidence.
40 | www.papermart.in / June-July, 2022
Ms. Mala Mohini, COO, EnviroWay Bio-Science Pvt. Ltd.
WOMENINPOWER •••••••••
Clyde Industries is the world’s leading Boiler Cleaning operations expert. Our equipment, technology, field service and knowledge is unmatched in the industry,creatingsignificantvalueovertheentirelifecycleofyoursootblower. Minimize MaximizeDowntimeEfficiency Having Boiler plugging or clinker formation issues? Want to avoid 3 days forced outages? TMHere we come with our SMART Clean Intelligent Sootblowing System for Pulp and paper recovery boiler. Clyde industries customers realize an average yearly plant savings of $1.56 million and avoid 3 days of forced outages. l Clyde have good record in reducing the Sootblower steam consumption to a level below 5% of the boiler steam generation while increasing the recovery boiler throughput. l Increase Throughput and Reduce Operating Costs. • Pays for itself quickly (6-12 months average) • Reduces steam consumption 40% or more • Eliminates forced outages due to tube damage • Improves preventative maintenance planning • Complete integration, compatibility and control • Creates fleet-wide consistency and optimization • Delivers predictable profit margin increases BENEFITS Office Address: Clyde Industries India Pvt Ltd. 22/3, Metropolis #203, Balewadi High Street, Pune, India - 411045 Mobile: +91 7020064687, Email: info.india@clyde-industries.com, Website: www.clyde-industries.com HeavySuperheaterFouling BankGeneratingPlugging Black Liquor Heavy Fouling & Plugging in Recovery Boiler Clinker Rooftopin CarryoverFume
MM: I had a difficult journey. The ownerof the company Mr. Bob Behari stays in Canada and it was difficult to manage his business in India from there. He had seen issues like water logging and otherproblems in Indiaand wanted todo his bit for his motherland, which is why he came up with a natural biotechnology product. In the early 2000s, the industry, as well as the government, was in a transition phase. I took up the control here in 2012. The industries were all located in remote areas and I had to travel for meetings. Moreover, nobody was interested in treating the water because they didn't feel that itwas needed. Thanks tothegovernmentthat came in 2014! The first thing they did was to work for the rivers. During 2013-2014, CPCB had implemented a 'Charter forWaterRecyclingand PollutionPreventioninPulp&Paper Industries in Ganga River Basin' in five identified clusters locatedinUttarakhandandUttarPradesh.Themillsadopted a positive approach and made huge investments to support theentirecharter. A lotof effortshad tobemadeinspreading awareness regarding the chemicals and online monitoring Isystems.appreciate that the paper mill owners are very positive and high-spirited. Since I have been closely working with them for a while, I have seen the financial challenges they underwent. While the government came up with tight rules, they did notcomeupwiththepertinentsolutions.Thecharterwas new and the people were confused. They knew about their paper product but were unaware about the pollution it creates and the preventive measures required. This is where wecameintothepicture!
PM: What would be your message to young women, who would want to follow similar footsteps?
MM: Since the paper industry is water intensive; it needs a bigger land – i.e., extra space for putting up the treatment plant. This is why the mill owners look forward to cheaper lands, which are available in the remote areas. As paper mills work 24x7, the women are reluctant to join and even I have been reluctant to hire them as women safety still remains a huge concern. However, that is not the case for every paper mill. As paper units are old, they're mostly located in the Ganga and river basin states. While initially these were remote, the cities have emerged and the population around the paper plants have grown by 60 to 70 percent. Recently, thegovernment hascome upwith a lotof plans regarding land allocation, infrastructure, transportation, electricity, digitalisation, GST, MSME, start up funds, environmental and safety norms for the industrial units to create an environment for ease of doing responsible business. Thiswill encourage morewomen to joinat factory level forwork.
PM: In brief, tell us about your journey that led you to this industry along with your experience.
WhenIstarted myjourney, IwasstressedthatIwasresponsible not only for me but for over 100 other workers too. However, the more I learned, the morepowerful I became. In today'sworld,it'snottheweapon,whichmakesyoupowerful, it'stheknowledge! Indiahasagoodeducationsystemandthe knowledge can be gained by anyone, irrespective of their gender. I understand safety isaconcern forwomenwherethe governmentcan helpto facilitatewomenworkforce. If that is addressed, more women would be coming out in the field to work.Wecancertainlydowonders!
MM: Initially after independence, we have multiplied in all directions; however, it was not a well-planned, focused, and balanced development. Thecurrentgovernment is focussing on making businesses across various industries into more focused, productive, and responsible by channelizing in every direction. Since I am in the water industry, I have experience of working in association with several industries such as sugar, textile, dairy, paper, and so on. In my opinion, the paper industry, at present, is a highly advanced industry. The paper industry professionals are technically more educated, qualified, and positively co-relate with each other to make the industry units technically and technologically Theadvanced.government should initiate planning for making the industry well-organised for a better future. The paper industry should come under a specific ministry. With a plannedapproach, I foreseeahumongousopportunityinthe Indian paper industry. We are more advanced than many othercountriesand haveampleresources. Being highlywater intensive, the paper mills cannot be set up in a region or a country that doesn't have significant water sources. If the government makes a plan to export the paper products in such countries, the companies in India would have huge opportunities. I hope that magazines like Paper Mart can bridge the gap between the government and the paper industry.
We all have studied the Tortoise and a Rabbit story in the childhood. The moral of the story was that we all can win the race by consistently working hard in the focused direction as theTortoisedid. ¢
MM: I would say that anybody can achieve anything they wish to – nothing is impossible! Theonlydifference between amanandawomanisthatawomanismorelikelytobeonthe softer side, her physical safety becomes the concerns for herself and the employers. If the focus, belief and emotions are properly channelized, anyone can enhance their knowledge, expertise and experience in the professional world in a positivemannerforfutureprofessionalgrowthandsecurity.
WOMENINPOWER ••••••••• 42 | www.papermart.in / June-July, 2022
PM: Could you shed some light on the future potential for the pulp & paper industry along with the key trends that are catalysing the growth of the market?
“The photographs are indicative actual equipment may vary as per requirement” SALIENT FEATURES OF UASB PROCESS: THE FINAL TREATED WATER CAN BE REUSED TO PAPER PULP MAKING AND MOST IMPORTANT REMOVING SMELL TO FINISHED PAPER PRODUCTS. • No need of special startup requirements. • High treatment efficiency. • Generates non-conventional energy in the form of bio-gas. • Low space requirements as compared with other treatment process. • Very low sludge production. • Low operation cost, low electric power consumption. • No moving parts inside the reactor. • Sludge can be stored for extended periods of time. • Auto operations for higher efficiency. Durga Bhawan,A-68, FIEE Complex, Okhla IndustrialArea Phase-II, New Delhi – 110020. EPBX : +91-11-4724 2500 | E-mail: krofta@kroftaengineering.com | Web : www.kroftaengineering.com Krofta Engineering Limited KROFTA INTRODUCES ANAEROBIC TECHNOLOGY
44 | www.papermart.in /
togettheproperacknowledgmentasaleaderinthisindustryas compared to my male counterparts. Although the paper industry is predominantly male-centric, JMC has been involved in fostering the growth of women in the industry for manyyears. Women are involved in every department at JMC, and I hope to see more companies do the same. Additionally, Paperex2022allowedmetomeetmanyexceptionalindividuals whoaresupportiveofmygrowinginvolvementintheindustry.
JMC: Fostering Growth of Women in the Industry for Many Years “
YP: Oneof themajorchallengesfaced bytheIndianpulpand paper industry is technological obsolescence. Compared to international standards, the Indian paper industry is lagging when it comes to the modernisation of plant and machinery. Implementation of artificial intelligence, collaborative workflow management systems, standardised quality control systems, etc. is essential and long overdue if we want to continue growing the Indian pulp and paper industry in Atthecomingyears.JMC,wearetaking measures toremain uptodatewith the newest technological advances by implementing a workflow management system to standardise the manufacturing and machining process. Recently, JMC has also established a professional affiliation with Haber to implement their June-July, 2022 Be confident in the value you bring to the table whether it is creativity, attention to detail, professionalism, or a fresh perspective, among others. Most importantly, uplift other women you encounter in your journey and within the industry as that is what makes you a pioneer for future generations of women.
Yesha Patel: JMC has been a leading manufacturer of pulp and paper machines for over 2 decades. With a state-of-theart facility and workshop area of over 10,000m2, JMC's footprint spans throughout India and internationally. Our recent technological innovations, such as the 10-meter CNC Lathe give JMC the ability to produce products of much higher scale than ever before. Our product lineup includes a steel dryer, air cushion-type pressurized headbox, and highspeed rewinder. The steel dryer, which is made with internal machining, benefits customers by allowing for better heat transfer, lower energy costs, and a more balanced shell thickness. The air cushion-type pressurised headbox allows clients to get the best paper quality with faster and moreprecisecontrolswith low maintenance. Other benefitsof the headboxincludetheuseof fewersparepartsandlowerenergy costs. The high-speed rewinder provides a higher quality of rewound paperrolls, high-qualityslitting, and a betterpriceto-productivity ratio. JMC's mission is to provide our customerswitha'one-stopsolution' toservetheireveryneed and these technology and product innovations allow JMC to Myachieveourmission.dailyinvolvement
”
WOMENINPOWER •••••••••
PM: What are your views on the Indian paper industry in terms of challenges and opportunities?
PM: Paper is a predominantly male-centric industry. What are the challenges you strive to overcome every day? YP: As a young woman in a predominantly male-centric industry, it can often be challenging to establish my presence among theolder, maleindustrialists. Itcanalsobechallenging
Dr. Yesha Patel, Chief Executive Officer, JMC Paper Tech Pvt. Ltd.
in JMC includes managing company organisation structure, delegating and directing agendas, communicating with the management team to determine short and long-term goals, driving profitability, developing strategy, building brand awareness, alliances, and partnerships with other organizations, and developing and maintainingcompanycultureandoverallcompanyvision.
Paper Mart: Could you present a brief overview of your company and its product portfolio along with your day-to-day life in the organisation?
YP: Paper consumption in India is expected to grow at a rate of 6-7 percent annually, with predictions of reaching 30 million tons by 2027. Some key contributing factors to this growth include the increased emphasis on education and literacy, the boom in organised retail (e.g., supermarkets, department stores), and the evolution of e-commerce (e.g., Amazon, Flipkart, Myntra). Although India is the second most populated country in the world, the current per capita paper consumption in India is only 13kg compared to the global averageof 57kg. These numbers highlight that there is an exponential potential for growth and the importance of the Indian pulp and paper industry to capitalise on these key trendsinthecomingyears.
”
PM: Paper mills are generally located in remote areas and considered less lucrative than other sectors. What are your thoughts?
YP: Personally, I believe the paper industry is avery lucrative sector with great potential for growth. As evidenced by the European and North-South American paper market trends, the Indian paper industry has abundant scope for growth. The remote locations of these paper mills provide the potentialforexpansiontokeepupwiththemarket.
“ machines along with installation and commissioning. We manufacture complete paper machines for kraft paper, writing & printing, newsprint, board, and tissue which are designed to provide operational advantages and produce high-qualitypaper.
Artificial Intelligencesoftwarewithinour machines to better serve our customers. The potential for opportunities and growth within the Indian pulp and paper industry is exponential. The combination of the new generation of technologyandthenewgenerationof leaderscanpavethewayforthe Indian pulp and paper industry to compete with the internationalmarkets.
PM: In brief, tell us about your journey that led you to the paper industry along with your experience.
Paper Mart: Could you present a brief overview of your company and its product portfolio?
Saloni Sharma: Saloni Paper Machines Pvt. Ltd has been a partof thepaperindustryin Indiaforover18years, initiallyas erectorsand laterventuring into the manufacturing of paper
Pushing forward past challenges in work and life is, and always will be, a priority for young women and men alike as neither holds a considerable advantage over the other. Keep going and things will fall into place by themselves, as hard work, caliber and proficiency have never been gender-specific.
WOMENINPOWER ••••••••• 46 | www.papermart.in / June-July, 2022
Saloni Paper Machines: Paper Industry Holds
PM: Could you shed some light on the future potential for the pulp & paper industry along with the key trends that are catalysing the growth of the market?
Immense Opportunities for Women
YP: My grandfather was the first one to get involved in the paper industry and now I am the third generation of my family to join the business. My decision to join the industry stemmed from watching both my parents and the rest of the JMC team work diligently and tirelessly to grow JMC into the respected and trusted business that it is. My father, Mr. Rajni Patel (CMD), is a visionary and he has taken JMC to heights unimagined. I, along with other members of the next generation, hope to continue this momentum of growth and spearheadchangeintheIndianpulpandpaperindustry.
JMC is located in G.I.D.C., a remote location known as the industrial hubof Ahmedabad. A prime remote location such asthis hasallowed ustoexpand ourmanufacturing facilityto 2over10,000m withplansforfurtherexpansioninthefuture.
YP: The key to succeeding in a male-dominated industry is surrounding yourself with people and organisations whose values align with your own. Build a reputation based on a strong work ethic, foster professional relationships, and identify mentors who support your growth. The goal is to establishyourself asatalentedand motivated individualwho will be an invaluable asset to any organisation. Be confident in the value you bring to the table whether it is creativity, attention to detail, professionalism, or a fresh perspective, among others. Most importantly, uplift other women you encounter in your journey and within the industry as that is whatmakesyouapioneerforfuturegenerationsofwomen. ¢
PM: What would be your message to young women, who would want to follow similar footsteps?
AIE Fiber Resource and Trading (India) Private Limited 3rd Floor, Megana Towers, Ayyappa Society Road, Madhapur, Hyderabad - 500 081, Telangana, India. Phone: +91 40 6658 3451 www.paperone.com • indiapaper@aprilasia.com
SS: Indeed, paperiscurrentlyalargelymale-centricindustry, but we should not see it as a challenge but rather as an opportunity to be one of the first women to be a part of the industry and hopefully motivators to others who will be joiningusinthefuture, becausethemomentwebeginseeing it as a challenge, it will start hindering our growth. And I personally do not perceive it as a gender-specific challenge butequivalenttothechallengesthateverynewcomerfacesin theindustry.
SS: According to me, automation and data analysis, what we commonly call Industry 4.0 has become very essential for everysectorand industry. As I said earlier, marginsareseeing a steepdecline and sustainability has becomea big question; thus, every aspect of the process has to take care to avoid any undesirable costs which can be done by implementation of centralised data analysis systems like ERP. Further, automation will enable the mills to achieve faster and more efficient processes for the production of higher quality products at lowercosts. Nodoubt, itcallsforahigh initial investmentbut reducestherecurringcostand lossestoagreatextentand has proved to be extremely beneficial in the long term. Hence, a
PM: What are your views on the Indian paper industry in terms of challenges and opportunities?
PM: Could you shed some light on the future potential for the pulp & paper industry along with the key trends that are catalysing the growth of the market?
PM: Paper is a predominantly male-centric industry. What are the challenges you strive to overcome every day?
SS: The biggestopportunityforthepaperindustry istheurge to find a replacement for plastic in India, mainly in the packaging sector. This calls for a high demand for board and kraft paper due to the increasing trend of online shopping and home-delivered food for instance. On the other hand, thechallengeistheavailabilityof rawmaterialsasmostof the packing paper is produced from waste paper. Due to less recovery percentage of waste paper in the country, India is mostlydependenton importedwastepaperwhichcomesasa huge burden on production (in the producer's pocket). The scenario has worsened in the last two years due to the pandemic and later, the Russian invasion of Ukraine. The prices of raw materials have increased drastically due to freight issues and higher dollar exchange rates. Thus, the margins of the paper mills have seen a significant decline as there has not been an appreciable rise in the selling price which could have compensated for the rise in raw material cost. Presently, the procurement and selling in the industry for both paper makers and machine manufacturers have become analogous to dealing in the share market due to the unpredictable fluctuations in the prices. Moreover, the enormous rise in fuel costs has totally disturbed the conversioncostofproduction. But as quoted, necessity is the mother of all inventions; our focus should remain on converting these challenges into an opportunity to grow technologically. For example, many mills have opted for plastic boilers with the required norms and pollution regulations. At the same time, we are seeing much advancement in the effluent treatment plants consideringtheimportanceof waterasoneof themajorresourcesin such a water-intensive industry. These will be the backbone of thepaper industry if weare to move towardsagro & virginbasedpaperduetotheunavailabilityofwastepaper.Theneed of the hour is to have a balance of production and environAlso,ment-friendlyprocesses.transformingchallenges into opportunities could be the present situation of newsprint production worldwide. Although with digitalisation, the demand for newsprint has eventually gone down due to the economic sanctions on Russia there is a latent opportunity that awaits the Indian paper industry. As Russia was one of the biggest suppliers of the same worldwide, filling the void by exporting good qualitynewsprintpaperconsistentlycanbeourtarget.
Ourproductportfolio includes headbox, fourdriniersection, straight through press, bi-nip press, k-type bi-nip, tri-nip press, dryer section, size press, calender section, pope reel section, rewinder, in-house suction roll internals, and many more. We have successfully implemented projects up to 800 MPM speed and 5.5m deckle and are currently working on a new advancement which will be soon added to our product portfolio. We endeavour to provide our customers with the latest technology in paper machines with high accuracy and energy-efficientsolutions.
48 | www.papermart.in / June-July, 2022 WOMENINPOWER •••••••••
Ms. Saloni Sharma, Executive Director, Saloni Paper Machines Pvt. Ltd.
