1988 08 The Computer Paper by The Computer Paper

Puzzled About Networking?

Don? Stand Alone...l_\_1etworlg Mlhen you need to share database or ac-

counting information with many user's, consider the variety ofnetwork options. 386 based multi-user Systems am also offer significant cost/benefits. Sogear up for a more efficient ofiice team. ‘

Call us f0? a free consultation

Technoiogy Coastway System V52 1E4 B.C. 989 West 8th Ave. Vancouver, 736-5039 Professionalism you can rely an!

Put it All Together With Kaypro/Novell PC

No matter what kind of work you d0, d0 it smarten‘, more efficiently with connectivity from Kayproffhe Kaypro PC Nctwvorks combine industry standard NOVELL Netwane with Kayprds full line of networthy Computers, including the KAYPRO 286 and KAYPRO 386. Let your Authorized Kaypro Nctwork Center show you the benefits of single-source networking from Kaypro. Get the connection the KAYPRO PC NETWORKS CONNECTION. EEEE_:_-—‘=TE"."_= ‘Ü

;

—

55T; B u l H In

C—O=M—P

rne Future s

ä R. Caspell lt Aswdltnslnr. #75l5—l49A Street Sumey TeL 597-3110

Coastway Systems Technnlngy 989 Was! 3th Avmw Tel. 7365039 Vmnountrcr

Cmbrldge Systems Granp HÜÖ-Sfifiülüngxw

i” V

’

„ u m m 4„_‚;*;5

Taka-a-hyh Cumpntzrs 5112-11511 Bridgcput „ m 3

mmm

Other Kaypm Dcalers Includc: C0

flflV E4538

mfiä T C 1

hexe. 3

Frilndlj‘ Techno 1151 Melvifle. Vmcouv: Tel. 632-6488

5.23

Büro-V

3 m756-1933 m Camp

‘

W ‘

‘ Norm. Vmuouvczr Tel. 986-76810

2 o 111e Computer Pxpcx August 1988

Den“ CWPMGTS

5101-1624 56th Stxeel Delta Tel. 94355331

6082 Friss: Slmct

Vannouvcr Tel. 321-7144

I II I

Il I I

|_ _ % 099mm

‘m9

Sduho"

PC Of (A Suite 320 1675W. 8th Ave. Vonoouver. B.C. V6.1 N2

: W E N N ‘ CWWW‘ 1915 Lnnsdnlc Avmue

‘

um“ I:

Did you know that we also 531 WG SBWiCG?... suv man n45 euvs WHO KNOW m5 DIFFERENCE.

Nanaimo Tel.

Wlnrd Computer Systems

__-

“fiklwm II I

Sales: (604) 732-6527 5 S9TVÜCQZ

“

(man

BRITTSHCOLUMBIASCOMPUIPRHNIFORMAHONSOURCE

FRON/FTHINEEDHOR

Vol1.No.7August1988

CONTENTS

‘

i Inmandtalkedwimtwopeoplemismonmwhohadnothadmuch now bcoonxing inboth wer: with | cxperienoe

Departments 6 Ncwsbytes Aufl

just

computing. ‘They

volvedandexpzessedttoewishmatmeyhadgonenintoitcarficnnae

wasthefeclingdxulheyhndbeenlcfibehitndnowwithsonmch infoumation passing by. lt is uuc they nave misscd mach by not cazching [onm the speeding information revolution hnppcning tight now. 1Lis not mistakc. Any onegmspingonornkhg novgeveruue mamisfsafem

summa"

gmem

currenflheloadofinformafionisvastandsonnschnewhappensevery

.__ A

__„

_ .

Jagen

Macintosh

dayßmtbacisapoimmkocpingczumnnbecanseitisaffecfingfllof ; usinourjobminomentcminmentmxdinom-envfiununemwehaveto kecpingtuninginmwhazisgoingmmmndusmstayeeonomicafly

’ '

— „

37-‘

m°°“‘„f;‘g„„„„.s„.„g &oraphics

anmterestevcnattmspomtszandsamasonablechunceofsnying

Byms

CanadianNews CDfROM Cm?‘

PCNWS

gffiljpsn .

viablc.

The federalgovcmrmntobviously beüevesdüsasmcymspexxding Jlflge mountof rnoneyon acampaign to promotc scicnocand

gf|31f5_g_

Windows

wchndogyflmnnymwsomahwdxhehaflvufixmmufilheymmcmesflutmufindmmnüm

aneonlyXmmbaofdaysfimheyeatmfliousmumeymrymgmnfifigemfüwufiinmflnhigh techsectoßofcompmbchnobgymfitheixfimmafionage. '

‘

aassificdAds

Wcalsotakcthisseriouslyandviemmalängourcffortshomuwnsmanwaytohelpyoukaepup withthisbmageofinfounutimwefeelsuonglythatthisüfiormfionneedswbemadilyavailnblemd havearegionalandlocalflnvormgiveitlcontext.

Thisissueisabouznuwmmymympmgmameeompmmmgeuuyougaamax NetworksaregIogicalcxmsbnofsmglcwmpufingmceyourufiumepowaofafigglcmachinc, youstantotmnkoiallthcwaysyouoomdenhanocodnerputsofymrbusmessassocmmnmsdmL

Feature‘‚ L o g ‘ Area Networks

CookinsUpANetwak Nflwofknflfisimouidc

Itisalogical progression formany busincsses whostaltedwith onePCtodomciracoountingJowant

T m fi m ” °fL°°a‘“°’N°‘W°‘*-‘*

toachievcsimilarbcncfitsinothermmsuchasorflerenuy.inventolympointofsalcs.Entenhelaocal

Whnguagg

AmaNc-‚twu'k(LAN)

l8‚TOPs'pCmMa°'ndBxk Wchavclmtedaavxityofwayswintgramummummandithnbecnaruleflxmfimpmess & Surveys Rewews forusuwellaswesuuggkfimourownnuworfingcwhonmcntmthcoffioesofmcmmuwhper. Smmdoanmrfemssafilyequmvfimfimphüoodlnckmmydymwbomawnpfingmßmmcs

weknowyouwnllneedit.lhopcyoueujoythcissueandgezsomeinsightsintonetworkawchavctried toincludemoughtokecpboththenoviceandthemorasophisficamedreaflershappy. Sofarnoonehaschewedusoulforotrchangeoffixuntflheootasensusisinanditappcaßyoulikcd iLPleascn-‚cpunfeedbockwufingwemalwayshnpynohetrfinmymandwhaxywwoufllikem u m “ ) :

WemlooHngfa-waxdmnneefingnnnyofyoulivcaztheoonfingPacificRhnCmnwterand Communicafions Showin NovemberWarchforusdownbylhcExlfihitm-slpungeboothailflA/Ihcrc isalsoaNewandUsedConIputaSwapMoctplannodformtobcnwatchfonhazoneforsotnegood bargnins as wen. Until nenissue

M “ßÄ! j

Kinn Singt Khalsa Publishfl/Editor

Im,“5mm‘, A l m Real“),

20Macw_m‘ so

20 m s h a m w m shcu’; EßyLAN u

C _0 lumns

21 Theservificsector 4 N “ , producß 27 The Booksellers‘ Bestseller: Comlng Up In

111e Computer Paper:

September: Edumfion S: Training Oopy ä M Dedlb:Anmut Z2

October: Wmdmrs

‚

‘<

l? ll l

ncsgcs. This Inne.Simply Accounting hit Sofrsel Coxhputer Producß’ Macüunsh Resoumc “Hol. lhc only woomting progmm to maka the

Is your as "Easy To Use" as the Salesman told you it would be?

Der TCP WmatanifiylinlepapztNcwy (whereircounrs)

klfummfivc (rc: 10m1 activities) and " m y rcgdable. Good 11ml: wirh your publicafion. Keep up the 500d work.

Rspectmlly Your; FA. Koch _ Prcsidmt. Bullfiog Reoozding Campmy Ltd.

‚U äJI -15]: J2)

HOHIZON SYSTEMS

‚_._ _ _ . _ . . .

Editarxlove E2310": likelkese andtheywe nimmt guamnleed t0 geb‘published. 7711:1113.

.._._;.„.

Has 'l'he Answer

(604) 591 2245 11028 33A Ave Delta, B.C., V4C 2J5

seen

in PC Magazine

äumwm

—

EXECUFOLD Envclnpe Felder Timd o1’ folding envcbpes m invoioee? ABBA Computer Corporafion G; EXECUPOLD has mmuncad m:mzroducfion cf wha: nhey believe i: the mm1. pracfical am! oonvcnicxlx des}: top parpezr folding machine m dm. Retailixmg for S298, the EJCECUFOLDcm easilyprowss a3 page. stapled busincsssizclcucr. hlcsstltmi semndsmith far more oonsisrmcy manby hmd, which can Luke up m30 scoonds. Chariücs? Vohmteerhelp? Momhly offioe a bxuk wixh EXstammenrs? Give ECUFOLD. (416)477-4033 m’ write w Matthaw La 21 Amber Sinai, Uni: 4, Mtrkhlm. Onmio. I.‚3R 423 f0: more infonnaxion.