SYNCHROFLYFULLY MACHINECUTTERSHEET 1900S//1700S1500S-HSC PAP-TECH ASSOCIATES&ENGINEERS Representative:IndianAuthorizedExclusive +91-9351649342:AgarwalV.K. pkpaptech@gmail.com:E-mail +91-9610476662:AgarwalRavi ravi201496@gmail.com:E-mail LISTREFERENCE NOS5-BHADRACHALAMITC,1. NOS4-MUZAFFARNAGARGENUS,2. NOS-1MORBIMILLENIUM,3. NOS1-MORBIEDICON,4. NOS10-PRINTERSINDIAN5. Person:ContactChinese Ginny:13166387619 Address: Apartment’sGurushikharC-506, Jaipur-302022Post-Bilwa, (India)Rajasthan
future, automation of machines is going to be one of the cutting edges in the competitive market for which Saloni PMPL is already geared upwiththerequiredskillsetsandstrivestobeyourpartnerin achievingthesame.
Paper Mart: Could you present a brief overview of your company and its product portfolio along with your day-to-day life in the organisation?
WOMENINPOWER ••••••••• 50 | www.papermart.in / June-July, 2022
PM: In brief, tell us about your journey that led you to the paper industry along with your experience.
Shree Rudra Lamkraft: Mantra is to Never Give Up “ ” I would ask every woman to follow their instincts. Anything is possible with hard work. You will fail only if you give up on yourself.
Other key focus areas are proper usage and circulation of water to minimise the odour of the paper as the demand for packaging, especially for food is increasing. Further, energy conservation in terms of fuel (steam) and electricity is a majorpriorityinthemillsforwhichadvancementintechnologywillplayamajorroleasthecostof energyisescalatingday byday.
PM: What would be your message to young women, who would want to follow similar footsteps? SS: My message would be – just do it without thinking and presuming about any gender-centric obstacles. Pushing forwardpastchallengesinworkand lifeis,andalwayswill be, a priority for young women and men alike as neither holds a considerableadvantageovertheother. Keepgoingand things will fall into place by themselves, as hard work, caliber, and proficiencyhaveneverbeengender-specific. ¢
NirjaPatel:ShreeRudraLamkraftisanewlyestablishedpaper mill. Our installed capacity of 60000 TPA, along with modern machinery, world-class technology, automation, and energyefficientsystems isoneof akind. Weproduceabsorbentpaper for now and will further go with sack kraft paper as well. Our Ms. Nirja Patel, Director, Shree Rudra Lamkraft Pvt. Ltd. collectionisfabricatedusing high-qualitywastepaperwhich issourcedfromourtrustedmerchandisers. With the help of our highly qualified team of professionals and our well-equipped production facility, we've also been abletoprovidecustom-madespecificationstofitawiderange of requirementsforourcustomers. We'reentirelycommitted to environmental kindness, and we go to great lengths to ensure that there is norisk to theenvironment. Ouroriginal-
wise choice has to be made by the customers and at the same time, machine manufacturers have to provide a wholesome solution where the mechanical parts are no more just about sturdiness & rolling the paper but together with electrical advancements and automation, resulting in minimising the downtimes and providing operational advantages. This will help us increase the life of the equipment and produce Inconsistentqualitypaperproducts.myperspective,inthenear
SS: My journey in thepaperindustry is totally inspired by my father and founder of Saloni Paper Machines Pvt. Ltd., Mr. Jaikishan Sharma. His incredible drive and passion for paper machinesandpapermakingturnedouttobeacatalystformy interestinthepaperindustrywhich led tomyinvolvementin thedomain. Myworking and learning experiences have been undeniably great so far. I am looking forward to the same in thecomingyears.
Paper Mart: Could you present a brief overview of your 'paper bottle project'? How has the journey been so far?
PM: Kindly guide us through some of the key strengths of your product offerings. As a woman, what challenges did you overcome?
Mrs. Samiksha Govil, Director, Kagzi Bottles Pvt. Ltd.
Samiksha Govil: At Kagzi, we are working to create a bottle made from paper – an innovative packaging technology that mayhelpusachieveaWorldwithoutWaste.Wehavedecided to become part of the solution for a sustainable future. The journey so far has been wonderful. We have been working on making the product 100 percent biodegradable and longlasting. It has been almost 5 years of research and now weare close to commercialising it. We have also started working on otheralternatesolutionstoplasticlikestraws,paperpouches, tubes,etc.Verysoon,wewill launchourproductsinthemarket.
PM: What would be your message to young women, who would want to follow in similar footsteps?
NP: I would ask every woman to follow their instincts. Anything is possible with hard work. The main mantra is to nevergiveup.Youwillfailonlyifyougiveuponyourself. ¢ ity, innovation, competitive pricing, and on-time deliveries havebeenlargelyappreciated.
” Women have proven to be better decision-makers, multitaskers and creative thinkers. This is one of the reasons that despite the challenges, women have reached great heights and have started companies that are already unicorns.
NP: The paper industry in India isagro-based and it requires more land and hence, the mills are located in remote areas. This is one of the reasons why women cannot contribute muchtotheindustry.
SG: The paper bottle is targeting a wide range of brands and liquid-based contents. It will be a pioneering packaging solution for various liquids. A major challenge in the existing, matureand efficient market is thescaling of ourtechnologyto enable the manufacturing of large quantities of paper bottles.
NP:Thepaperindustryisagrowingindustrywithahugescope. Therearemanyopportunities,andonthesamehand,thereare manychallengestoo. Iovercomethemwith myout-of-the-box ideas. Itisamale-dominated industrywheretheratioof males is more as compared to females. Respecting each other's opinionsandmutuallyworkingtogetheristhebreakthrough.
52 | www.papermart.in / June-July, 2022 WOMENINPOWER •••••••••
PM: In brief, tell us about your journey that led you to the paper industry along with your experience.
PM: Could you shed some light on the future potential for the pulp & paper industry along with the key trends that are catalysing the growth of the market?
NP: With the single-use plastic ban by the government, the focus is now more on paper. The paper industry has a bright future. However, the government and businesses need to workhandinhandforthat.
PM: Paper is a predominantly male-centric industry. What are the challenges you strive to overcome every day?
NP: My family has been in the paper industry for years. My father is my inspiration. Being a millennial, it isagreatexperiencetolearnnewthingsandgainthebestknowledge.
PM: Paper mills are generally located in remote areas and considered less lucrative than other sectors. What are your thoughts?
‘We Still Have a Long Way to Go’ “
‘Kuantum Papers has given me the platform to showcase my abilities and empowered me to take on new challenges’ Believe in yourself ! It is your commitment and professionalism at work that define you and not your gender. ”
PM: Kindly shed light on the positive steps taken by the government. What else can be done to facilitate the growth and consumption of such products in the country?
SG: When I started 5 years back, the ideawas tochange liquid packaging from plastic to better alternatives. Looking at various picturesof trash in theocean, I realised the main issue with the environmental hazard is plastic bottles and plastic packets. We had alternatives toplastic bagssuchaspaperbags andcloth bags, butthebottlewasanuntapped market. Even if one productchanged its packaging toa sustainable source, we willmakeahugechange.Istartedmyresearchonpackagingfor shampoosandconditioners.Wastepaperwasmyfirstchoice. I knewthelimitationsithas,buttherewerewaystomakeitwork. With this bleak vision, I started my research on making paper waterproof. I noticedthateverything innaturewaswaterproof such as grass, leaves, bark, lotus leaf, banana leaf, etc. so why can'tweget inspired bysuchthings inourdailylifeand makea lifestyleproductoutof it. Usingegg traysasabase, Icontinued myworkfor2yearsbeforegettingthebottleformed.
PM: As customers are increasingly moving towards sustainability; how do you view paper packaging as a resource-efficient product with the lowest environmental impact?
SG: The rising anti-plastic sentiment has fuelled a growing demand for packaging in all forms that are recyclable, compostable,andbiodegradable.Paperalongwithbioplastic has therefore seen tremendous demand in this shift. Since bioplastic is a newer subject, people are confused about its biodegradability and this has made paper the next best option in packaging. It has many benefits too, such as shelf life, excellent printing substrate which leads to better branding and backyard composting. Wood for the paper is taken fromsustainablymanaged forestsand otherwaste. It is easytorecycleandhasanaturallook/feeltoit.
“
Prachi Sharma: Kuantum Papers Ltd. is one of the leading wood and agro-based paper manufacturers in India and is committed to manufacturing high-quality maplitho, creamwove, copier, and specialty paper. The company has a fully integrated manufacturing facility with the capacity to produce 1,64,250 MTPA of paper. Its plant infrastructure includes fourpaper machines, agroand wood-based pulping
PM: In brief, tell us about your journey that led you to this industry along with your experience.
SG: There are many limitations to women in India. People still see the women in the house to be responsible for the household and kids. Creating a balance of a high-pressure work environment with household duties is a big challenge. But women have proven to be better decision-makers, multitaskers and creative thinkers. This is one of the reasons that despite the challenges, women have reached great heights and have started companies that are already unicorns.Westillhavealongwaytogo. ¢
SG: The government of India has taken huge steps for the growth of paper packaging. Firstly, the ban on petroleumbasedplastichascreatedurgencyinall manufacturingunitsas wellascustomerstolook forbetteralternatives,withthepaper being the first choice. It is cost-effective and the availability of rawmaterialmakesitthefirstchoiceinpackaging.
WOMENINPOWER ••••••••• 54 | www.papermart.in / June-July, 2022
Tohaveaworking barrieris mandatory, butasoften in innovationprojects,weimprovedetailsovertimeaswelearnalongthe waytocreateanoptimalsolution.Thefirst-generationconcept will be partly renewable and fully recyclable, but it is the next and following paperbottlegenerationsbarriersthatwillcreate Asatrulysustainablealternative.awoman,mybiggestchallengeistobalancemyfamilyand kids with work. The priority of my kids will be first and launchinganewproductwiththatisextremelydifficult.
Paper Mart: Could you present a brief overview of your company and its product portfolio?
PM: What would be your message to young women, who would want to follow similar footsteps?
Secondly, the government has launched many forums for new innovations to give birth to better alternatives in packaging. Startup India, incubation facilities, and other grantsgiven by thegovernment hasencouraged everycitizen to think of new businesses and new ideas which will help the countryinthefuturetobecomegloballycompetitive.
streets, a co-generation power plant and a chemical recovery plant. Kuantum's products are extensively used in the printing of books, notebooks, annual reports, directories, envelopes,diaries,calendars,computerandofficestationery. Our product offerings also include value-added specialty products like Azurelaid paper, parchment paper, cartridge paper, ledgerpaper, stiffenerpaper,coloured paper,cupstock and carry bag paper with a GSM range of 48 – 180 GSM. We have a strong network of 100+ dealers spread across the lengthandbreadthof thecountry.
PM: Paper is a predominantly male-centric industry. What are the challenges you strive to overcome every day?
Ms. Prachi Sharma, Associate Vice President (Corporate Strategy), Kuantum Papers Ltd.
The Central government's decision to put a complete ban on single-use plastic products w.e.f. July 1, 2022, is a shot in the arm for the paper industry, as paper is the most viable and sustainable alternative to plastic. Going ahead, you will see a surgeindemandforspecialtypaperduetothiswelcomemove by the government. Kuantum has already been developing new products to cater to this demand like straw base, cupstock with bio coating, biscuit wrapping paper and Oil & Greaseresistant(OGR)paperforfoodwrapping.
PS: Paper consumption in India is projected to grow by 6-7 percent per annum in the next five years so as to reach 30 2022
56 | www.papermart.in / June-July,
WOMENINPOWER •••••••••
PS: Notonly paper mills, manufacturing unitsof manyother sectors are also located in remote areas, but that does not makethemany less lucrative. I recentlyspoketoa new joinee at our plant and asked him about his experience of staying in the residential colony within the mill campus. His prompt reply was, “It's like staying in a resort (because of the greenery) with one big family and I feel that my family is safe and secure!” In recent times, theseso-called remote locationsare preferred by many candidates as they allow them to lead a betterqualityof lifewith their family, with less pollution and lesser commute times, which basically translates into a great working experience. Also, in today's connected world, “remote”isamisnomer.
PS: In India, themanufacturing sectorasawholeispredominantly male-centric. According tostudies, womenconstitute barely 12 percent of the workforce in the manufacturing industry. Whilewomen have made their mark in the services sector& IT,oneof thekeydissuading factorsinhiringwomen in the manufacturing sector is the perceived inability to do hard laboriouswork. The likesof Mary Kom, Mirabai Chanu, and the Phogatsisters (to namea few) havedefinitely proven thatwomenarestrongandhavegreatendurancelevelsbeitin the sports field or at work. Women were and are capable of doinggreatthings!
In addition to this, the implementation of the NEP is expected to furtherprovidea boost to the industryespecially playersinthewriting&printingsegment.
At Kuantum, I am fortunate enough to be part of a team that hasalways treated measan equal and respect thevalue that I bring to the table. My biggest challenge is ensuring that I strike the rightful work-life balance and play all my roles as a womanwithelan.
It is heartening to see that many manufacturing companies are now taking proactive steps in being more inclusive and focussing on diversity while hiring. Women bring collaboration, sincerity, creative thinking, and a sense of semblance to theworkplaceandareinvaluableassetstotheorganisation.
PM: Could you shed some light on the future potential for the pulp & paper industry along with the key trends that are catalysing the growth of the market?
PS: The paper industry, after facing a couple of challenging years due to the pandemic, has started this year on an excellent note and demand wise we are in fact in a better position than the pre-COVID era. There are still some macro hurdles at play likeescalation in the prices of various inputs like fuel, and raw materials and supply chain disruptions. However, the first quarter of FY 22-23 has put things back on course and has paved the way for a much betteryearahead. Order books are running full and mostof the mills have been able to pass on these cost increases via improved NSR's.
PM: Paper mills are generally located in remote areas and considered less lucrative than other sectors. What are your thoughts?
PM: What are your views on the paper industry in terms of challenges and opportunities?
www.papermart.in / June-July, 2022 |
PS: I have been associated with Kuantum Papers and the paper industry for more than 5 years now and it has been quite an exciting journey. In fact, this is my first experience in the manufacturing industry as before this I had worked for more than 15 years in the financial consulting and services sector. Though a CA by profession, Kuantum has given me the platform to showcase my abilities not only in the financial space but has also empowered me to take on new challenges in Investor relations and business expansion and growth strategy. Working with a visionary management at Kuantum has enriched my professional growthandexperience.
Improved standards of living and a more hygieneconscious population will also add to the demand for tissue andrelatedproducts.
57 million tonnes by the year FY27, making it the fastestgrowing paper market in the world. The government's emphasis on education and literacy coupled with the implementation of the NEP will result in a surge in demand for writing and printing paper. The booming e-commerce sector, demand for quality packaging of FMCG products, pharmaceuticals, textilesand organised retail will continue to give an impetus to the packaging paper segment.
PM: In brief, tell us about your journey in the paper industry along with your experience.
PM: What would be your message to young women, who wouldwanttofollowsimilarfootsteps?
¢ WOMENINPOWER ••••••••• Food DeliveryProduct Food Service Food Bags Food Bags E-Com Pkg Corrugating
The next few years will see the paper industry achieve new heights and benchmarks both in terms of financial growth andinnovationinproductsandtechnology.
PS: Believe in yourself ! It is your commitment and professionalismatworkthatdefineyouand notyourgender.
Paper&BoardConsumption andProduction Like other industries, in 2021, pulp and paper showed signs of a strong post-COVID recovery, as paper and board consumption increased by 5.8 percent, outperforming the overall rebound of the euro area GDP. The growth was driven by a renewed customer demand, not only in Europe, but also globally. Paper and board exports increased by 4.1 percent in 2021, exceeding the levels achieved in 2019. COVID-19 accelerated the trends of e-commerce, digitalisation, and work from home and will have long-lasting impacts.
As a result of these positive trends, paper and board production also increased, by 6.1 percent. The pulp consumption increased by 6.5 percent and total pulp production increased by 3.5 percent in 2021 while market pulp output remained virtually unchanged.
FactorsBehindResilienceand StrongPerformanceofEuropean PulpandPaperIndustry
ANALYSIS •••••••
The Production of Speciality Paper and Board has increased significantly in 2021.
epi's annual statistics for theCEuropean pulp and paper industry offer a unique view of the current state of the market for pulp and paper products and the industry's performance. They also allow for an objective analysis of deeper trends behind the industry's resilience.
In 2021, pulp and paper showed signs of a strong post-COVID recovery, as paper and board consumption increased by 5.8 percent, outperforming the overall rebound of the euro area GDP.
The sector's operating rate, the capacity at which paper mills are operated, has reached 90 percent over the year, compared to 85 percent in 2020. Positive trends are also recorded for the first quarter of 2022, with the sector surpassing in the first quarter of 2022 its 2021 first-quarter production levels. The growth was driven by a renewed demand both in domestic markets and globally. Exports exceeded the levels achieved in 2019, registering strong growth in sales to North and South American markets. Currently, 22 percent of paper production from Cepi members is exported.
58 | www.papermart.in / June-July, 2022
TM SPRAYING SOLUTIONS AN ISO 9001:2015 CERTIFIED COMPANY Compound33/16,Site-2,IndustrialArea,HindonAirForceLoniRoad,P.O.-MohanNagar,Sahibabad,Ghaziabad-201007UPIndia Contact:09810636863,09899889855,09910320682,09999070778|E-mail:rahul_basra21@rediffmail.com,spraying.solutions@gmail.com, Info@sidhuindustries.com,sanjivbasra03@gmail.com|Website:www.sidhuindustries.com OURPRODUCTS:•SHOWERS•OSCILLATORS•SPRAYNOZZLES•WEDGEFILTERS•ROBOCLEANERS Prioritising Top-Notch Quality & Reliability. Sidhumatic Robo Jet cleaner is used for cleaning the wire/felts with three jet nozzles to reduce the fresh water consumption with better cleaning of paper clothing on paper machine.