Systems (hat don't byte backl Are you concemad that your Ventura Publisher and AutoCAD software wen’! run properly on a Local Area

Hetwork?

ACCPAC BPI LanPnk Releaed VANCOKJVER B.C. hme 1. 1988 03MPUPER ASSOCIATES CANADA. LTD. noday anmunced the reluse of 1h: ACCPAC BH LanPak, which pmvidcs im Accounting System growthmndallowsmnlfipleuszxsuoshmaemmtllsonnmmoodsigv ingrMomcuTh:

niEcmtcnhmmnnmtoACCPACBPIGemral

Specialists in high resolufion

outputfor Desktop Publishers.

‘

odmalldwhlslncsspeuplemspezadmtxc

counductgng btnsntess by simplifyhag and theu" bookkeeping." oftscl 3nd Redford iznplemeuned thair ' ‘trufion sgfeelnmt in In: 1987. Sofßel‘: f "dann. Michael D. Piclwn. suggested that Bqhfonrs products would mect m:needs cf m: 313x215 exflodingsmallbuxincss markctplacc. “I! er: am disoovsrirxg thatsimply Account’

issuinbhfmmeirbookkupingxuqtfiranmts." he said. "Wo wem oonfidant rhaI Redford would mtnlhn-‚Hotlisnltwuorfiy amatteroflinac." acoountixxg ‘Bcdford publishes two intcgrated 1nd

IMT Introduces Hodh America’: most excltlng and rellable LAN system, LIFENET by Univution

Your Desktop Publisking Centre

T0 "Dm Editor Ijustdisouveradyouraccflmmwspapern the ccnnnmfications Dny «wen: a: m:Royal BC Museuminvicwriaonhnu 18. Ipickedupacopy ofynm April arldMny issucs mdmad themfiom wvcrto wvcr. We Mannen-profit organizaüon lhalisgronülgqlfickly. Wemjuslnqwhtlß i5 matkellookingmrcnflefielbqlsorm O‘ ahcrty. 1s clagcd the: ' heilig so well mcewed. "Rlsmg u:the Hut List m und Desktop Publishing mftwam. T11: nun:yaflimuoubclicffllmthme aremany üonirlyourfieepcpuhupruvodtobeinvaluahla er: in need of n good smnll husiness actous. “Vhaeixivicmriacanmobuhyvm comfixgproduct."hcsaid."Simp1y Accounting i5 nawspapflflhmks verry much fur your aus of a

Accounting. Accounts Psyabla. Aowmnx Receivahlgmdlrlvmlmyoonflolmodules. “ACCPAC BPI is a sophistlanmd acnauming

Inxegratcd pzogranxs: Simply Accounting, for Ihr. mM-PC und oolnpnfibles. Bqlh provide an mmmtmdablc. easy-to-use accofiming soluticn for small mmodium sizedbusineqses. Eachprogxmn fially iruggran-‚sxixcommon thatinfotangomüngfinwücnsmasütglediskso in one Iedger is ümnedian-‚ly transu:olhcz lodgcrs. f A: a suggeswd Es: puioe of 5449.00. Slmply will pmvidgmqpupriazc. cflocuvc xfiulmüig sohafimügwillwmficaflyseflinelf. ‘Ihcpmdtzctis uvailnble thmughmnstmajor distfibumrs.

sysm-npusifionednanamacfivepricmmdwnsidaedfluwghoutmeirfinsayasmnmgflubext

andwahavsbecnmcthefimummmfingsofiwarc campmytopuvavidnnctwotkhgfmalowoost Prancis. Vlce woogmrhng sysmm." seid

UploeiglnuserscnlshneACCPACßPl

Macintosh“ and

IBM“ mpponed Hardware

S:Software

s y .Für exnmplß. mmcmacoessafiitorvizwnonmnmcusmmnm vmdm informafim a! the Same time. Mtxlfiple umsmayalsoshmpümsmdaisksmnge.

sales and consulfing

GT. Laser? Edge Ltd 750 West Pender Street, Suite 804,

C.V66‘ 2T3 Vancouner B. Phone 662 3774

alizinginmnssnmigedevicqlhc

ofthelhmmincludßimamlmdextmulSCSI drin: ( w e r | II-id: rang: cf cnpaciücs.

‘

Ncwbfldge AnmuneesPC Network Software ‘KANATA- A powaml mtworking m fi w m

ppksgccmnpnfibkwimflwhflCOMDflaPBX

sein; was unnmmoed uoday txy Ncwbridge Netwart: Corponfinn.

‚TMWCOMDaIaPBXisonaoftI-mbut sdling circucit swilnheddnvice: in I11: wmlLL bula

4-TheCampumrPapaAugust1988

lag]: cf custdmized PC compatible softwarn hns BedfwdouMnclfiul-IMLB: VANCOUVER Tina: mmuhs ago Bedfoxd limilcd.in: usc in a PC neworkixxg enviwnment.“ said Mike Paseoes. Newhridge Vice Pmxident 8:. Software nnnounced the release of Simply Ac- Gänzml Mmagcr of Lhc Canadim und Innenmn Macintosh inxcgmwd acoouming procumfing, RngianTE-fisystrmtpabvidesmflty tiqumlBusimss medium sized busigram inmmdad for man ro

in Vicbofia.

David Humc cfo Softwords Viclnriz.

Wc are warlnirsg an. gmlng up our cover

VicwriaWanchfarmqxzuianinIhefaIL nüc-

msan (im:w: will sendyou Tellyour loca! machma- abow u. Thanh. A’

l”=.‘*»'1.fiLSTl—ll;';Al)’ “ * 2

PUBLISHEIUEDYEOR Kirtan Singh I'll-nahm CONTRIBIIIWG I T O R S Wendy Woods.

KmMaiu. Dmnmmlmhomlflnsayuki

Miyazawn. Keim Ymmnom. Gxmxßuddu, Steve Gold ani Pein Vekinis. CONTIJBUTEG WRITERS: Garden Simmmds. Mih-‚Wolfe. Roher! Hilnhms. Nancy Mnrheson andCory Muzyah.

Tlu: Computer Pnper. Bfililh Columbinis Computer Infoanntion Sauce i: published by:

willplay apivotalmloirxfimeorpmsian

itywillhoumassunblyJa-viogwndwuscmfl administrativ: operations. An anmotmoetnmt mwill bc garding a nur 535mm Cmldim und: in 11x: nur future. CONTACI‘: Hamy Vehavec. Pruidmx, 12-4631 Shnll Rom-l, Richmmd.B.C. VGX 31-14 276-2326

Iamwrifingwsayflmlteallymjoyyour

puiodicaLWhuecanWegetMComyuuPapu

mailitlguhdhnndlingfiwliissuesinCmldL Americm subscripdmu plcase amS25. 111i:i: Volnme 1.No.7 August 1983

CBCcrADAMdimmlymsomoetheirMACFLYs. ADAM Peripherals Inc. in an Apple. Cufified Ikvelaper fncusing urn Ihn ckvclopnmn an! distrhfimofadd-onpoünuform Applemnflcet-

‘Theootnpnnyw expmlednew Richmondfzcil-

DcarTCP

SUBSCRIPTIONS: The Compuur Papa- is publishnd luomhly. If you worum like das Computer Papa: mailed direcfly myourhomqplensesmdachequefiorsltl u; 3205 Wert 13m Avennc, Vamouvet B.C.VGK 2V6 Telepbona (604) 733-5596. 111i: will oover

Neu Maclmosh Hart! Drhrcs BC Gruwn ADAM Pa-iphgul: Inc. of Riclnmnd. 1ms noquired Ihr: exclusive riglns mIhoMACFLY tun-d frum Campum’ disk drhm for Apple Broker:ofCmadafiCßC) mundisclosedmm. dualer: my cnll einher Canmdinn

Klicks

Rahm Barlow Hcaling Exchange Association. P 5 . Hupe In 5e:mure covetagc ofadvemüsus in lhc Victoxia region.

ART DIRECIOR: Rosnnn-y Andczs ( ; :Glnciu Hass COVER DESIGN‚E: ARTWORK: mustrifim by I-Iaxi Arm: Km ADVEKPISING MAINAGER: Kimn Slngh 1511215: EDITORIAL ASSISTANT: Johnüliver PRODUCHON ASSISTANTS: Don Profino und Eng: fmm hlcKzy hlsfitum DTP cuune. DISTRIBUTION: All CiIi Flyet Distribumn PRINTER: Vnlley Weh Graphit:

mid ringe pruduct: an lhc maflwt. Nov: with netwmking. the produa is um more powcrfixl,

modular und dm

Iinotyping IaserPfinüng

PGP?‘-

1 l

CumdaCunwwPnperImflAllziglmmscrved Repmducfionmwhnleminpmwifixout

thcpenuission offlwPuhlishuixsuicflypxohnbitcd. Unsolinitead matuial i: grunfully aooepüed. but w: caxftba rexpansible forrclnmizlg i: unlas

itisaowmpmlalbynxtmmcdself-mflrassed

Suhmissimu m: prdmed on 5 &1/4" Dixlccuu in ASCII (tut) fortan: er Mm: dixlu. am!