Cepi figures also show that, after significant investments by the sector, the recycling of paper is increasingly performed in Europe; surpassing 50 million tonnes in 2021 for the first time, while exports of paper for recycling decreased by 18 percent compared to 2020. Market pulp output grew by 2.1 percent, supported by dynamic domestic markets.
ANALYSIS ••••••• 60 | www.papermart.in / June-July, 2022
Trends and their Effects on Different Grades
The European paper industry adds EUR 21 billion to Europe's GDP every year.
Cepi annual statistics are developed by an in-house dedicated team and cover the countries represented by the Confederation of European Paper Industries. They are based on data collected from national associations, in between other indicators, on production and consumption. The data quality check is performed following an EU methodology, and the data is audited annually.
“Our annual statistics are proof of the
Resilience and Recovery
The crisis of the COVID-19 pandemic also accelerated certain trends, observed over the past decade. The rise of e-commerce boosted the paper and board packaging market, while it benefited from the substitution of other solutions, often triggered by the EU Single-Use Plastics Directive.
For the paper and board consumed, the recycling rate was 71.4 percent.
The production of packaging grades reached an all-time high in 2021, increasing by 7.5 percent compared to 2020. The most impressive growth was registered for the production of wrapping grades, used for paper bag production, which increased by 11.6 percent. It benefitted from the EUbacked phase-out of plastic packaging.
The production of paper & board recovered from the recent instability and increased by 1.5 percent over the first 4 months of 2022. With a more stable demand from publishers, offices and commercial printing, the overall output of graphic grades grew by 1.7 percent. The production of sanitary and household grades increased by 1.0 percent with the gradual recovery of the 'away-fromhome' market. The production of speciality paper and board has increased by 2.7 percent.
Another COVID-related effect on paper markets has been the development of the hygiene market segments. Demand for paper for sanitary uses has seen a correction effect, with the peak of the pandemic now behind us, and it should benefit from higher hygiene requirements over the long term. Graphic paper markets have, after a very negative impact in 2020, bounced back in 2021. Speciality paper & board production grew significantly by 2.7 percent, but with heterogeneous developments according to segments.
ANALYSIS ••••••• www.papermart.in / June-July, 2022 | 61
resilience of this industry and unique attributes of paper and fiber-based products. Amongst the European industries, the pulp and paper sector remains in the leading position for its recycling performance, use of renewable energy, energy efficiency and sustainable sourcing. These are key to our capacity to develop rapidly in new markets”, says Mr. Jori Ringman, Director-General, Confederation of the European Paper Industries (Cepi). ¢ The use of paper for recycling purposes has also risen 5.8 percent to reach 50.7 million tonnes.
The workshop, held from July 25 – 27 at Sharanpur, saw many renowned faces from the paper industry.
The keynotespeechwaspresented by Dr. R.C. Rastogi, CMD, Khatema Fibres Ltd. “This year marks the completion of my 50th year in the paper industry. Today, waste paper-based paper mills take up 70 percent of the total paper mills in the countrywhilewood-basedpapermillsareabout20percentor so. Nowadays, chemical recovery has improved a lot compared to theconditionsof about 25 yearsorso. CPPRI, aswell as IPPTA, have immensely benefitted the situation of the paper industry,” he said, adding that the government should formulate policies after considering the problems of the paper industry so that the industry becomes competitive both – locally and internationally, and achieve further Whilegrowth.appreciating the efforts of the integrated pulp and papermillstowardssocialandfarmforestry,heinformedthat the industry representatives/associations have been discussingwiththegovernmenttoformulatepoliciestomake degraded lands available to the industry and encourage the farmers to contribute to developing such forests. He further added that if bagasse is madeavailableprofuselytothepaper industry, around 100 percent of the problems related to raw material will be solved. “This would also reduce our import
ndianPulpand PaperTechnicalAssociation(IPPTA)andICentral Pulp & Paper Research Institute (CPPRI) jointly organised a workshop on 'Benchmarking in Pulping, Bleaching & RecoveryOperation in Indiavs Global Standard' at CPPRI Campus, Saharanpur from July 25 to July 27, 2022.
The workshop aimed at addressing the current challenges beingfacedbythepaperindustry.
In the welcome address, Dr. M.K. Gupta, Chairman –Program Committee, Director, CPPRI set the tone for the proceedings and thanked the team of CPPRI and IPPTA. Mr. M.K. Goyal, Honorary Secretary General, IPPTA, presenting theoutlineof theworkshop,said, “Wecameupwiththetopic on pulping, bleaching, and recovery technologies – which form the backbone of the pulp and paper industry. The operations of these three verticals of the paper industry are becoming very important. In the last two years with the global crisis, we have seen that the prices of waste papers are goingupsignificantly.Thisishowwecameupwiththetopic.”
62 | www.papermart.in / June-July, 2022 EVENTHIGHLIGHT ••••••••••••
IPPTA, CPPRI Organise Workshop on Pulping, Bleaching & Recovery in Paper Mills
“Similarly, if one can improve in any of these three areas –pulping, bleaching, chemical recovery, it will be regarded as a greatdealof contributionmadebytheseminar.Thesingle-use plasticis banned bytheGovernmentof Indiaas itwas harmful to the environment. If we consider the global scenario, the conceptofsingle-useplasticisverydifferentinwesternnations as compared to our country. Also, it is important to note that PE-coating, which is done on paper and paperboard, is also banned. The e-commerce players like Amazon, Myntra, or Flipkart – have also started replacing their plastic packaging withpaper-basedpackagingsolutions,”headded.
Other guests of honour in the session were Dr. RM Mathur, Ex-Director, CPPRI, Dr. Bipin P. Thapliyal, Ex-Director, CPPRI and Dr. Sujay Chattopadhayay Professor & Dean, IIT Roorkee, Saharanpuramongothers.Theworkshopsawmany renownedfacesfromthepaperindustry.
The processof bleaching becomesacauseof deterioration of mostcellulosefibersand leadstoadecreaseinthestrengthof the fiber, pulp, and paper. Ozone bleaching is a hot topic in the paper industry, which eliminates most of the bleaching chemicalseitherpartiallyorfully. However, wecannottotally depend on ozone bleaching, because its uncontrolled action can damage the fiber quickly as compared to any other bleaching chemicals. Therefore, the enzymes are the best solutionswithalmostnoharmtoanyfiber.
EVENTHIGHLIGHT •••••••••••• 64 | www.papermart.in /
June-July, 2022
Presenting the presidential address, Mr. Ganesh Bhadti, President, IPPTA, and Director (Operations), Seshasayee Paper and Boards pointed out, “When the COVID-related challenges subdued, and we all thought that the industry is now performing well, the coal shortage crisis came up. With regard tosolarenergyorotherformsof renewableenergy, we have not developed that kind of capacity that can be substituted or fulfill the energy requirements in place of coal. All these integrated mills should know how to utilise the raw materials, and how to maximise the yield. This is why we chose this topic for the workshop – amid the ongoing shortage of coal and energy resources. While the challenges will always be there, we should brace ourselves for them. We are striving to provide solutions to the present challenges through the workshop and would continue to address the challengesinthefutureyearstoo.”
Mr. Ankur Bindal, Director, Bindal Paper Mills Ltd., who was thechiefguestattheworkshop,presentedtheinauguraladdress, cookingtechnologiesconditionspapermaking.Anhardwood,“Intoday'sscenario,manydifferentrawmaterialslike–softwood,andagroresiduesareavailableinthepaperindustry.appropriateselectionofrawmaterialsisrequiredforbetterToprotectthecellulosecontent,pulpingshouldbestandardisedandoptimised,andmodernwithlesseruseofhazardouschemicalsintheprocessshouldbeadopted.
The inaugural session was followed by technical sessions on advancement in the pulping process, benchmarking of energy management & process and advancement in the chemical recovery process. The sessions on the next day witnessed discussion on case study on bleaching process, benchmarking kraft mill & raw material, non-process elementimpact&remedy,processvariability&improvement – pulping, chemical recovery, and recovery boiler. The threedayworkshopconcluded with thepresentationof mementos andavoteof thanksbyMr.M.K.Goyal. ¢
Dr. R.C. Rastogi, CMD, Khatema Fibres Ltd. Mr. Ankur Bindal, Director, Bindal Paper Mills Ltd.
We all know that recovery is needed to maintain sustainability in the papermaking process. We have to maintain high solids content in the black liquor so that we are able to maintain lesser steam and chemical consumption to increase sustainability. Most paper makers are well aware of how to produce high-quality papers at low operational costs. Although there are a number of issues about which our renowned scientists and researchers should put their minds together and find pertinent solutions. We should also work on being independent in terms of our raw material requirements including chemicals, and reduce our dependence on imports. Innovations are never-ending processes and we will have to find better solutions than earlier for maintaining a sustainable process,” hesaid.
dependence on waste papers. In this way, we would not only be saving foreign exchange but also providing good-quality paperandpaperproducts,”hesaid.
aber provides automated, AI-driven solutions toHgenerate accurate, real-time insights and help industries manage their process more efficiently. In an interview with Paper Mart, Mr. Ram Santhanam, Director-Engineering at Haber throws light on the importance of water treatment in the paper industry and how Haber, through its innovative approach and AI-driven automation services, is transforming this space. Chemical applications through AI-based control have enabled paper mills to generate accurate and real-time insights which pave wayforefficientprocessmanagement.
Dischargenormsaregetting tighterbythedayand thosewho arenotpreparedtohandlewaterrecyclingissuesfaceproduct qualityissuesaswell.
Secondly, taking a panoramic view of the situation is imporHaber: At the Forefront of AI-driven Water Treatment
PM: What do you think are the limitations or challenges in the current system followed in the industry?
Paper Mart: Given the current situation can you elaborate on how critical water treatment is to the paper industry?
INTERVIEW ••••••••
Newer markets and product developments and their chemistriesimpacthowwaterisfurthertreated.Forexample, withtheincreasing pressureon banning plastics, theworld is looking up to the paper Industry to provide food-grade replacements which will bring in demands both from product quality that are safe and internal water treatment
Manyperspectives.millexpansion plans are on hold mainly due to thoughlimitationsonwaterallocationsordischargerestrictionseventhepapermarketiswitnessingrobustgrowth.
66 | www.papermart.in / June-July, 2022
RS: As we see it, the knowledge gap is one of the primary impediments today. Traditional water treatment methods or knowledge is not adapted innovatively to meet paper Industry challenges, where both the volumes treated and qualityaspectsaresignificant, leading to high treatmentcost projectionsandabortedprojectplans.
RamSanthanam: Nexttorawmaterialcosts,watermanagement is becoming the primary talking point in the paper industry. Changing climatic conditions significantly impact mills thatusesurfacewater, and thoseusing groundwaterare facing increasing draw restrictions or quality issues.
Mr. Ram Santhanam, Director-Engineering, Haber Measurement is the first step to control. Measure-Analyze-Automate is the next evolvement in Industry 4.0, and these are even becoming the norm in compliance management today, where key water parameters are being asked to be transmitted to the central grid in real-time.
Automationwouldbethebiggestlevelerinanindustrywhere variations are the norm in the process – grade changes, breakdowns, boil-out happen all the time and it would be naïvetothinkthesecould behandled manuallyandstill keep a firm grip on your water handling. Plain automation alone wouldonlydumpmoredataand maynottranslatetobenefits unlesscombinedwithstrongprocessexpertise. Haber offers this combined water and paper process knowledge packaged into their adaptive automation. I call this adaptive automation, as this overcomes hardware-intensive linear automation that would periodically add costs to obsolescence. Haber also specialises in shifting the automation costs to a production-driven revenue model instead of CapEx, where mills continuously evaluate us on a Pay-uponPerformancemodel.
PM: Is automation the way ahead to accelerate the growth of the industry globally?
RS: Industriesworldwidehavecommitted totheIndustry4.0 transition, and this would be the beginning of a new datacentric Industrial revolution. I would not be surprised if it becomes a norm in the future to identify yourself as a practitioner of this model, similar to what we do with ISO certificationsinmanufacturing. As with water management, it would need differentiated technologies to break new ground and Haber is at the forefront in bringing the ever-evolving expanse of AI applicationstoprocessindustryautomation.
Transitioning from certain low-hanging fruits to complex ones in a sequence helps matters. Changing water treatment plans with changing administrative scenarios or laws can makethemillgoincircles. Withextensive knowledge inwater, utilitiesand paperprocess systems,HabercanhelpinconductingaMill-wideWaterAudit [MWA]andcreatearoadmapanddetailedplans.
RS: Measurement is the first step to control. MeasureAnalyze-Automate is the next evolvement in Industry 4.0, and these are even becoming the norm in compliance management today, where key water parameters are being askedtobetransmittedtothecentralgridinreal-time.
INTERVIEW •••••••• Manufacturers of : • Doctor Blades • Doctor Holders • Doctoring Systems Address: Cell: Email: Website: • Doctor Oscillation Systems • Felt Stretchers •Autoguides Plot No.19, SR.NO.2608, Shanta Gulab Industrial Park, Besides Damanganga Industrial Park, Karvad, Vapi-396193 +91 9898130415, +91 www.rs-engineers.comsales@rs-engineers.comayaz@rs-engineers.com,9227830415 R.S.ENGINEERS
PM: How do you think the adoption of world-class automation solutions can help the industry?
www.papermart.in / June-July, 2022 | 67 tant, where mills must make a medium-term vision of zero liquid discharge. The key lies in making a roadmap and then taking small and assured steps in the right direction.
MJ: BASF India Ltd has completed the installation of a state-of-the-art dispersions production line in Dahej in 2022 Q2, serving the coatings, construction, adhesives, and paper industries for the South Asian markets.
BASF: Creating Chemistry for a Sustainable Future
The new production line complements the existing setup and allows the production of new dispersions technologies under Styronal® PLUS 7918, Styronal® ES series, Basonal® FCB, In paper coatings, we continue to drive improved cost-in-use solutions. Styronal® PLUS 7918 is our high-strength product that allows a substantial reduction of binder usage.
MJ: Sustainability and food safety have become more prominent topics in the packaging industry. Higher requirements for food packaging coated grades are being seen in the Asian market. As India is one of the leading producers of coated grades for food packaging, it needs to bring new sustainable approaches to meet the ever-increasing food safety regulation requirements. In addition to that, paper and board customers are also facing huge challenges from their end users including printers and convertors who want to deliver super low odour binder for their coated board grades during their printing & converting process while maintaining excellent printing quality. To respond to the current market needs and to address the challenges of the customers, BASF has recently developed a super low odour binder, sustainable topcoat binder and revolutionary high strength binder. These lattices meet the challenging requirements for sustainability and food safety and other requirements needed for the high-quality coated paper and board. Besides GB9685, this new range of lattices also complies with all other relevant standards including European Commission, FDA, and BfR.
ASF is one of the world's leadingBchemical companies. With its corporate strategy geared towards innovation; the company caters to almost all industries and develops processes, technologies and products for a sustainable future. It is one of the leading suppliers of binders and additives for the paper and packaging industry. In a joint interview with Paper Mart, Mr. Milind Joshi, Business Director - Dispersions, South Asia and Mr. P Balakrishnan, General ManagerPaper Chemicals, South Asia, BASF India Ltd. discuss recent developments in the company and their views on the Indian paper industry. Please tell us in briefPaper Mart: about BASF and its product portfolio in the paper industry.
BASF began production of polymer dispersions in Dahej in October 2014, and this additional production line will almost double the capacity.
68 | www.papermart.in / June-July, 2022
Milind Joshi: At BASF, we create chemistry for a sustainable future. We combine economic success with environmental protection and social responsibility. Around 111,000 employees in the BASF Group contribute to the success of our customers in nearly all sectors and almost every country in the world. Our portfolio comprises six segments: Chemicals, Materials, Industrial Solutions, Surface Technologies, Nutrition & Care and Agricultural Solutions. BASF globally generated sales of EUR78.6 billion in 2021. BASF is one of the world's leading suppliers of binders for the paper industry. We offer a wide range of Styrene Butadiene and Styrene Acrylic dispersions to our customers, including specialty and tailor-made grades for specific requirements, under the wellknown brand Styronal®, Acronal® & Basonal®. Our innovative solutions help our customers to meet the critical requirements of printing, packaging & converting industry
MJ: BASF is committed to the paper industry and recently expanded its Dispersions production capacity at its Dahej manufacturing site in line with the market demand. As a global supplier of polymer dispersions, BASF is committed to ensure the supply of high-quality products supporting our customers' expansion plans. The Indian market is one of the fast-growing subregions within the Asia Pacific region. Our customers are looking for global partners like BASF, who can bring innovation and expertise with its extensive footprint to help them differentiate in their markets.
Mr. Milind Joshi, Business DirectorDispersions, South Asia, BASF India Ltd.
PM: Please shed some light on the recent developments and your expansion plans.
PM: As BASF India has recently expanded the production of dispersions at the Dahej facility; what kind of plans do you have for the paper industry?
INTERVIEW ••••••••
PM: Since food safety and sustainable solutions are important in the paper industry; what's your perspective on the same and how does BASF address this requirement?