CIRCULAIION: 30,000

Number Sacond Ohm Posnge Reflsiratlum ' 771B Prlnhd in Canada. Caund: Computer Paper Im.

3205 Wust 13th Avcnua Vanwuvcr B.C. YGK W6

Phon: Number: (G04) 733-5596

powerfillnetworkiizgfcmlrawhichaddsaguz dulofviluc l0 aMICOM irlsullafimTherßuh will h: more aficiem m: of cnisting hardwue. 3nd greauy expcndod capubilities for PC flWiGlmenLs." EasySu-eet is a RAM-midmt ptogram which givesthePC DOSusermmypowerfixlnetworking cspabilifies widmen! disrupmg normal DOS opemfion. Easyslreet cm b: nctivanad by a simple "Honig" sequence. Which suspmds 1h: eurem DOS activitins und “pops-up” du: min man: screerLAllfuncfions areorganizedinmpulldown mznunwithexmnsiveoonxuxsauifivchelpuvaflalle using a 5in3]: kcysuoke. When finixhed. 1h: exitkeyretunsyouloDosutl-nepoixuwhaeycu Ich in. EasySn-eex offen a numbcr of advanced futurc: includixag: network cum-indem with n single kcysnukg prima: mdixucüon to any netwuxtnd devioe fmm any DOS npplicaflm ' PC Phon: inmactive vwildcardbinnyfileunufcrtooxfiomomn PCs. Filc transfex can be carried oul in backgmund while normal DOS work i: pafomed. and dncsrft rcquire any anmrian {mm Ihn: rcmote PC user. Samen Sntp Shol o tumiml unulation for noccssixtg host comput-

ptimEwimB-sizc ( l l " x l7')pepuhmd.lingm ImugaBaje elecrronic an.ImagcBase An is highinchtdc In enmnlnnor fozr a Hewlett-Packard peu quality. hfigh-ruoluüon artwodt on diskena: for plona’. Thepritnsynanprovidcs engineets und dskmp lfitblislters ushg Macimosh und/o: IBM otherusus wnh fasten’rmnaraund of A- mdB-size PCsyst . '

Fmm libmy qf a m ’ an: million images. ImageB high-quality utwoit ‚ has digiuzed papermapmpbnufcxeachplot. WilhslmdardRS 232intnfacg7hrfBofRAM. 111300 (vmüicndpnofmostoniirm-ffltlxp 35 reädent fdflß. dual pupu input bins and an: in")' 1o ferdesknoppublighn: flxhigtcstqualJnsed elechwnc an onIhe mutet. inpu: ny. Ihc QMS Lasergrnfix 2200 man: for uy 0521.995. Also incluthd n: stmdard features am Pshgod in vohxmes of 100 imagcs euch. emulmm {m- Dinblo und Qume 1ma- quality ImugcB Art is umgoriznd f0: quick und usy prinlen, Tchmnix 401014014 gnphics and HP selectiom Volmms an: availabl: in ove: 50 spe747m peu plouzr (HP-GL). The QMs L u n - cificca Wxies. und arealso xvuilahleheard-me gnfix 2200. based on a Panasonic FPL-30l p-int packng auch a: Repaflvialnet und Neukuncngimhnsarecoxmnutdcdmoufltlyusagenwof Maku ' Im; asevolmnu mpsoedaxusnasm Nßflflpngupcrmmmflteprintar. Ivlillbleirl hlnlungwfllbesoldmendusumOEhdsnnd each (f 100 separate kluges). und n: xvnihblc VARs dinaly from 1h:Print Systcnls divisianof direcfly 50m Ehe manufacnnu. Connor? Prunk N. Whitehcad. 4949 Genen: QMS Computer Pxoducts LuL AvenuggExicino. Califomn 91316. (313) 3311997

plols. und eliminazu: 1h: need 1o physically load

MS/PC DOS --LOIUS ‘l-Z-J

-°

WORDPERFECT

MICROSOFT WORD

corpormo rau avdlcblo. smdl dass das.

vuswptogrammablescriputoautommeommonintnacxicnsuchasmodandiflingpüim configuraüotz. and autn log-m backgromid operaüun logging md rnanimring o szvenl lcvcls cf secuxiry against unamhotizad xemom accass.

cm1

For more Infomlafion Call:

688-2992

Thc Blggest Game In Tonrn Taino Software. filcumnjoxplayetin mecoin

Alloy Tpkcs A New Approach to Networldng Multigßcx schwere is required whq:man man oneusq-‚wmns 1o aoccsfltesamedaunmesunc timc. PC-PLUSfrom Alloy CamputcxProdncts is

opcmndvidwucodegaxmsmmtetinlapmwilh ovc: 100.000 und: machincs. is lamxhing 11s Nonh Amnican campaigxi on 1h: gnmc software agroup fproducß zhuprovideaxmiqxxqand cosl nolutionnorumingnnflüuausoftwm iradustty from Nonh Vmcouver. They recamly am" Ä ' anorunoad m rcleasc o1‘ five new ütles fm- 1h: in: pumcnviromnau. The Con-nnotlmcfi-Aloonmrhnoidßubblcßobble. nwlhodofallowingusuxofdiffaPD-SIG recanüy mimmcod thc orpenirxg of a tersnoacoeaflaesameuxfmmtianism Renagade und kann. Thc eompany plan: re- cnt " sharewm: house m11 for domain. Ihcm xogethq’. 111i: i: achicvcd with public clearing leascs of Lhese and cum 1111:3 on a variery_of "netw Freeware sofiware. PD-SIG which slands for operaxiixgsyszmrxmduding interfaajeboardsthnlpluginmthebusofcachof lBhLAwlelL Axmga thc ‘ Public Don-min Spocial Internat Gmup. will dis- und Ami ST. am. wiring 1o connect the imerface u-ibuszPublicDonxainundshaxcwmesohwarefor Taimfshmnchixzthcoonszmersofiwucmtket boards‘ gahdnmdamtworkopenfingsystcnt IBM Oompatihla. Ami ST. Amis: 1nd Minin- begmin1987 withaxmmbaofjxogannsde- mkocp-Irackofatxdsuvicelhsrequesßoffln: tosh computu-s. Meanbets d u : an: m1 requirad signed for 1h: Nintcndo Baumann: Systan. ixxdividißfl man. 0m: of the oormpumx. callcd the by PDßlGAvhmg/cupmchnseacanlogfiunthc Taitnisstillverynmchamchndlothelihitendn “hosl” q:“sann” has a lugc. fast hnxd disk dfive 00m thnts‘ medatnfxlestobeaccsadby 111e ‚thedtnueincludxlüifiazpriceoflhe bmimss u a thixd pmy lioensae. wäiliaog... Vanoouvcz was diesen n: 1h: hzadqumus of networkeddiskdxivethatsrmu Lhzdamfiles tobe Inchidedinmecaxalog areamembmhipcaxd fliccompnnykNonhAmuicmoperafions. Alm aocessefl by Ihe nctwoxked Users and thail- multiwilhnumbcl’ touseinorda-ingsoftwaxe. acatalog Eiern. Taito‘: president. commzntzd; “Vuncou- userso m. Inmnnycasm thehostmachüle is ofovex 2000 diskx of Software for Ihe asmcialed w: is zhe sito of reoem 1181D und techmlogical dudiczmpdtouxeusluofflxcnntworkopumng cmnnt bc usad Io nm um: applic-a» eormpuursnndmSOpagemüI ordahaxdwareand gtowdnNotunlg/wiflilspmximily solapunfmilisysmmrxid summa-rein] softwm analog. Abonusofiutoüie nons.

be circulnnd rezulnrly. PD-SIGisdsolookingfwnewPDmdShne-

umshipfingaxflopmfiangitwfllalsoprofiz Alloivhastakmnsliglflydiffcmnappronchvo fromcxpandingbusincss activixyinlhePadfic ' u n d : nctw ‚Alloftheuuin Rim." Coima:hnichc1ePorul1o(604)984-3344. 257 samel-nndicy arcmrmgcddiffnmfly. In1hePC— PLUS j tenuenchunrmthenetwofk. insuzadof WcstEsplannde. Nord: Vancoluver WM m5 n havingßhm’ own oomnumr. h:

msnQuautycItpAn

waxcptogrnmmatidtodnübrzy. PD-SIG hopes nopochtc: aCD-ROM cunuiningthehhuyinlhemirdquarmrofwüwima 1113:1pxice of S179. Fox filflhfl‘ infonnnxion an PD-SIG. conmct Rabat S0011. PD-SIG 65-13830 74th Ave Svmcy B.C. VSW ‘IE6 Telcphoite (604) 597-0881

(nomqnoryorprocesxmgpowumfltemnciunc)

usually consixzing of a rmmitor and a kcyboud. Tharextofflxeixeompzxmixxcplaoedby a“slxve band"; The slava band i: similartoflneinxcxfaoe boand mcnlimwd previauly. in 11min plngs inm mchoajtmachinetocommctthcusasto dumm-

CAE.) und IBM mainfxmc users. 111e. QMS Lusergmfix 2200 is 111e first lase-

THE COMPUTER PLACE 860 Burrad Sheet Vcmcouver. 8.6. V61 1x9

O.S.S.