-
P Balakrishnan: BASF has a comprehensive state-of-the-art R&D facility in the innovation campus in Shanghai and in Mumbai, where we are able to carry out cross-functional research and development projects. In conjunction with this, we also have wide experience and in-depth knowledge of paper coating and its impact on the final coated paper & board properties of high-speed printing and converting. This unique combination enables BASF to have innovations/developments to offer step-forward technology for developing high premium grade lattices. In our solution, we want to provide a step-forward change in our latex. New technologies and innovative technical approaches are incorporated into the development of these lattices. For example, on the compliance and foodsafety front, while keeping abreast with regulatory changes, we identified and eliminated non permitted food contact additives for compliance and odour impact in the final product. This development has benefited the high-end segment coated grades. High solids latex is very rare in the paper coating industry due to its unique challenges in inherent viscosity and latex stability.
PB: Indian paper industry has huge potential growth in the coming years. The pandemic has shown consumers the convenience of working from home. There has been a drastic need for food packaging. Also, e-commerce will increase immensely. In addition to this, the recent single-use plastic ban will drive innovation for sustainability more rapidly. As one of the leading suppliers and partners of choice of the coated paper and board industry, BASF is well positioned on the technological front, as well as a wider portfolio range to support growth and address customers' challenges.
www.papermart.in / June-July, 2022 | 69 new development, sustainable topcoat latex will have solids content of more than 55 percent. This step-forward approach would have a positive impact on technical performance and huge commercial advantages.
PM: Please outline the company's unique expertise in developing high-quality lattices for the paper and packaging segments.
BASF's
PM: What is your viewpoint on the Indian paper industry with respect to – the potential and the opportunities for BASF?
Mr. P Balakrishnan, General Manager Paper Chemicals, Asia, BASF India Ltd.
South
INTERVIEW ••••••••
Works & office: Plot No. 5314, Phase IV, Ramol Cross Road, G.I.D.C. Vatva, Vatva,Ahmedabad - 382445. (Rajesh Desai) +91 9825042710, 9227225579 E-mail: dsengineers_raj@yahoo.com / dspl@ymail.com D.S. Pulp & Paper Machinery Pvt. Ltd. D.S. Engineers Mfg.: Paper, Pulp & Cement Plant Manufacturer of : Complete Paper Machine from conveyor to Rewinder • Duplex • Multi Layer Kraft • Kraft • Newsprint www.papermillmachineryindia.com | www.papermillindia.com
eginning its journey in 2009, Precise Castings Pvt.BLtd. is a noted manufacturer of rubber-coated rollers for the paper industry. With a fully-equipped steel melting shop and machine shop for casting pipes and manufacturing other raw materials, Precise has made a name for itself in the market of quality steel castings. Being one of the pioneers to develop pulp molded tableware manufacturing machines in India, the company manufactures and supplies a range of – pulp molded tableware machines, trimming machines for finishing of pulp molded tableware, special alloy steel castings for companies like ISGEC and BKT, and suction roll shells for the paper industry.
Daksh Singal: Precise Castings Pvt. Ltd. was started in 2009 as a backward integration of Amar Elastomers Pvt. Ltd. for its needs forspecial castings for making heavypress rolls for the paper industry. We have a fully equipped steel melting shop and machine shop for casting pipes and manufacturing other raw materials for our group company. We are equipped with the necessary inhouse capabilities to manufacture the complete machines under one roof… This is one of the major pillars which enables us to provide the customers with timely delivery and all the qualityrelated checks.
In a conversation with Paper Mart, Mr. Daksh Singal, Director, Precise Castings Pvt. Ltd., sheds light on the beginnings of the company, the infrastructure setup, technological capabilities, types of products manufactured, and an outlook on the pulp molded tableware segment.
Growth Potential in Molded Fiber Segment
Precise Castings – Seeing Great
Mr. Daksh Singal, Director, Precise Castings Pvt. Ltd.
70 | www.papermart.in / June-July, 2022 INTERVIEW ••••••••
Paper Mart: Could you please give us an overview of Precise Castings Pvt. Ltd. and its business journey?
PlatenSize 1000mmx950mm FormingType TopForming HeatingType ThermalOilorElectric Max.Pressure 30TonHydropneumaticCylindersaccompaniedwithtwopneumaticcylinders Max.ProductHeight 80mm ControlBy PLC+Touchscreen DesignedCapacity 400-500KG/Day Remarks stress*AllPartsincontactwithpulpwillbeofS.S.304*CompleteS.S.304covers*RigidrelievedM.S.squarepipeframe INTERVIEW •••••••• 72 | www.papermart.in / June-July, 2022
of Pulp Molded Tableware
Inoursemi-automaticmoldedfiberproductionmachine,the pulp is molded into different products like plates, bowls, trays, etc. The machines are developed using advanced technologiestoeliminateholes,anduneventhicknessduring production to reduce defective goods. The semi-finished product will be moved to the hot press station for mold drying. The product taken out from the hot press undergoes Structure
DS: Precise Castings is the first company to develop pulp molded tableware manufacturing machines in India. It started three years back when we went to China to buy these machines for setting up our own tableware manufacturing plant. However,aftervisiting China,wediscerned theneedto manufacture these machines in India to meet the growing demand for molded tableware solutions which will further increaseamidtherecentplasticban.Sincethen,wehavebeen manufacturing these machines and have supplied 25-30 machines to different plants which are running up to the expectationsofourcustomers.
Machine
With experience spanning over about 40 years in the paper manufacturing industry, our Managing Director Mr. M.P. Singal hasbeenadrivingforcefortheorganisation. Underhis able leadership, we have developed pulp molding machines for manufacturing biodegradable tableware from bagasse pulp to replace single-use plastics and thermocol which are harmfultotheenvironment.
PM: Tell us more about your factory – infrastructure, product portfolio, technology, manufacturing capabilities, investments, etc.
Precise has also made a name for itself in the market of quality steel castings. Since then, the journey of progress started as per the requirements of our customers. The capacityof furnaceswas increased tocastasinglepipeup to 16 tonnes and shafts, with special alloys like SS 304,316, duplex steel, copper, MS, bronze, cast iron, etc., and equippedwithall typesof testingequipment.
The product portfolio includes – machines for manufacturing pulpmolded tableware, trimming machinesforfinishing of pulp molded tableware, special alloy steel castings for companies likeISGECand BKT,and suctionroll shellsforthe paperindustry.
PM: Kindly shed some light on the specifications and unique features of the bagasse fiber molding machines supplied by Precise Castings.
The pulp stock supply chest moves the pulp continuously to thepulpforming machines. Forming isthekeyprocess inthe tableware production line. The process isquantitativelypulp supply using a deposition method, back flushing air supply, vacuumdewatering,andforming.
The non-wood pulp of sugarcane bagasse, rice straws, bamboo, wheat straw, etc. is bought and converted into pulp slurry. Then, waterproof and oil-proof additives are added to it. Afterwards, the pulp slurry is sent to the pulp slurry chest.
There are two centrifugal casting machines for manufacturing pin-hole free castings with a higher density and with bettergrain structure. Outof those machines, the biggerone can handle a weight of up to 30 tonnes. In the engineering section, the company is equipped with 5 vertical turning lathes, 2 horizontal boring machines, several lathes of size from2 metersto10 meters(one6-meterCNC lathe), 1surface grinderof 10 meters, O.D. turning and I.D. turning machines forpipesupto6-meterlength,2CNCgundrillingmachines,1 cylindrical roll grinderof 10 meter, plano-miller, radial drills, andsomanyotheraccessoriestocount.
DS: Over time, our infrastructure and technology have also grown and have been upgraded from time to time. The companyisspreadoveranareaof overfiveacresof land (with a covered area of nearly 70,000 sq ft) and with 40 tonnes handlingoverheadEOTcranes.
Easytohandle3Pcs.Structure1.FormingStagex1inthemiddle2.HotpressingStagex2onthetwosides
Product portfolio
ManufacturingSpecificationsProcess
Delivering profitable solutions to Paper Industry Office Address: Plot No, 99/3, Flat No, 1, Aryan Heritage Apartment Sector 16, Chikhali, Pune Maharashtra 411 062, India Factory Address: Plot No.B 114, MIDC Chakan Industrial Area Phase 2. Bhamboli, Tal. Khed, Pune, Maharashtra 410 501 E-mail: aspireengineeringpune@gmail.com | Mobile: 9225321201 / 9511889020 •PRODUCTSPolyDiscFilter / Vaccum Disc Filter • Various Types of Sector, Sector Holder, PP Bags & Spares for Poly Disc Filter • Britol Former Auxiliary like Octopus Header, K-frame, Sevall, Pivot Box, Couch Roll Etc... • Recycled Fiber line & Stock Preparation Equipments • Cylinder Mould
Having our own in-house designing and engineering department helps us to work on the regular research & development activities to develop an innovative and better productforourcustomers.
DS: We have a very positive and wide outlook regarding the potential of the pulp molded tableware industry as disposable tableware has become a very necessary consumer product nowadays. After the plastic ban by the government, the demand for these products is increasing multifold. These kinds of products are majorly used in social gatherings such as weddings, parties, religious functions, and even in big corporate offices and railways, airlinesaswellasairports.
Moreover, our longstanding experience in the pulp and paper industry helps us to understand the importance of different processes at various manufacturing stages.
PM: Considering the surge in the fiber-based packaging market due to the recent ban on single-use plastics by the government; how do you see the market evolving in the future? What is your outlook regarding the potential of this segment in India?
an edge-cutting machine where the extra edge will be Aftertrimmed.this process, the product is ready for a quality check. Here, all the products are checked for their shape, size, and durability.Afterthequalitycheck, theproductispassedonto the counting division where it is counted and sent for packaging.
On our machine, we can manufacture a variety of tableware products such as plates, bowls, trays, clamshells, containers, lids, etc., to meet the increasing demand –local aswell as international, fordisposable tablewareas it is a very good substitute for single-use plastic disposable tableware.
PM: What are the key strengths of the company which enable you to make your mark?
Pulp molded tableware has been accepted as a substitute for single-use plastic products. Also, being a 100 percent biodegradable product, this also opens up the gates for international trade for the industry. Considering all the above-mentioned market demands and trends, we foresee a lotofpotentialinthismarketintheupcomingyears.
DS: With respect to our clientele, our machines have been running in many plants which we have supplied either directly or through a marketing agent. A few of our clients include – Ecovore Tableware Pvt. Ltd., Dev Euro Paper Products LLP, Kuber Packaging Industries Pvt. Ltd., Oom PulpProductsLLP, EcotweetAgriwarePvt. Ltd.,and Ecoware SolutionsPvt.Ltd. With the aim to fulfill the increasing demand of the machines, we are all set to increase our manufacturing capacitiesof thesemachines.
DS: Manufacturing 100 percent biodegradable and compostable tableware is the need of the hour. There are a variety of molded fiber products that are in huge demand to replace various single-use plastic items; however, we are majorly focussed on molded fiber tableware manufacturing as we feel it to be a very important and one of the biggest segmentswithhugedemand.
74 | www.papermart.in / June-July, 2022 INTERVIEW ••••••••
PM: Talking about molded fiber products — could you please brief us on the types of the products manufactured by the machine along with their applications?
PM: Please shed some light on the market footprint and clientele of Precise Castings along with the expansion plans.
DS:Weareequippedwiththenecessaryin-housecapabilities to manufacture the complete machines under one roof starting from fabrication, casting, machining, stress relieving, and assembling. This is one of the major pillars which enables us to provide the customers with timely deliveryandallthequality-relatedchecks.
SmallThingsMake BigDifference
76 | www.papermart.in / June-July, 2022
After a lot of trials, Shree Krishna Paper Mills & Industries launched brown A4 PackMate copier paper that uses almost 10 litres per tonne of paper less water as compared to white A4 copier paper. So when you use brown PackMate copier paper, you save almost 0.5 litres of water per ream! simply due to the fact the government of all the nations has taken the plastic ban very seriously. The shift from plastic to paper is not just based on the material change; it is based on the cost change as well. Plastic is the cheapest product out there and the most durable. Paper on the other hand is an expensive alternative and is always going to play a part in decisionmaking, especially for smaller Wecompanies.allhave been hearing about the ban on plastic not only in India but in various countries worldwide. India has always been a follower, not a leader when it comes to policies, particularly regarding sustainability and the environment. Various countries have already banned singleuse plastic across the globe, following which India too took the final step in 2022. However, due to the size of the population, no policy is easy to execute. Even when the single-use plastic ban is being implementedcustomers have moved to the closest cheaper alternative - non-woven bags. We at, Shree Krishna Paper Mills & Industries, have always thought to innovate and bring forth solutions that help the environment. Paper is made using water and a lot of water is used to manufacture paper. If paper makers are one of the consumers of
Author: Mr. Naynesh Pasari, Director, Shree Krishna Paper Mills & Industries Ltd. he global paper market isTaround 450 million MT of paper of which close to 260 million MT is from brown papers, which includes containerboard, packaging and high-strength kraft papers. The need for high-strength kraft papers is on the rise when companies like Amazon, and Flipkart want to develop alternate suppliers in India. Currently, all high BF papers come from Europe and India is unable to consistently provide good quality paper. Owing to the developments in India, mills have undertaken to be a long-term supplier for high BF papers. Recently, Shree Krishna Paper Mills & Industries Ltd. (SKPMIL) developed 45 BF paper. The paper we managed to produce is 4 times consistently achieving the same BF and results. We do realise without good quality pulp, we cannot manufacture this quality of the paper. The real key is to manufacture again and again getting the same results. We are happy that we were able to do that. A few years ago, CSR only meant that companies would provide donations from the profits to less privileged areas. Today, CSR has taken on a larger meaning. A lot of CEOs are now taking recycled paper and sustainability as their CSR. The reliance on recycled fiber is increasing
INNOVATION •••••••••
www.papermart.in
water, then we should be the ones to work on solutions to save water too. It was at the Paperex 2022 when we launched recycled brown notepads as souvenirs for our customers coming to visit the stall, which got great feedback - we started working on the idea of B2C products. After a lot of trials, we launched our brown A4 copier paper that uses almost 10 litres per tonne of paper less water as compared to white A4 copier paper. So when you use brown PackMate copier paper, you save almost 0.5 litres of water per ream. It has got amazing feedback from the market and we are already getting repeat orders. Also, when you use PackMate copier paper, you save yourself almost 15-20 percent cost as compared to white A4 copier paper. Our product range is based on the vision that brown is the new white! Brown denotes eco-friendliness; brown denotes sustainability and brown denotes our mother naturethe colour of mitti. We hope to make PackMate notebooks, notepads, envelopes, and gift wrapping papers a household name and make a real connection with the mindset that every person can save the planet - not by hugging a tree but by using PackMate products which save water.
Image Source: Ecosure Pulpmolding Technologies. July18,2022 Ecosure Pulpmolding Technologies Ltd. has set up a second unit in Coimbatore to produce fully-automated pulp
PackMate is already listed on Flipkart and Amazon and is gaining popularity. When you print your invoice & letterhead on PackMate brown A4 copier paper, it's a reminder to yourself and the clients who see it that - you care about the environment and are doing something to make a difference.
Ecosure Pulpmolding has strengthened its commitment of bringing in world-class solutions which are 'Made in India'.
78
manufacturesFoundedalong'MadeeningpulpWithCoimbatoremanufacturingunit.thenewunit,theturnkeysolutionprovidertoproducefibermoldedproductswithindigenoustechnologyisstrength-itscommitmenttobringinworld-classsolutionswhichareinIndia'andarecost-efficientaswellasenergyefficientwithprovidingexcellentservicestoitsclients.in2019,EcosurePulpmoldingTechnologiesLtd.semiandfullyautomaticpulpmoldingmachinEcosure
Automated Pulp Molding
SKPMIL has fullyshifted to PackMate forall its internal needs. A lotof companies, ourfriendsand family have also moved to PackMate brown. Small things makea big differenceand this Rakhi everyonewhoused PackMate recycled Shagunenvelopewasextremely happyand gaveusgreat feedback on the same. Ourcompany has launched a direct-to-consumere-commercewebsite www.PACK-MATE.in. Let's together bring the brown revolution! Go Green, Go Brown. | / June-July, 2022 ery as well as moulds to produce non-wood agro pulp molded tableware made from renewable resources like sugarcane bagasse, wheat straw, bamboo or rice straw. The specialities of the company include machinery, equipment, pulp molding, 'MadeinIndia'machines,moldedfiber,andsoon. n
INNOVATION •••••••••NEWS •••
“Wemoldingproductionlinesforthetablewaresegment.takepridetoannounceouropeningofthesecond unit in Coimbatore to manufacture first-ever 'Made in India' fully automatic pulp molding machines for tableware packaging”, says Ecosure Pulpmolding Technologies. In addition, Ecosure Pulpmolding is also planning to introduce machines for industrial packaging, egg trays, fruit trays, and so on from the Pulpmolding to Expand Production of Fully Machines with its Second Unit
Heat Management's HISS™ was installed as part of the Södra expansion 2.0 project, resulting in production records (+9 percent), and increased boiler load by 12 percent. With higher production comes more output of renewable energy to thegrid, resulting in 20 MWe of locally generated and sustainable power for the Swedish SE3 region. This effectively offsets power generation from fossil power stations, reducing emissions by 21 000 tons CO2eq Södraannually.Cell Värö is a prosperous NBSK pulp mill with ambitious sustainability goals. As part of the Expansion 2.0 project, Södra increased its NBSK pulp production capacity from 710 000 ADMT/year to 780 000 ADMT/year. The recovery boiler was identified as the Heatbottleneck.Management's
80 | www.papermart.in / June-July, 2022 CASESTUDY •••••••
Thisconditions.approach renders the biggest advantage: combining improved availability from dynamic operational and strategic sootblowing capacity with millions of EUR in potential savings generated from increased and safe mill production levels. Energy and water savings per ADMT play straight into the mill sustainability goals and circular operations. All in all, renewable heat and power generation are increased while CO2 emissions are decreased, contributing to the pulp mill'ssustainabilitygoals.