OPTTCAL STORAGE SYSTEMS

DATA AROHIVAL: WORM Write Orten Rand Ilany 400 MBremovabie 51/2‘ camidge v permanent. rellabla. Iow eost transparent read/wrüe softwam o

man dßk drive.

PC. S081. and ruggadizad modois

Thcplave boarß. howevcx.haue memory unda

pzoceqor dedicamd 1o the atmched mdxinaL A

slavc band isreallyjunnmodierboard-on-a-cud. "Thefaptthneachmahsdmüoflmploceuwmd manogyisjzsHikahxvinuhdrowncompum excepqithasbemmovodclosettofludiskdxiveby

placmg i1cm111c bus of the hosx mnchinc. Thi; architnchun: .i: uuactive for a mxmber o1‘ reasom: 1) Bccanse nach user's 51m: boand 3nd thereforeallofmdrptoccssingpowerisrightmflteblß of meinst, vcty fast disk was:b achieved. msecurityofthcdatis inaensedbeauscnoxte of mejnchvork was havc 1h: ability ro rammt: dass frpm the network.via floppy diskma,nmless they Hzv: physieal w e n ; 1o thc hast

QMS’: Ncw Ltser Print: Tablold Sbe. QMS Im. recently mmmed the 11m1mentber of i1: hmgrafix prima- fmxily. rhc Q1015 Luczgmfix (R)2200.I1is Ihn: firstprimcrixius puice dass to offer users print spceds up m 22 pagcs per mimna and 11' 7. 17" paperhandlirxg. The QMS Lasczgrafix 2200 also fcatures uniqm capubilities. includirxg an HP GL emullfim. f0! compumr-aidod design 3nd engineczing (CAD/

- 6179.

IBM oqmppod.

bwywinbeumomnedviaflHodixPwhicltwm

‘v

Vanouvors nevnd. moct omonomlc l up-to-ddo computor trdnhg foclllly. Convonlont downtomn looallon. Prohnlond hdmcion.

firstfllonpplicmtsisafieedfigimclockama copy ofntedmiulnfu-moemanual fmthePCl XTeompuible. Disk: for PD-SIGmanbexs will bc 51.95 fot 5 . 3 ‘ flomics und 52.95 for 35" disks. Nun-nimmer: Will ply 53.95 und 54.95 respecfively. New softwue addifions In 1h: 1i-

dIASEIII PLUS AOCPAC

flneyfiriflonlybeablcmucoessdaumdprugxum

Ihey Have aulhorized acta: In. 3) Users only hxvc n kzyboard and moniwr an thcir frecing valuable desk spucc for Workmg. ' PC=PLUS is mnmzfacnned by Alloy Compumr

Despil: a dcluge of clip an. fm: quality graphics an: still few and fzr bctwem. It is refreshixtg now 1o soc 11m5: ncw packagcs being ofiered. Motto Ima eßase, nsubsidimy of Memo Crcaüve Graphics. .c.. has amomced Ihc introduction of

Pmddcts Im. TheymmpmauedmthnVmcou-

du by Hart Softwm Support Ltd. 111e PCSlav 16N‚ their 8088bnsed slave board. has alist pfloc [S1395andthc NTNX. the netwcrrk opuating Ssystun is S795. For man: informntiorl. 081| Hm Software a: 7324278. ver

i“

DATA DISTRIBUHON: cn-nou compacl Disk Read Only Memory 552 Mbyta famory prossing

electronic publishing disttibtnbn of Iarge data bases microfiche replaoemem 0.5.5.: Opucal Storage Systsma is a Vanoouvor based company specializing in optical storaga tachmbgy. A3a Systems intogralor, 0.5.5. supplies hardware. Software, consuhing. CD-HOM application Support und premnstering servicas. #300 Sovln Wut Sovonlh Avonuo, s

Vancouw vsv 21.4- (604) 8764838

Tiu: Computer Papa: August 1988 -5

TRI TEGH COMPUTERS

ATARI i: said L0be wotkirxg on a 68030-1135151! Version of irs poprulm- ST sefies. The as-yct-un-

namcdmaclüzmswillbeamtumoed insepmnbn.