¢
Partnering with Heat Management to make pulp mill efficiency improvements involves a continuous dialogue for validation and verification. Heat Management studies process data every week to ensure the highest possible amount of steam savings with desirable boiler availability. A good relationship with the pulp mill is in focus, supporting operations, maintenance, production, and processexperts with unique knowledge and holistic data analysis for both the measurable and the non-measurable process
Author: Mr. Pontus Linder, Product Manager HISS™, Wave Impact Heat Management AB
HISS™ is an optimised sootblowing system thatcan be customised to meet the needs of each customer. Users of HISS™ can increase the sootblowing capacity by 100 percent without consuming more steam or maintaining the same cleaning effect with 30-45 percent reduced sootblowing steam consumption. The system was used in Södra's case to maximise cleaning capacity, resulting in production records, while producing more renewable power to “Wethegrid.entered into a sustainability partnership with Heat Management to reduce our production costs and increase the generation of renewable power from our pulp mill. The investment in HISS™, allowed us to safely explore the process limits and take it beyond technical specifications, to reach our production goal of 850 000 tonnes/year. The recovery boiler is now operating on a 12 percent higher liquor throughput compared to before. The investment was in line with Södra sustainability and decarbonization goals,” said Mr. Anders Wiman, Power andRecoveryManager,SCV
Heat Management’s HISS™ was as Part of Södra Expansion Project
Installed
2.0
to grow its annual pulpwood production capacity from 3.5 million tonnes to 5 million tonnes in the next four years – as published in a leading newspaper. The planned pulpwood expansion will be supported by its agroforestry programme which will commence soon in Chhattisgarh and AlmostOdisha.half of the pulpwood production by ITC is being utilised as raw material at the ITC PSPD Bhadrachalam unit in Telangana. Currently, the company utilises about 1.8 million tonnes per year of pulpwood for paper manufacturing. In the next four years, around 30 percent of the pulpwood requirement of the ITC PSPD would be fulfilled from Odisha and ITCChhattisgarh.hasdeveloped
a farm plantation programme which provides employment opportunities and income to farmers. There are high-yielding, site-specific, disease-resistant saplings and a comprehensive package of plantation and management practices are implemented to ensure a consistent supply of high-quality raw material to its manufacturing facilities.
Total plantations, as of March 31, 2022, stood at over 9.50 lakh acres. The social and farm forestry initiatives have not only contributed to a sustainable source of raw material but have also helped sequester 6,182 kilo tonne of CO this year, thus2 consolidating ITC's status as a 'Carbon Positive Company' for the17thyearinarow.n
The total plantations by ITC under its social forestry programme, as of March 31, 2022, stood at over 9.50 lakh acres. June-July, 2022 The social and farm forestry initiatives contribute to a sustainable raw material source and helps in sequestering carbon emissions. Image Source: ITC Ltd. July25,2022 ank Note Paper Mill India (BNPM), a joint venture ofBSecurity Printing and Minting Corporation of India Ltd. (SPMCIL), and Bharatiya Reserve Bank Note Mudran Pvt. Ltd. is looking toward setting up a bank note paper manufacturing facility in Balasore district, Odisha. As per news reports – the proposed paper mill will entail an investment of INR 2,500 Mr.crore.SThalikerappa, Managing Director, BNPM India, apprised Chief Minister of Odisha Naveen Patnaik of the project, the Chief Minister's Office said in an official statement. The Chief Minister assured the company officials of the support in this regardfromthestategovernment.
ITC to Increase Pulpwood Production to 5 Million Tonnes
NEWS ••• 82 | www.papermart.in /
July16,2022 he social and farm forestry initiatives contribute to aTsustainable raw material source and help in sequestering ITCcarbonemissions.Ltd.isplanning
A New Bank Note Paper Mill to be set up in Odisha with INR 2500 crore Investment For the proposed mill, about 100 acres of land will be acquired. Bank Note Paper Mill India has a plant in Mysuru city in Karnataka, with a total capacity of 12,000 metric tonne per annum (MTPA).
Representative Image: Currency notes.
HenanJingxinFabricTechnologyCo.,Ltd.,foundedin2011,isoneprofessionalmanufacturerandtechnicalservicerofpaper machineclothingandchemicalproductsforpulpandpapermills. Initspapermachineclothingproductionbase,factoryhas33000squaremeters,annualproductioncapacitycanget 1000000sqm.JingxinfabricʼsformingfabricallusedtheGerman“Perlon”brandhighqualityimpomonofilament,andDryer screenwillusedPortugal“Filkemp”brandmono-filament.InJingxin,toproducehighqualityproducts,weintroducedthe mostadvanced5setsSwedenTEXOfullyautomaticrapierloom,14.5metershotsettingmachine,16metersGerman Jürgensweavingmachine,AustrianWISfullautomaticseamingmachine,etc. Initspapermakingusedchemicalproducts productionbase,factoryhas44000squaremeters, annualproductioncapacitycanget400000tons. ThecoreChemicalproductsare:SurfaceSizingAgent GS,SurfaceSizingAgentWS,WetStrengthAgent,Dry StrengthAgent,Defoamer,etc. JingxinmanagementhaspassedISO9001qualitymanagementsystem,ISO14001environmentalmanagementsystem,ISO 18001occupationalsafetymanagementsystemcertification. Duetothereliableproductquality,theproductssellwellalloverthecountry,andhavereachedlong-termcooperative relationswithmanylistedpapercompaniesinChinaandthepulpandpapermillsfromRussia,India,Vietnam,Pakistan,Iran, Indonesia......morethan15countries. ThecoreproductsforpapermachineclothinghasFormingFabric,DoubleWarpFlatWireDryerFabric,SingleWarpFlatWire DryerFabric,SpiralDryerFabric,PlainWeaveDryerFabric,SludgeDewateringFabric,etc. Tel.：+863945228866 Mobile:008618838386818 Fax：+863945106388 E-mail：info@jingxincorp.com Website：www.jingxincorp.comHENANJINGXINFABRICTECHNOLOGYCO.,LTD SHENQIUNORTHINDUSTRYZONE, HENAN,CHINA
n
About 100 acres of land will be acquired to set up the mill.
Ÿ
AdditionalhighlightsoftheProgramJagriti:Specialitypapermachineof100MTper day for solutionsŸ including flexible packaging with furnish by optimising, the 100strengthofagro-residuebagasse.percentbiofuel-powered10MWCogenplant. PulpcapacityenhancementbyaugmentationofPulpMillbyŸ another 75 percent (environment-friendly pulp backed by SupportenhancingtheequivalentcapacityofRecoveryIsland).infrastructureinlinewithincreasedoutputof pulp
A delegation of RBI has already visited the Balasore district to assess the situation at the ground level for the possible establishment of the paper mill at Padabadagaon village, whichissituatedontheoutskirtsofBalasore.
NEWS ••• 84 | www.papermart.in / June-July, 2022
Ÿ
Yash Pakka Announces Mega Expansion under Program Jagriti
(L-R): Mr. Jagdeep Hira, Business Head, Yash Pakka Ltd., and Mr. Antonio Bernucci, Head of Business Unit South East Asia, Process Industries Division, AFRY.
Withavailabledomesticallyforthefirsttime.thissignificantadvancement,the brand also intends to pique the interest of existing and prospective investors. Furthermore, to strengthen its sustainability initiatives and improve the capabilities of its facilities in Ayodhya, Uttar Pradesh, Yash Pakka is launching an integrated Brownfield expansion project in collaboration with AFRY. The strategic partnership will significantly help the brand to increase the support infrastructure in line with the increased output of the pulpandpapermachines.
Commentingandpapermachines.onthedevelopment, Mr. Jagdeep Hira, Business Head - Yash Pakka Ltd., said, “The demand for compostable packaging has been more than the supply with rising consumer awareness. AtYash Pakka Ltd., we have taken the onus of meeting this growing need through meaningful and ample solutions. With our new 100 MT paper machine, we are concentrating on offering better packaging solutions to our customers. Additionally, the state-of-the-art paper machine will give customers access to a wider range of domestically Hemadenichespecialitypapers.”continued,“OurProgramJagriti will provide the impetus boost to our mission of manufacturing innovative packaging solutions that are eco-friendly and contribute towards making goal.BasicsystemsupgradeaimexpansionasionYashproduction.”andWetoBharatabetterplacetolive.Also,atYashPakkaLtd.,ourvisionistransformtheworldbyofferingqualitypackagingsolutions.placeastrongemphasisontheaccumulationofknowledgeexperienceforenvironmentalprotectioninthecourseofPakkahasalreadybegunthegroundworkforitsexpan-ProgramJagritipostawardingthecontractforconductingBasicEngineeringstudyfortheintegratedBrownfieldprojectatitsAyodhyafacilitytoAFRY.TheprimaryoftheIntegratedBrownfieldExpansionProjectistothelegacysystemstointegratewithotherhigher-endusingwell-knownprotocolsandstandards.Hence,theEngineeringstudyisacrucialsteptowardachievingthe n
With this development, the brand aims to ramp up its production capacity to provide consumers with sustainable packaging options. August2,2022 ith rising consumer awareness of the environmentalWimpact of plastic packaging, the demand for sustainable packaging materials has also increased. With the aim to provide environment-friendly products to its customers, Yash Pakka Ltd., the pioneer of compostable packaging in India, has announced the installation of its 4th paper machine as a part of Program Jagriti which will enable niche speciality paper from the state-of-the-art machine. This new addition will also boost plant production capacity by 100 MT, enabling the brand to cater to customers' demands and get special grades of paper
BNPM India is engaged in the production of bank note papers and has its plant in Mysuru city in Karnataka, with a total capacityof12,000metrictonneperannum(MTPA).
ABB integrates OPT800 Lime APC Solution in APL's existing DCS.
ABB's OPT800 Lime APC solution to continually drive sustainability and efficiency of lime kiln production at APL's Rajahmundry paper mill in India. Use of the ABB solution results in uniform lime quality with lower energy consumption and reduced emissions. 2022
Satia Industries Wins Order Worth INR 105 Crore from NCERT
NEWS ••• 86 | www.papermart.in / June-July,
For the order, Satia Industries will supply 11,000 tonnes of Maplitho grade paper of 80 GSM in sheets and reels.The paper will be used in the printing of NCERT textbooks – as published innewsreports.
August4,2022 ndhra Paper Ltd. (APL), one of India's largest integratedApulp and paper manufacturers, has deployed an ABB advanced process control (APC) solution at their Rajahmundry Tomill'slimekiln.helpreduce the energy requirements of the highly interactive lime kiln production process, ABB has integrated their OPT800 Lime APC solution into APL's existing ABB Ability™ OPT800System800xAdistributedcontrolsystem(DCS).Limeenablestightercontrolofthelime production process. In the kraft recovery process, lime mud is calcined into quick lime which is then further processed to create white liquor.The process being endothermic, a greatdeal of energy is required in the calcination process and is one of the leading Atcontributorstomill'senergycosts.itscore,OPT800Limeutilizesa model of the kiln process to accurately predict process variable interactions and make realtime adaptions to process changes. This leads to smooth and stable pulp mill operation and uniform lime quality, while also reducing energy consumption and emissions, increasing reburned lime availability, and decreasing residual carbonate “Wevariations.arecommitted to environmentally and socially responsible business practices, and by using ABB's APC solution, we are able to optimize the lime kiln operations,” said Mr. M Sura Reddy, Senior Vice President, Mill Operations, APL. “We have worked with ABB's team for more than 15 years, and they understand the specifics of our business very clearly. We look “Thisforwardtobenefitingfromtheongoingresults.”newprojectforOPT800LimeintheIndian paper industry allows us to expand our footprint while showcasing our digital solutions,” said Mr. Shankar Singh, Global Product Line Manager, Drives, Automation and Digital Solutions, Pulp and
The wood and agro-based paper manufacturer will provide 11k tonnes of Maplitho paper for the printing of NCERT textbooks. August4,2022 atia Industries Ltd. has been awarded an order of over INRS105 crore from the National Council of Educational ResearchandTraining(NCERT).
n
Andhra Paper Deploys ABB's Advanced Process Control for Optimized Lime Kiln Production
operatorsintegratesAbility™Sincesolutionconditions.conductedtheboards.qualityPradesh,LocatedmorePaperPaper,ABB.“WehaveeveryconfidencethatwewillhelpAndhratoachieve,andexceed,theirenergyreductiontargetsforsustainablemilloperations.”intheEastGodavaridistrictofthestateofAndhrathemillproducesarangeofproductsfromhigh-papersusedinwritingandprintingandspecialtyBuildingonanexistingrelationshipwiththecustomer,ABBIndiateamengagedwithAPLfromanearlystageandamulti-yearsitestudythatassessedoperationalAsaresult,theywereabletopresentatailoredwithquantifiableROI.2006,APLhasbeenoperatingABB'smarket-leadingABBSystem800xADCS,acentralisedsolutionthatelectricalandsafetysystemstoenableplanttomakemoreaccurateandtimelydecisions.
www.papermart.in To provide a platform to Exchange Ideas, recent advancement in Technology for Wastewater management & share good practices adopted on Holistic Water Management by Industry leaders in the Pulp & Paper Sector.
Mr. Rajinder Gupta, Founder, Trident Ltd.
on the global map and we have become a notable contributor in our county's growth and prosperity and have full confidence in the new professional Board that Trident will accomplish greater heights
Speaking about the order win, Mr. R. K. Bhandari, Joint Managing Director, Satia Industries Ltd., asserts, “We are pleased to announce the receipt of this order from NCERT placing their trust in our ability to deliver both quality and quantity well in time for completion of their time-bound Beingprintingschedule.”oneofthelargest Indian wood and agro-based paper mills, the company is known for providing all types of writing & “Weprintinggradesofpaper,andpapercups.hopetocontinueourstrongpresence in this segment in the current year assuring better capacity utilisation at good salesrealisation,”addedMr.Bhandari. n
Trident Announces Broad Base of its Board of Directors to empower Professional Management
Theintimestocome.”Boardandthe Nomination and Remuneration Committee has approved to broad base & restructuring of the Company's Board of Directors (the“Board”) by induction of two Independent Directors, one NonIndependent Director and five Professional Managing
growthprogressivewhichwiseBathInfrastructureThetrajectory,Company,strategicDirectorsontheBoardinadditiontotheexistingDirectors.ThismoveshallacceleratethegrowthmomentumofthetherebyplacingtheCompanyinanupwardaddingvalueandgrowthfortheshareholders.BoardhasbeenbroadenedbasedonManagementalignedwithBusinessverticalsi.e.,BedLinen,Linen,Yarn,Paper&Chemicals.Thereshallbebusiness-KPIsandBalancedScoreCards(BSC)foreachbusinessshallempowerbusinessestobecomeindependentlyandprofitablewhichinturncatapultstheoverallofthecompany.
Image Source: Freepik August18,2022 rident Ltd. has announced that its Founder and ChairmanThas expressed his intention to the Board to step down as the Director & Non-Executive Chairman of the Company due to Respectinghispersistenthealthissuesandfamilycommitments.therequestreceivedfromMr.Rajinder Gupta to relieve him from the duties of the Chairman of Trident Ltd., the board commended the unparalleled contribution of the founder in building the company and graced the decision of Mr.prioritisinghealthcareandfamilycommitments.RajinderGuptawhileexpressinghisdesireto step down from the position said, “After devoting over three decades at byunmatcheddistinguishedandandhopefuldecadesandThetionalfamilyandTridentLimited,IrequestedtheBoardofDirectorstorelievemesupporttoprioritizemyoverallhealthandwellbeing.Mywillalsobewithmetore-buildmyphysicalandemo-well-being.”outgoingChairmanexpressedhisgratitudetotheboardshareholdersforsupportinghimoverthepastthreeandtrustinghimtobuildTridentLtd.Hesaidthat“IamthatIwouldbeabletoserveonceIregainmyphysicalemotionalfitness.Ithankonceagain,withahumbleheartmemoriesofsomepassionateyearsduringwhichajourneyofovercomingmanychallengeswithdeterminationwiththeteamworkwaswitnessedtheworldwhilewebuiltTridenttogetherandhasbroughtit
The Company has bestowed the title of Chairman Emeritus to Mr. Rajinder Gupta, the founder of Trident Ltd. There has been the induction of two independent directors and one non-independent director of the company. Additionally, the company has also appointed five professional managing directors to enhance empowerment, drive strategy, and catapult the growth of each of the business segments.
NEWS ••• 88 | www.papermart.in / June-July, 2022
–BathLinenBusiness
Day, celebrated on August 10, PM Narendra Modi dedicated the new 2G Ethanol Plant to the nation. This will enable in reduction of pollution caused by stubble burning in Haryana. Established by the Indian Oil Corporation Ltd. (IOCL) at the cost of more than INR 900 crore, the plant is located close to the Panipat refinery. It aims to utilise about 2 lakh tonnes per annum (TPA) of rice straw (crop residue) to Accordinggeneratearound3crorelitresofethanolannually.tothestatementofCheemaBoilers Ltd. on the recent project,“We are proud to be associated with India's first 2G Ethanol Plant IOCL in Panipat, Haryana.The project will turn Cheema Boilers Supplies One-of-its-kind Boilers to 2nd Generation (2G) Ethanol Plant For the new 2nd Generation Ethanol Plant by Indian Oil Corporation, Cheema Boilers Ltd has supplied its unique boiler technology. The plant has been set up with an investment of INR 900 crore in Panipat, Haryana. Image Source: Cheema Boilers Limited (CBL)
August18,2022 heema Boilers Limited (CBL), a renowned specialist ofCpremier engineering solutions, has supplied its one-of-itskind boilers for the 2nd Generation (2G) Ethanol Plant in Panipat, Haryana.The new ethanol plant will utilise indigenous Ontechnologies.WorldBiofuel
NEWS ••• 90 | www.papermart.in / June-July, 2022 l Appointmentof Mr. Kamal Gaba as Managing Director – Bed LinenBusiness l Appointment of Mr. Kavish Dhanda as Managing Director –YarnBusiness l Appointment of Mr. Naveet Jindal as Managing Director –Paper,ChemicalsandEnergyBusiness l Appointment of Mr. Pardeep Kumar Markanday as ManagingDirector–GrowthandProjects Non-Executive Non-Independent Director Appointment of Mr. Kapil Ghorse as Non-Executive NonAcknowledgingIndependentDirectorthewealth of experience, exhaustive knowledge and proven track record of creating value for the stake-
Mr. Gupta graciously welcomed the reconstituted board with full confidence and encouraged the members to take the company to greater heights, he said, “Keeping in view the reconstitution of Board of Directors of the Company, I am of the firm opinion that the Company is in right hands of seasoned and skilled Directors with optimum mix of executive & Independent Directors. He added, “I wish the succeeding leadership team who is very much capable and well-groomed to sustain growth and I look forward to hearing of the continwithfollowingRemunerationThesyncManagingTheuedsuccessofTridentLtd.”broadbaseoftheBoardshallempowerrespectiveBusinessDirectortodrivestrategyandleadthebusinessinwiththevisionofthecompany.BoardbasedonrecommendationsoftheNominationandCommitteehasconsideredandapprovedtheappointmentsonBoardofDirectorsoftheCompanyeffectfromAugust9,2022: Prof. Rajeev Ahuja as an Independent of Mr. Swapan Nath as Managing Director
build/contributecorporatemattersandInmanCommittee,recommendationscontinuedthecontinuedholders,theBoardofDirectorsrequestedMr.RajinderGupta'sforassociationwiththecompanyintheadvisoryroletoBoard.Mr.GuptaacceptedtherequestfromtheBoardformentorshipandguidance.InagreementwiththeoftheNominationandRemunerationtheboardappointedMr.RajinderGuptaas'Chair-Emeritus'oftheCompanywitheffectfromAugust9,2022.thisnewrole,Mr.RajinderGuptawill,inter-alia,mentor,guideprovideperspectivetotheBoardandthemanagementonrelatingtostrategy,newbusinessopportunitiesandgovernance-relatedmatters,andcontinuetototheCompany'simageandbrandequity.
n
Independent Directors l Appointment of
Director l AppointmentofMr.RajKamalasanIndependentDirector Managing Directors l Appointment
Amid the ban on single-use plastic products in the country, Arttek Solutions is working on its commitment to offer paper straws for which it has selected BillerudKorsnäs ConFlex Glaze as its straw material. Procured from FSC-certified sources, the paper is 100 percent recyclable, sustainable, and a high-quality MG speciality paper.
Mercer Rosenthal Orders a LignoBoost XS Plant from Valmet
August4,2022
NEWS •••
TheproduceofthewithWorldBiofuelDay,PMNarendraModiasserted,“Thisisjustbeginningasethanolplantswillbesetupindifferentpartsthecountry.Pollution-causingstubblewillbeusedtoethanol....Itwillalsoincreasetheincomeoffarmers.PanipatplantwillbethelargestinAsia.”
n
a new chapter in India's waste-to-wealth endeavours by utilising about two lakh tonnes of rice straw (parali) annually to Addressinggeneratearound3crorelitresofethanolannually.”avideoconferenceattheeventwhich coincided
www.papermart.in
qualitiesplantapplicationanddevelopedLignoBoostInpartnershipswillLignoboostofproductssays,PresidentSpeaking2022.includedmaterials,extractedTheplantwillextractkraftligninfrompulpmillblackliquor.Theligninwillbeusedfordevelopingvariousbio-basedwhichcanreplacefossilrawmaterials.TheorderisinValmet'sordersreceivedforthesecondquarterofabouttheinvestment,Mr.WolframRidder,ViceBusinessDevelopment,MercerInternationalInc.,“Mercerisinvestigatingligninutilisationforbio-basedasoneofthealternatepathwaystowardsutilisationsidestreamsbeyondbiomassenergy.WithValmet'spilotplantinstallationon-site,MercerRosenthalfurtherbuilditssolidligninknowledgeandwillallowforproductdevelopment.”thewordsofMs.HannaKarlsson,ManagerforAshandTechnology,Valmet,“LignoBoostXS™hasbeenforcustomerswhowanttoentertheligninbusinessstarttheproductioninsmallerscaletoenablefullscaledevelopmentwithfuturelignincustomers.TheoffersMercerthepossibilitytostudydifferentligninandtheiruseinvalue-addingproducts.”
August18,2022 engaluru-basedmanufacturerofsustainablepaperstraws,BArttek Solutions, under the Arttek Enviro brand, is strengthening its commitment to replacing plastics in drinking straws. Arttek Solutions has partnered with BillerudKorsnäs to BillerudKorsnäs Partners with Arttek Solutions to Replace Plastic Straws in India drive innovation, selecting BillerudKorsnäs ConFlex Glaze as its straw material. A 100 percent recyclable and sustainable highquality MG speciality paper, the ConFlex Glaze is made from TheFSC®-certifiedScandinavianforests.Indianspecialitypackagingmanufacturer is focused on 92 | / June-July, 2022
The scope of the order includes a demonstration-scale lignin extraction plant, LignoBoost XS™ with a capacity of around 350 TPA. It is a module-based installation enabling streamlined Theengineeringandfasterdelivery.MercerLignoBoostXS™plant is adapted both for hardwood and softwood kraft lignin extraction. The plant is fully automatedandisdesignedforsafeandeasyoperation.n LignoBoost, with a capacity of around 350 TPA, is adapted both for hardwood and softwood kraft lignin extraction.
LignoBoost XS™ is a module-based installation enabling streamlined engineering and faster delivery. Image Source: Valmet.
ercer Rosenthal has ordered a LignoBoost XSTM plantMfrom Valmet for its Lignin Center in Thuringia, Germany.
August18,2022 t. Governor of Delhi Vinai Kumar Saxena launched pulpLpads which were made out of white currency waste at the
n
KNHPI develops Handmade Paper from White Currency Waste
Topaperformed,Artteklittering,itsembracespaper.AstheworldmarketpaperstrawsinquesttohaltplasticthebusinessunitSolutionswasspecialisedinstraws.beaninnovatorinan exciting niche segment of paper straws, it was important to find the right material that offers high functionality and quality that meets consumer demands. Arttek had the technical support of BillerudKorsnäs all the way – from trials to product development. The mission of both companies was mutual – a business collaboration that challenged conventional packag“Weingforamoresustainablefuture.thinkofBillerudKorsnäsasa reliable partner in development and business – especially for a small and niche operator Thelikeours,”saysMr.RajMurali,Director,ArttekSolutions.selectedpaperBillerudKorsnäsConFlexGlazehas
Saakshy Agarwaland Moh. Esa Khan, under the guidance of Mr. rawemphasisetechnologiesItbecomingVillageSaxena,whohasheldthepositionofchairmanoftheKhadiandIndustriesCommission(KVIC)previouslybeforetheLGofDelhi.isnoteworthythattheKNHPIhasdevelopedanumberofforthehandmadepaperindustrywhichutilisingcost-effectivealternativelignocellulosicmaterials.
The Kumarappa National Handmade Paper Institute (KNHPI) has developed technology to use white currency waste as the costs of cotton hosiery waste are on a sharp rise.
NEWS •••
The Kumarappa National Handmade Paper Institute in Jaipur. June-July, 2022 glossy side, offering a smooth feeling for consumers, which sometimes can be challenging since plastics is generally smoother than paper in contact with the lips and mouth. The paper's strength ensures that the straws are strong enough to
94 | www.papermart.in /
plasticsThus,moremillionstatesplasticdecidedandminedEarth.Org,AccordingingbuttoequipmentConFlexwellandConFlexpapersurviveincarbonatedsoftdrinkswhichalsoisachallengesincefiberseasilydissolveincontactwithcarbonicacid.GlazelivesuptoitspromisesandmeetsthestrictestmoststringentrequirementsinColaindustrystandardsasastheFDAstandards.GlazeoffersgoodrunnabilityinArttek'smachineandtheconsistentqualityofthepaperhashelpedreducewastage.Themachinesoperateatmediumspeedthecompanycannotfindanyobstaclestofurtherincreas-speeds.tostatisticsfromglobalenvironmentalorganizationmoreandmorecompaniesandbrandsaredeter-toabandonplasticstraws,includingMcDonald's,IKEA,Starbucks.Therearealsopoliticaldecisions;theEUhastobanallplasticstraws.Also,inmanycitiesinIndia,strawsarenolongeravailableatrestaurants.SomeintheUSAhavebannedstraws.JustintheUSA,500plasticstrawsareconsumedeveryday,whichcouldfillthan127schoolbusesperdayorover46,400peryear.thereareexcitingbusinessopportunitiestoreplacewithpaper. n sustainable, renewable solutions, and offers products that enable customers to replace plastics with renewable
Thepartially.wastimes.coststechnologyTheIndiacurrencycovers,industry–KumarappaNationalHandmadePaperInstitute(KNHPI),Jaipuraspublishedinnewsreports.Notably,thehandmadepaperutilisespulppadsformanufacturingcarrybags,fileandfolders.TheinstitutionisprocuringthewastefromtheSecurityPrintingandMintingCorporationofLtd.Lt.Governorinformedthattheinstitutehasdevelopedforutilisationofwhitecurrencywaste.Infact,theofcottonhosierywastehavebeensurginginrecentMoreover,headdedthatthehandmadepaperindustrylookingforwardtoexploringotherrawmaterials,fullyorstudieswereconductedbyresearchersofKNHPI–Dr
one Image Source: BillerudKorsnäs
NEWS ••• www.papermart.in / June-July, 2022 | 95 August18,2022 oimbatore-based K.U. Sodalamuthu And Co. Pvt. Ltd. hasCwon the Regional Export Award from the Engineering Export Promotion Council (EEPC) of India in recognition of achieving the highest export performance during the year 2018-2019. The Company manufactures and exports paper conversion machinery for the production of paper cones, tubes, composite cans, edge protectors, and pulp moulded Apartproductssince1970.frombeingthe market leader in India, it exports to more than 60 countries including the USA, Italy, Brazil, Mexico, Mr.Russia,Egypt,Turkey,andSouthAfrica,amongothers.BasavarajBommai,ChiefMinisterofKarnataka,gave away the award at a function held recently at Bengaluru. It was received by the Company's Managing Director, Mr. K.S. Balamurugan. K.U. Sodalamuthu And Co. Pvt. Ltd. has won 23 ExportPerformanceAwardssofar.n K.U. Sodalamuthu And Co. bags Regional Export Award from EEPC India
Chief Minister of Karnataka Basavaraj Bommai presenting the award to Mr. K.S. Balamurugan.
The award was given by Karnataka Chief Minister Basavaraj Bommai to the Company's Managing Director Mr. K.S. Balamurugan.
Yash Pakka generates its own electricity with a captive power plant that operates on biomass. It also sources its raw material and fuel locally and recovers 95 percent of the cooking chemicals used in manufacturing.
Paper Industry Representatives Meet Managing Director of Karnataka Textbook Society
n
Image Source: Yash Pakka buy wood crops from them after helping them to grow the “Approximatelysame.
Yash Pakka Bags FSC Chain-of-Custody Certification for Sustainability
July28,2022 ash Pakka Ltd. has bagged the coveted Forest StewardshipYCouncil's (FSC) Chain-of-Custody Certification for its selected products. This esteemed and sought-after title authenticates that the products sold by Yash Pakka originate Thefromwell-managedforestsandreclaimedmaterials.FSClabelcrediblylinksresponsibleproduction and consumption, allowing consumers and businesses to make purchasing decisions that are beneficial to people and the environment. The Chain of Custody (COC) verifies that FSC material has been identified and separated from non-certified andnon-controlledmaterialacrosstheentiresupplychain.
4,50,00,000 textbooks are printed by the society every year. We have requested to print a wrapper on each textbook regarding the manufacturing process and the importance of paper. We shall send the matter shortly. We thank Mr. Kantilal Ji, Managing Director, Amarjyothi Paper Co.
The Karnataka Textbook Society has agreed to print 4,50,00,000 textbooks with information regarding the manufacturing process of paper to debunk the myths around paper and spread awareness.
NEWS ••• 96 | www.papermart.in / June-July, 2022
This Chain-of-Custody Certification further means that only eligible materials as per FSC standards are being responsibly sourced by the manufacturer, wherein no illegally harvested wood is being processed to carry out the production. This adornment certifies that the company has responsibly complied with all the regulations and requirements of the FSC Well-deservingforsustainableandplanet-friendlygrowth.oftherecognition,YashPakka generates its own electricity with an 8.5 MW plant that runs on 100 percent biomass-based energy. It also sources its raw material and fuel locally, and recovers 95 percent of the cooking chemicals used in manufacturing. The company's core USP lies in utilisation of local agri-residues in creating raw materials. Its strength is rooted in R&D and innovation, and it is creating path-breaking products and processes for fiber, pulp, paper, biopolymers, Mr.mouldedproducts,wastelines,andbiomimicry.JagdeepHira,BusinessHead,YashPakkaLtd., said,“The FSC Chain-of-Custody Certification is a distinguished feat for our company. While our production has always been environmenablewithcarbonmaterialsinnovativefactory,residueplanetconsciousindustry.encouragementtallyresponsible,thisinternational-gradecertificationisahugeandrecognitionforourgoodworkintheOurcoreidentityreliesonthefactthatweneedtobeandawareoftheenvironmenttoday,tomakethebetterforourfuturegenerations.Fromusingagri-asrawmaterialtousing100percentbio-fuelatourthisbeliefreflectsinallouractions.Currently,ourgreenproductsarechangingthewaypackaginghavealwaysbeenseeninthemarket.Fromlowfootprinttoresponsiblesourcingandbeingcreativewastematerialreuse,YashPakkaLtd.hasmaderemark-stridesindoingitsbitfortheenvironment.”
August1,2022 aper industry representatives met MP Madegowda,PManaging Director of Karnataka Textbook Society and discussed how paper is manufactured in India. While 70 percent of the paper manufactured in India is agro-based, the tativespaperindustrygrowsmoretreesthanituses.Themillrepresen-haveasocialresponsibilitytowardsthefarmers.They
EPRC: Paper Value Chain is Ready to Take Circularity to New Level with 2030 Recycling Rate Target ••• www.papermart.in / June-July, 2022 | 97 for co-ordinating and fixing the meeting. Mr. Ramesh Bhootra, Mr. Ramesh Salecha, and Mr. Bharat Bhansali also joined us,” said Mr. Dinesh Jain, President, Karnataka Paper Merchants' ThisandStationers'Association,Bangalore.wouldbeasmallsteptowards debunking the myths around the paper. Paper Day is celebrated in India on August 1 every year to create awareness about paper as a sustainable material.The paper was manufactured in India for the first time on1August1945.
NEWS
n
July7,2022 epresentatives of the European paper value chainRgathered in Brussels and pledged to recycle 76 percent of all paper consumed by 2030. The commitment was taken during the 8th edition of the European Paper Recycling Awards which saw two projects, breaking new ground for how far paper recycling can go, receiving the highest distinction in the TheEuropeanpaperrecyclingcommunity.new,ambitiousrecyclingrateof76 percent, calculated by dividing the recycling of used paper by the total paper and board consumption, should be reached by the year 2030. It represents a best-in-class performance both at the global level and across material industries, as paper and board is the most TherecycledmaterialinEurope.commitmentislaidout in the new European Declaration on Paper Recycling 2021-2030 report. The document sets out measures to optimise the management of paper at every step of a continuous recycling loop. This entails a variety of operations, from paper and board manufacturing, its conversion into products and prints, through to its collection, sorting, and Therecycling.industries co-signing the declaration state however that several enabling conditions from EU and local authorities need to be met. Including to limit the use of paper waste for energy recovery purposes and to ensure that paper is separately Thecollectedtopreservethequalityofthematerial.projectteamofEnEWA,financedbytheGerman Federal Ministry for Climate Protection, was awarded at the award ceremonyorganisedbyCepi.
The separate paper collection is also a prerequisite for higher levels of recycling and needs to be further promoted. However, the paper value chain is also pushing boundaries for what additional products could be recycled, and how to access paper waste which is not finding its way to separate collection.
Paper Industry Representatives in a meeting with Mr. MP Madegowda, Managing Director, Karnataka Textbook Society. European Declaration on Paper Recycling 2021-2030 Report.
The European Paper Recycling Award-winning projects tackle The European Paper Recycling Council (EPRC) recently held the European Paper Recycling Awards during which the recycling rate of 76 percent has been set by the European paper value chain representatives.
“The recycling rates we have already reached put paper and board as industry frontrunners. Both ongoing initiatives and planned steps will allow us to close the circular economy loop even further. The innovative projects presented yesterday at the EPRC Awards are timely examples of what it will take to get there”, says Mr. Ulrich Leberle, Secretary, EPRC (European Paper RecyclingCouncil). n both these challenges.
The project team of EnEWA, financed by the German Federal Ministry for Climate Protection, was awarded at the award ceremony organised by Cepi. CELAB Project Team being awarded at the European Paper Recycling Awards. 2022 July26,2022 tora Enso and Tetra Pak have teamed up to assess andSresearch a shared beverage carton recycling solution to meet the growing recycling need in Benelux. This is in response to the increasing demand for circular paper-based packaging solutions. The joint feasibility study will present a proposal for a comprehensive beverage carton recycling facility at Stora Enso's Langerbrugge site, Belgium. The fibers will be processed at the Langerbrugge site, and the polymer and aluminum barrier materials would be recycled by a dedicated partner.
Image Source: Stora Enso
EnEWA, a research and development project financed by the German Federal Ministry for Climate
NEWS •••
recycling rate by 2030.This is an ambitious target and every piece of paper and board bringing us closer to it counts!”, says Ms. Annick Carpentier, Chair EPRC (European Paper Recycling Council).
recycling system for beverage cartons in Benelux and surrounding Theregions.recycled fibers would serve as source material for producing recycled containerboard within the Langerbrugge site, delivering a fully circular solution. Within the partnership, Tetra Pak would ensure a recycling solution for polymer and aluminum materials to be processed
contributegame-changers“TheinitiativeandhouseholdandProtection,isfocussingontheoptimisationofsorting,cleaningrecyclingpaperevenwhenitismixedwithotherresidualorcommercialwaste.Awardedinthe“informationeducation”category,theCELABprojectisacross-industrytorecycleself-adhesivelabels.projectsorcampaignscompetingfortheawardsareallinthewaywerecyclepaperinEurope.Theywilltoachievingourambitiousgoalofa76percentpaper
There are about 75,000TPA of beverage cartons in the Benelux andisrecycling.market,ofwhichmorethan70percentarealreadycollectedforPresently,abeveragecartonrecyclinginfrastructurenotavailableinBenelux.ThepartnershipbetweenStoraEnsoTetraPakwouldenableinthecreationofacomplete
Thebyadedicatedpartner.recyclingproject is also in relation to Stora Enso's recently announced feasibility study to potentially convert one of the Langerbrugge site's paper production lines into a high-volume Stora Enso and Tetra Pak Research for Beverage Carton Recycling to Promote Paper-Based Packaging
After the conclusion of the joint research of Tetra Pak and Stora Enso, the proposed recycling line in Langerbrugge will have the capacity to process about 50,000 TPA of recycled cartons, which can be further extended.
98 | www.papermart.in / June-July,
Voith is expanding its portfolio for cross-process controls and AI-supported process optimisation in pulp production. Image Source: Voith.
oron-premisewelltrainingtherespectiveBTG'sThesustainableproduced.enablesMr.variabilitythe“Thetosupplier,ProductPapermakingtheexcellent“Manyofproductadvancedbeintegrated,hybridsystemsolution.OnCumuluswillhenceforthofferedunderthenamedataPARCcloud,whileBTG'sMACSprocesscontrolsolutionswilljointheOnEfficiencyfamily,therebystrengtheningtheEfficiencySolutionstheVoith'sPapermaking4.0portfolio.yearsofknow-how,bundledexperienceandanpartnershipbetweenVoithandBTGarethebasisforoptimiseddigitalisationandautomationportfolio4.0,”saysMr.PeterEisen,VicePresidentDigitalManagementatVoithPaper.“Astheleadingfull-lineourgoalistoenablepapermanufacturersworldwideachievesignificantproductivityandcostadvantages.”solutionsofferedbytheOnEfficiencyportfoliooptimiseprocessinpulpandpapermillstosignificantlyreduceandoperatingcostsandincreaseproductivity,”saysDanSmith,BusinessDirectorProcessSolutionsatBTG.“ThissavingsofbetweenEUR2andEUR10pertonofpaperAtthesametime,thesolutionsensuremoreproductionwithlowerresourceconsumption.”combinationofVoith'scloudsolutionOnCumulusandon-premiseinstallationdataPARCcombinesthestrengthsoftheplatforms.Inthecloud,forexample,almostunlimitedcomputingpoweroffersadvantagesforAImodelsandsimplifiescross-locationsolutionsasaslocation-independentaccesstodata.Thestrengthsofinstallationslieinprocessinghigh-frequencydataclosedcontrolloops.
The addition of dataPARC and MACS to the Papermaking 4.0 portfolio completes the full-line offering from the global technology company Voith for digitalisation in the pulp and paper industry. August3,2022 or maximum savings in pulp and paper production withFthe help of automation and digitalisation, Voith and its wholly owned subsidiary BTG are merging their product portfolios. The two established data platforms, Voith's OnCumulus and BTG's dataPARC, will be merged into an
NEWS
Mr. Thomas Greil, Vice President IIoT Technology & Advanced Applications at Voith, summarises, “Our goal is to create a completely hybrid solution by 2025 that seamlessly combines on-premise and cloud, with a unified user interface, bridging the IT/OT gap. Hybrid and multi-cloud solutions permit all stakeholders to leverage data in a secure way that is efficient and most relevant to them. The user will no longer notice any difference between an application running locally or running in the cloud, and the benefits of both solutions can be optiWithmallyexploited.”theintegration of MACS into OnEfficiency, Voith is expanding its portfolio for cross-process controls and AIsupported process optimisation, especially in the area of pulp production. The addition of dataPARC and MACS to the Papermaking4.0portfoliocompletesthefull-lineoffering from the global technology company Voith for digitalisation in the pulp and paper industry. DataPARC cloud serves as the central platform and backbone of all applications in the Papermaking 4.0portfolio.n
Voith and BTG Present Joint Automation and Digitalisation Portfolio ••• has the know-how and experience we need in fiber recycling. Together with them, we have the potential to put in place a circular solution that helps us secure a world where a growing number of carton packages are collected, recycled and we can Mr.minimiselitter.”MarkkuLuoto, VP LPB Aseptic and CUK, Stora Enso, comments,“At Stora Enso, we constantly pursue opportunities to deepen our commitment to a circular packaging future. Circularity advancement requires smart investments and collaboration with the right partners. By working jointly with Tetra Pak, we can simultaneously create value, enhance circularity,andgrowourcompetitiveness.”n recycled containerboard line. This feasibility study is slated to conclude in the first half of 2023, and the recycled
cartons.inmentPak,Mr.cartons,willtimeline.Similarly,containerboardlineisexpectedtobeinproductionin2025.thejointstudywithTetraPakwillalsofollowthesameInitially,theproposedrecyclinglineinLangerbruggehavethecapacitytoprocessabout50,000TPAofrecycledwhichwillhavethepotentialtoincrease.ChakibKara,ManagingDirectorFrance&Benelux,Tetrasays,“Withthisjointinitiative,weunderlineourcommit-tolocalrecyclingprogressandimprovinginfrastructureBenelux,aregionwithhighvolumesofcollectedbeverageStoraEnsoisatrustedandimportantpartnerwhich
www.papermart.in / June-July, 2022 | 00
August18,2022 man-based Keryas Paper IndustryOLLC has ordered two power cleaners (dryer fabric cleaners) for their Paper Machine 1 (PM1) from ProJet. The new cleaners will be installed on the first and the second Unirun. The value of the Notably,orderhasnotbeendisclosed.ProJethasalready supplied more than 40 power cleaners to paper mills in the Middle East in the last decade. The HP cleaners are installed in the forming and press sections as well as the dryer sections of the Themachines.PM1produces corrugated medium and kraftliner, utilising 100 percent OCC. Since OCC can cause huge contamination on the dryer section, Keryas Paper Industry has selected ProJet yet again. The equipment is scheduled to be delivered in Q4 of 2022 whereas the installationand the startup are expected Keryas Paper Industry Orders Dryer Fabric Cleaners from ProJet
Guangxi Sun Paper Orders Four Stock Preparation Units from ANDRITZ
ProJet's Power Cleaner 2.0 is expected to be delivered to Keryas Paper Industry in the Q4 of 2022. The 2.0 version has a unique 3-stage self-cleaning station, that makes the system superior in terms of runnability compared to competitors.
significantcleanusablefabricsguaranteesApplyingreductionincreasetheseparedsuperiorstation,hasuum/dischargepressurecleanerThe2.0,whichistheupgradedversion.upgradeconsistsofasmallerhead,morenozzlesatahigherandanimprovedvac-system.The2.0versionaunique3-stageself-cleaningwhichensuresthatthesystemisintermsofrunnabilitycom-toitspeers.Thecombinationofallimprovementsisanenormousincleaningefficiencyandainmaintenance.aProJetCleaningSolutionconsistentlycleandryerfrombeginningtotheendofdryerfabriclife.Consistentlyfabricsdeliverthefollowingmanufacturingadvantages: NEWS ••• 100 | www.papermart.in / June-July, 2022
ANDRITZ stock preparation system. Image Source: ANDRITZ
August18,2022 uangxi Sun Paper Co., Ltd., has ordered four stockGpreparation systems from ANDRITZ for its tissue machines PM9 to 12 in Beihai, Guangxi Province, China. The startup of the stock preparation systems is scheduled to take
by ANDRITZ have an aggregate design capacity of 360 tonnes per day (TPD) as well as process Needle Bleached Kraft Pulp (NBKP) and Leaf Bleached Kraft Pulp (LBKP) to produce tissue.The international technology group will install the complete process technology from pulping to refining, including fiber recovery.The scope of supply also comprises erection, commissioning, start-up, Guangxitraining,andservice.SunPaper
Upon the completion of the mill, Guangxi Sun Paper will have a total production capacity of 3.5 million TPA of pulp and paper.
and ANDRITZ have maintained a close business relationship for many years. Top-quality and energysaving technology, as well as professional support during the complete project phase, were the decisive factors for placing thisorderwithANDRITZ.
ProJet's Power Cleaner 2.0. to take place later in 2023. The Power Cleaner will be ProJet's Power Cleaner
Established in 2019, Guangxi Sun Paper is an integrated pulp annumhaveaandpapermillinBeihai.Themillwillbebuiltintwophasesoverperiodofapproximatelyfiveyears.Whencompleted,itwillatotalproductioncapacityof3.5milliontonnesper(TPA)ofpulpandpaper. n
Theplaceinthethirdorfourthquarterof2022.state-of-the-artstockpreparationsystems
The new AHEAD 2.2L machine by Toscotec has a production capacity of more than 80,000 TPA.
July22,2022 ajda-Papír has started up theVdouble-width AHEAD 2.2L tissue machine, which was supplied by Toscotec (PM2), at its Dunaföldvár facility in Hungary. The supply was completely turnkey, including the entire tissue production line and all erection Theoperationsatthemill.scopeofthesupply included the entire stock preparation system and Vajda-Papír starts AHEAD Tissue Production Line by Toscotec system that came online in February
The2022.AHEAD 2.2L machine has a net sheet width of 5,600 mm, a maximum operating speed of 2,200 m/min, and a production capacity of over 80,000 TPA. It is equipped with Toscotec's state-ofthe-art technology, a fully hydraulic TT Headbox-MLT, a shoe press of the upgraded TT NextPress, a thirdgeneration TT SYD Steel Yankee Dryer,
NEWS •••
l Maintaining consistently high dryer fabric air permeability increases availabledryercapacity.
Toscotec's patented TT SAF® (Short Approach Flow) fitted with a double dilution system to maximise energy savings. It comprised the electrification and controls, dust and mist removal systems, boiler plant, bridge cranes, air compressor station, roll handling and wrapping systems, and hall ventilation with a conditioning system. For the PM1, Toscotec had supplied an OPTIMA 2600 slitter rewinder equipped with an automatic shaft puller and dust removal
l Better CD moisture profiles will be maintained.0 l Sheet curling, caused by uneven drying,willbeeliminated.
Rengo sets up a Biomass Boiler to promote Alternative Fuel for Power Generation in Japan www.papermart.in / June-July, 2022 | 101 l No chemical cleaning will be required tomaintainfabriccleanliness.
The Tonegawa Division of Rengo is one of its core divisions, which can produce approximately 350,000 tonnes of paperboard each year. Rengo's No. 3 boiler. August18,2022 engo Co., Ltd. will put up a new biomass boiler for powerRgeneration at the Tonegawa Division in Japan. The decision to install the new boiler is premised on the intent to encourage the use of alternative fuel sources.This is one of the measures toward the reduction of carbon emissions to reduce the environmentalimpact.The new boiler is projected to begin its operation in October 2022. It will be Rengo's second Withbiomassboiler,aftertheoneinYashioMill.apapermillandafoldingcartonmanufacturing unit, Rengo's Tonegawa Division is one of its core divisions, with a production capacity of about 350,000 TPA of paperboard and prints and converts lines of folding cartons such as a variety of heavysource.welluseTheprocessedpaperandmulti-packs.newbiomassboilerisapowergenerationfacilitywhichwillwoodchipssourcedfromconstructionwasteinTokyo,asasrefusepaper,plasticfuel,andscraptiresasitsmainfuelTheTonegawaDivisionchangeditsfuelsourcefromoiltoLNGin2007.Byswitchingtorenewableenergy
l Dryer fabric life will be substantially improved.
l No shutdowns will be required for fabric cleaning. This will provide increased manufacturing productivityandprofitability.
l Much less contamination will be deposited on dryers, doctor blades, andfeltrolls.n using this biomass boiler, a reduction of about 90,000 TPA of WithCO2emissionscanbeachieved.therecentmove,Rengo will keep on promoting fuel conversion, particularly in paper mills, which emit a lot of carbon and actively promote initiatives toward reducing environmentalimpact.n
NEWS ••• 102 | www.papermart.in / June-July, 2022
n
Image Source: Mondi
Image Source: Toscotec and a TT Hood system designed for Mr.maximumenergyrecovery.AttilaVajda,Managing Director of Vajda-Papír, remarks, “This new Toscotec line constitutes our flagship investment at Dunaföldvár site. We have a vision for Vajda-Papír's expansion to be in harmony with the environment, and that is why we chose the most energy efficient technology available on the market. Throughout the entire project, the whole Toscotec team demonstrated their extensive expertise and great passion for tissueMr.making.”Gabriele Barattini, Project Manager, Toscotec, says, “Successfully completing a turnkey project of this magnitude is a great satisfaction indeed. The cooperation with Vajda-Papír's team has been excellent all along and has allowed us to manage every phase in the best possible turnkeysuccessway.Toscotec'sflexibilityiscrucialfortheofanyproject,evenmoresoforprojects.”
The paper-based packaging solution has been developed for Antico Pastificio Umbro. August3,2022 ondi, in partnership with Fiorini International, a world-Mleading converter and packaging producer based in Italy, has successfully created and launched a new fully Anticorecyclablepaperpackagingsolutionforapastarange.PastificioUmbrodecidedtocombinetheexpertise of Mondi and Fiorini International to design and produce a paper bag with a viewing window for its premium pasta ranges. Following the complete rollout, this new packaging solution will support the company's sustainability goal of reducing Theplasticbysavingupto20tonnesofplasticperyear.partnershipbetweenMondiandFioriniInternational has resulted in an innovative paper bag design with a window made of transparent, recyclable, and biodegradable cellulose that allows the end user to see the contents. The bag is fully recyclable while offering the same protective properties as
n
circularananandWasteSolutions,Foundation'sTheeffectivelyallstreams.easilyplastics.Madefromrenewableresources,thepackagingcanbedisposedofbyconsumersinexistingpaperwasteThenewpastabagofferssuperiorprintabilitysothatbrandandproductmessagescanbecommunicatedandithasgreatrunnabilityonfillingmachines.packagingwasincludedintheEllenMacArthurUpstreamInnovationGuidetoPackagingpublishedinNovember2021.ItwasalsopartofTheAgeExhibition,hostedbytheLondonDesignMuseumtheEllenMacArthurFoundation.Hereitwasrecognisedasinnovativeexampleofsubstitutionforbetterrecyclability,approachthatisinlinewiththeFoundation'svisionforaeconomyforplastics. Mondi and Fiorini International Team Up to Develop Fully Recyclable Paper Packaging paperustheircludes,Mr.brandaexperience,isInternational,Mr.ofutescreatingPaper,Mr.MassimilianoScottà,HeadofSalesRegionSouth&AmericaKraftMondi,says,“Thisisagreatexampleofbestpracticeinpackagingthatkeepsmaterialsincirculationandcontrib-toMondi'sMAP2030sustainabilitytargettomake100percentitsproductsreusable,recyclableorcompostableby2025.”PietroFiorini,SalesDirectorPackagingDivision,Fioriniexplains,“ThepartnershipwithPastificioUmbroasuccessfulpilotprojectwhereFioriniInternational'sresearch,innovationandtechnologyhavedefinedsustainableproductionmodelperfectlyintegratedwithinastrategyandacommonmission.”LeonardoFaccendini,CEO,AnticoPastificioUmbro,con-“Reducingtheenvironmentalimpactofourproducts–manufacture,packagingandtransport–isatoppriorityforasacompany,andreplacingtraditionalplasticpackagingwithisamajorsteptowardsachievingthisgoal.”
n EVENTHIGHLIGHT •••••••••••• www.papermart.in / June-July, 2022 | 103
Over70speakersfromAmazon, Unilever, MotherDairy, ITC, Pepsico, Nestle, Haldirams, Mondelez, Dabur, Emami, Reckitt, Tata Foods, Baskin Robbins, Ecoware, and other big names shared their insights, expertise and elaborated on latest packaging trends and pertaining challenges across the packagingindustry.
The conference kick-started with the inaugural session, in which the panel discussed designing cost-effective sustainable packaging strategies for the circular economy. The panelists in the discussion included Mr. Ramesh Ramchandran, Associate Director, Food packaging sustainability - R&D, AMESA & APAC, Pepsico, Mr. Gagan Bedi, Vice President (Corporate QA & Regulatory Affairs), Haldirams, Ms. Rhea MazumdarSinghal, CEO, Ecoware, Ms. BarunBanerjee, Headof packaging, NestleIndiaand had Mr. Rajat Wahi, Partner, Deloitte as the moderator. Being biodegradable, lightweight, and extremely rigid, fiber-based packagingwashailedasoneof themostviablesubstitutesfor plasticin Partneredthesession.byGandhi Automation, Dotsmark Systems, MLM India & Worldpack Automation, and supported by organisations like Indian Institute of Packaging, an autonomous body undertheMinistryof CommerceandIndustry,Authentication Solution Providers' Association, All India Food Processors'
The packaging industry continues to see growth in India and the event showcased various solutions, technologies, and machinery further enabling growth in the sector.
PackPlus: Packaging Conclave Hails FiberBased Packaging as One of the ‘Smart and Sustainable’ Solutions
Mr. Kaushal Verma, Deputy General Manager, Sales and Marketing, Nichrome India, added, “PackPlus is an event which attracts industry professionals to source solutions for theirpackaging needs. Weareverypleasedwiththeresponse wegotasanexhibitor.”
Mr. Sagar Singh, Deputy Director, Bureau of Indian Standards(BIS),Ministryof ConsumerAffairs,Food&Public Distribution, Government of India called PackPlus as a great event for the packaging sector. Talking about the event, Mr. Mudit Lawania, Packaging Technical Lead, Amazon, said, “It is a fabulous exhibition with a mix of machinery, converters and packaging materials. It'sreally interesting tosee how the industry is moving towards sustainable packaging.”
One of India's premium and business-focused trade fairs for packaging, package printing, paper packaging, finished packaging, converting and supplychain,PackPlus,tookplacefrom7thto9thJuly2022at PragatiMaidan,NewDelhi.Atwo-dayconferencethemedon 'Smart and Sustainable Packaging' was held on July 7 and 8.
Association, and Delhi Printers Association amongst others, PackPlusconcludedonahighnotewithexhibitorsandvisitors equally impressed with the management and energy of the event. Itwitnessed 153 exhibitors representing manufacturers, suppliers, and distributors encompassing packaging, converting, corrugated, paper packaging, and printing sectors and The12,231attendeesfromalloverIndia.packagingindustrycontinues to see growth in India and the show successfully showcased technologies and machinery further enabling growth in the sector. Latest packaging technologies, converting and sustainable packaging solutions took centre-stage with eminent players such as Bobst India, Global Link Impex, Natraj Industries, Pragati Pack India, Prakash Web Offset, and Sahil Graphicsamong other big names. With India's banon select single-use plastic items from July 1, the event witnessed the participation of various paper bags, paper cups,andpaperplatemanufacturers.
We have been continuously expanding our capacity to meet the growing domestic and international demand for SUP alternatives in the food delivery/food service space. We will continue to invest both in the additional capacity as well as in widening our product basket.
Mr. Vijay Gupta, Mr. Arjun Gupta and Mr. Ajay Gupta, Asia Pulp & Papers Pvt. Ltd.
Asia Pulp & Papers – Industry should Rise to the Occasion to Bring Sustainable Packaging Solutions
104 | www.papermart.in / June-July, 2022 engaluru-based Asia Pulp &BPapers Pvt. Ltd. (APP) provides a diverse array of paper and packaging solutions – both pan-India and globally. The company offers paper-based, non-PE sustainable food service and food packaging products.
Paper Mart: Could you give us an overview of Asia Pulp & Papers Pvt. Ltd. and its business journey?
Asia Pulp & Papers: Asia Pulp & Papers Pvt. Ltd., (APP) is a 25-year-old family-owned enterprise, which was started with the objective of bringing world-class packaging papers and sustainable paper products to Indian APPcustomers.operates in four different business verticals: l Value-added paper distribution of world-class packaging papers, and paperboards; l Manufacturing of food-safe, non-PE food delivery, and food service products; l International trading of papers, fibers, chemicals, and paper converting machines; and l Job work converting – paper slitting-rewinding, and paper sheeting. Value-added paper distribution While a few large customers can import packaging papers by themselves, a large number of mid-sized customers interested in high-quality packaging papers are unable to import directly due to long lead times, large MOQ, forex transactions, customs clearances, inadequate material handling, etc. To address this gap, in 2011, we set up a world-class converting plant in Bangalore.
INTERVIEW ••••••••
APP is engaged in value-added distribution of papers & paperboards, manufacturing of non-PE & food-safe products, international trading, and converting (paper slitting-rewinding & paper sheeting). In an interview with Paper Mart, Team Asia Pulp & Papers Pvt. Ltd. enlightens us about their business verticals, the infrastructure of the facility, their capabilities, and their outlook on the demand potential of fiber-based sustainable packaging solutions.
APP: Our manufacturing is spread over two facilities in Bengaluru with about 80,000 sq. ft of built-up space.
Our in-house Design & Development equipment and the team quickly convert a chef's concept into a realworld packaging product. All paper reels, sheets and products are stored in a secure infrastructure considering the safety of man & material and ease of retrieval. For local deliveries of paper and products, we have a fleet of delivery vehicles to ensure quick and safe delivery of materials.
One of our most popular equipment is the Synchro Paper Sheeting machine, which is ideal for paper mills producing packaging boards where they need special sizes and dust-free sheeting.
Mid-sized customers can buy packaging papers on a just-in-time basis and in the desired sizes, formats, volumes, and packaging from our plant. Also, large customers buy material from our plant quite often to meet their unforeseen requirements.
APP: Our primary focus today is foodsafe, environment-friendly papers, paperboards, and products for food delivery and food service. We offer several plastic substitution packaging solutions to the e-commerce, industrial, and retail space including paper fillers, packaging rolls, paper bags, and paper covers. Moreover, we continue to provide world-class papers for corrugated boxes, shopping bags, food bags, wrapping, and Thepacking.vastglobal exposure of our founders and their relationships with the best mills around the world help us source “the right” paper for most applications. Our entire team of 70+ does its very best to offer the right paper, the right product, and the right solution. Our biggest USP is to provide customised paper and products on a just-in-time basis. We Digital Design & Development Machine
Job work Converting With our state-of-the-art paper converting facility, we are the preferred job work paper converters for many publishers, corrugating companies, printing companies, and paper merchants. Customers rely on us for mill-quality paper slittingrewinding, paper sheeting and paper packaging.
Single-use plastic has been recognised as an environmental hazard long back. We have been watching global developments in this space. As early as 2018, we were the frontrunners to introduce non-PE-coated boards in India for food delivery and food service Simultaneously,applications.wealso committed ourselves to setting up a Greenfield facility to manufacture world-class, non-PE food delivery, and food service products. We are happy to state that with the Government of India's strong initiatives to eradicate the single-use plastic menace, we are now recognised as champions of sustainability and leaders in non-PE sustainable food delivery and food service product category. International Trading Given the vast experience of the promoters in international trading, we continue to sell papers, fiber, and chemicals, to direct importers. With our expertise in converting, we sell paper converting machines to various paper converters and paper mills.
For our value-added distribution of papers and paperboards, our facility is designed to handle any roll of paper that a mill anywhere in the world can ship out. Multiple paper slitting rewinding machines, paper reel to sheet cutting machines, and a fleet of excellent material handling equipment gear us up to process large jumbo reels and provide customers with smaller reels or sheets in any size that they need and all on a just-intime basis.
PM: Kindly describe the product range of the company along with the USPs and applications.
PM: Tell us about the infrastructure, equipment and storage facility at Asia Pulp & Papers.
For our food delivery and food service products, we have a fully integrated infrastructure including printing & die-cutting machines, over 20 different product lines, and packaging lines. Our facility is versatile enough to handle large and small volumes of customised products.
INTERVIEW ••••••••
Food delivery & Food service products
The machine we offer is very robust and provides value-for-money ideal for the Indian market.
www.papermart.in / June-July, 2022 | 105
PM: Please cast light on the kind of clientele - the different brands served by the company. How do you ensure timely & safe delivery of your products to them?
PM: Please shed some light on the specifications and unique features of the food packaging products supplied by Asia Pulp & Papers.
APP: We currently sell to over 100 locations across India. With the SUP ban, there is a huge interest in our papers, paperboards, and products. We are continually investing in Design & Development and new product lines to meet the ever-changing requirements on the ground. Having stabilised our products and deliveries, we are now looking at exporting our products. We have been continuously expanding our capacity to meet the growing domestic and international demand for SUP alternatives in the food delivery/food service space. We will continue to invest both in additional capacity as well as in widening our product basket. We are exploring multiple models to attract talent, technology, investments, partnerships, and teamwork to scale fast.
PM: What is the market footprint of Asia Pulp & Papers? Also, tell us your expansion plans. Sheeter Slitter Rewinder
106 | www.papermart.in / June-July, 2022
APP: As the chefs say, one consumes food with the eyes first and then with the mouth! Our consumers are a discerning group of people with wide awareness and exposure to the merit of buying food in high quality, foodsafe, and sustainable packaging. are a fully integrated end-to-end operation and this has helped us to meet all delivery obligations despite supply chain and shipping issues in the last 3 years.
INTERVIEW ••••••••
APP: Food is the most complex and sensitive product. Food can be dry or oily, acidic or alkaline, solid or liquid, and hot or cold. Food packaging has to be food-safe. It means not just the paper, but every input – inks, adhesives, machine, and tooling that comes in contact with the paper has to be hygienic and safe. The packaging for different foods needs to be designed and developed taking into account the condition in which it will be packed, delivered, stored, and consumed and the expected shelf life. Over the last 4-5 years, we have done extensive lab and field trials with a large variety of papers to ascertain suitability for specific foods and conditions. We now have ready solutions for most products and continue to design and develop solutions for new combinations all the Ourtime.customers always look at us for complete solutions and we do our very best to provide them with one. We enjoy these challenges and have pioneered a complete solution for non-PE tamper-proof and spill-proof heat-sealed food packaging. We have designed various combinations of meal boxes that go from one dish to twenty including some extremely complex designs to deliver food items. We currently have over 50 tailor-made food packaging products and over 100 SKUs of food packaging and food service products.
www.papermart.in / June-July, 2022 | 107
PM: Considering the surge in the fiber-based packaging market due to the recent ban on single-use plastics by the government; how do you see the market evolving in the future? What is your outlook regarding the potential of this segment in India?
APP: What started as a niche product range for the premium and environment-savvy food chains has swiftly moved to the mainstream with the ban that took effect on 1 July 2022. Many customers who were using SUP are now seeking functional and affordable alternatives. Now that a large number of mainstream customU2 Production Lines Finished Goods Storage
INTERVIEW ••••••••
ers are knocking at our door, we are working untiringly at finding suitable solutions for the mass market. Our learning over the last 4-5 years has put us in a pole position in this race to sustainable packaging. The potential is to change 100 percent of food packaging and service products to food-safe and sustainable fiberbased packaging. The consumer wants it, the customer wants it, the government wants it, the local authorities want it, and the planet wants it – this is the time for everyone in the paper business to stand up and deliver! Our customers include premium and luxury chains of HORECA, QSRs, sweets & savouries, ice cream parlours, bakeries, chocolatiers, cloud kitchens, event management companies, hostels, home kitchens, corporate & institutional kitchens, etc. We have our own fleet of fully covered vehicles for local deliveries. For outstation deliveries, we have tied up with strong logistics and delivery partners who are able to support our customers across over 100 locations in India.
SUBSCRIPTIONFORM •••••••••••••• SUBSCRIPTION FORMABi-monthly Magazine for Pulp, Paper & Converting Industries in INDIA YourRegularDoseofPaperIndustryNews *Including Mailing Cost & GST Please choose the following subscription plans: India Rest of World o 1year(6issues) Rs.1000 USD200 o 3year(18issues) Rs.2000 USD350 o 5year(30issues) Rs.3000 USD500 Company Details (PleasecompleteinEnglishusingBlockletters&attachyour Business Card) First Name_______________________________________________ Last Name___________________________________ Company Name___________________________________________ Designation_________________________________ Delivery BusinessEmail______________________________________________Website__________________________________________Tel._________________________________Mobile_______________________________Fax________________________City__________________Address______________________________________________________________________________________State___________________Zipcode___________Country______________________________Activity______________________________________________________________________________________Cheque/DDNo.__________________Dated________________ForRs______________Drawnon_________________________GSTNo._________________________BillingAddress___________________________________________________________Favouring “TULIP 3P MEDIA PVT. LTD.” Transfer from Abroad (Please mail the duly filled subscription form along with Bank Remittance copy to info@wirecable.in) Bank Details for Payment Transfer:HDFC BANK (Swift Code: HDFCINBB) IFSC Code: HDFC0000287 Credit: TULIP 3P MEDIA PVT. LTD., A/C No.: 02872560002186 Branch: Ashok Vihar, Ph.-II, New Delhi-110052 (INDIA) *Including Mailing Cost & GST Signature / Stamp Please fill & return to : TULIP 3P MEDIA PVT.LTD., 207-B, Second Floor, NDM – 2, Plot No. D–1, 2 & 3, Netaji Subhash Place, Pitam Pura, New Delhi – 110034, INDIA Ph: +91-11-45678 421/ 22/ 23, Mobile : +91 99999 35011 / 22 / 44, Email: info@papermart.in, info@tulip3pmedia.in Pay Online 108 | www.papermart.in / June-July, 2022
Event Calendar Editor & Publisher Parveen Kumar Jain – pkj@tulip3pmedia.in Deputy Editor Geetika Jain – gjain@papermart.in Associate Editor Anurima Mondal – desk@tulip3pmedia.in Sub Editor Soumya Ojha – desk3@tulip3pmedia.in Graphic Designer Ravi Thakur – ravithakur@tulip3pmedia.in Advertising & Marketing Puneet Dua – mktg@papermart.in Akansha Tiwari mktg3@tulip3pmedia.in Priya Thapar – mktg2@tulip3pmedia.in Support Team KushagraSandeepMehrotraKumarRahulKumar admin@tulip3pmedia.in Chief Executive Officer Priyank Jain pj@tulip3pmedia.in Editorial & Publisher's Office : Paper Mart, Tulip 3P Media Pvt. Ltd. 218, Sanjay Nagar, Gulabi Bagh, New Delhi-110007, INDIA Correspondence Address: Tulip 3P Media Pvt. Ltd. 207-B, Second Floor, NDM-2, Plot No. D-1, 2 & 3, Netaji Subhash Place, Pitam Pura, New Delhi-110034, INDIA, Tel.:+91 11 45678 421 / 22 / 23 Mob.: +91 99999 350 11 / 22 / 44, E-mail : info@papermart.in / info@tulip3pmedia.in International Sales : NicolasRNPPelletier 16, rue Bannier 45000 Orleans, France Tel.: +33 682 25 12 06, Fax: +33 238 422910 Chinese Representative: China Pulp & Paper Industry Publishing House No. 101, Gongyenan Road, Jinan Shandong, China Tel.: +86 531 88522949 Owned, Published & Printed By : Parveen Kumar Jain, Published at 218, Sanjay Nagar, Gulabi Bagh, Delhi-110007, INDIA. Printed at: Pankaj Paper Mart, 218, Sanjay Nagar, Gulabi Bagh, Delhi-110007, INDIA. All disputes regarding this magazine will be settled in Delhi (India) Jurisdiction Only. The views expressed in the columns of Paper Mart are not necessarily those of the editor or the publisher & they accept no responsibility for them. CAUTION: No part of this magazine including advertisements designs, prepared by us or through us should be copied, reproduced or transmitted by any one without prior written permission of the publisher. A Bi-monthly Magazine for PULP, PAPER & CONVERTING INDUSTRIES in INDIA PAPER MART Vol.: 23 / No.: 02 June-July, 2022 www.papermart.in Paper Mart Partner magazine: I http://emagazine.papermart.in visiting.beforeorganizersthewithcheckPleasechange.couldstatuseventCOVID-19toDue* Tissue & Paper Bangkok 2022 14 - 16, September 2022 Bangkok, www.tissueandpapershow.comThailand Paper Middle East 2022 3 - 5 September 2022 Cairo, www.papermideast.comEgypt 61st AGM & Conference of FPTA India 17 - 19, September 2022 Nagpur, www.fptaindia.inIndia MIAC 2022 12 - 14, October 2022 Lucca, www.miac.infoItaly IPPTA Zonal Seminar 18-19, November 2022 Daman, www.ippta.co/seminar-detailsIndia Paperex South India 2022 23 - 25, November 2022 Chennai, https://southindia.paperex.inIndia 50th FCBM Conference 16 - 18, December 2022 Indore, www.fcbm.org/50th-conference.phpIndia Papertech Expo 2023 2 - 4, February 2023 Dhaka, www.papertechexpo-bd.comBangladesh Paper One Show 2023 21 - 23, February 2023 Sharjah, www.paperoneshow.netUAE Paperex 2023 6 - 9, December 2023 Greater Noida, https://india.paperex-expo.comIndia CII 7th National Conference of Pulp and Paper 31 August 2022 Virtual www.ciihive.inPlatform
207-B, Second Floor, NDM-2 Building, Netaji Subash Place, Pitampura, Delhi, 110034, India Website: www.tulip3pmedia.in Online Networking Platform for the Pulp, Paper and Allied Industries Most credible source of information for Indian Paper Industry www.papermart.in/emagazinewww.papermartdirectory.comwww.papermart.in