Aboonlhecardsisasmi-gpflidnlwnflposingu mashulc. 111e 68000l

gamas czrtridgc

Expect

basod camidge sysmm in Jammy nur year u. z mget puioe of S199...

Speclals DATA PERFEOT

XTTUHBO Features:

0640 K Ram On Board IBM Compatibility 1 360 K Floppy Drive OParaIIeI Printer Port 0 Serial Port iClock/Calendar o Mono Graphics

9g;599500

MS DOSIGW Basic High Resolution TTL Monitor

GENIUS MOUSE SPECIAL DR. HALO mSOFTWARE v des}: taop publishing 0 drawing 6: picttue capabiljties MENÜ MAKING SOFTWARE

.‚ fimflajflj“ Ü

11101156

“in3 board

1320m s t a u t Delta. 8.0.

e323

s 9

Camp”:

Pmasonic 1080i Primat

(Roland 1012]................„m5275

ECA Monitor8zCard.....„....'5750

597-4777

ONCOURSE

Learning Centers’ ‘ANew Iearning ‘Experience’ ONCOURSE Lnaming Centers‘ dann are to open soon! ONCOURSE maximizfis uaining retmns by tailoring oourscs to your specific corpomte goals.

We offex comprehensive training t0 yom- stafl’ in our Manning Center er onsiu: and w: provide ongcxing Support for your compangfs changing needs. Call today t0 find out how you can profit from your training dollars.

E}669-29800

Part of the Vancouver Safiwars Center, 400-1190 Melville SL, Vanmuuer. B. C. V6E 3 W ]

-—

ATARI. Smmyvnlc, Ca.‚ has pul. off its trmsputer-based Workstation tmül "a: least 1989." COMPUTER SYSTEMS NEWS repotts

caam LAN vershnofACCPAC V.5

md amfifing 1001:. pxcsmlatiUn-quality areportitng finnctimt. the abilitgl to read Lotus 1-2 3 E105 andzxecxm 1-2-3 macms, und cumpatibil ity with Silvcradn. Compute: Associaxes‘ da11 add-in for base hnetprogrmß S|xpe:C11c5 werkam allM JIXDS oompums. ’ clmmterisfic Computer Associatas i5 prmno a5 anaflvamnge ova- Min-nach‘;15m1.whichre

Ihcdclayisduewnlackofadaemtopmxfingsyxum. Sig Hatmwm. Atari executiv: via: pttsidmgrepurnuflysaysthcoperafingsysnwncaflad Helms. wiunothsrendymfilomher.

VANUOUVER (TCP) Cnulpum’ Associales in amjmcfionwiflß-Comatxdcadmmconxpumrs. In ACCPAC sofcware develaper, demunstralsd meirngw Vaximfi lnwlmcaNc-‚turotkMmage-I receufly a:ufesmMedianJ Produm. Cnuqmlzr Associaxc: has reoeivcd xavc revicm on meiner

hrarIaceexmaummmzofmeirveuionSOf ACCPAC rclcasud in Ianumy. bin the LAN versionhadbemslowm follounlifescanisalnlnwun

+ Iohnson-owxlcd medicnl pmchads pompany jn so]! tesfing kits for diabedcs. T11:

cstunatcsüntwimsaleshmeraxtgeof

5—50mil1iondoflars. Ihn system will meettheir prooexxing needs. Thc culslomimd ACCPAC syslcm included anorder enxry and hwenmoty symm with 1DPCs. 2 Mncimoxhcsß dotmatxixprhters.

uxialnsetprinme: allnetworkutlroitoffashgle dediaamd 386 based 3-Cum server wir]: 150 mcg harddrivemfiasoplfisticatedtapebacktrp subsysm11.

The Vicc Prcsicbmt of Lifespan. John Hayes was pleased with lhc ncw System und 111e Service am! dodimtion h: was receiving fmm Cadmoe. H: 511d umum: ACCPAC syszem i.s being jealbusly eyed by (bei: US purem: compmy which

nxilins 1 mainfi-une blsed systun. CadmocCompmashadapproachedCon-xpuxm Associams m 1:31:11 I11: Erst vczxion 5 LAN. Cadmwinnnmclnostß-Combecanseofpexformamefaswrs. Accmdirlg mCudmrepu-efihtlm Glas. du: ß-Cun sczvc: "scrcuns" compamd m any other LANsysteans amanrly avnilable. T11: SHVE!‘ also 8110W! for oonsidarable finc 11min: which ftlrther enhnnoes spaed und 115er w a s : fi m m Ahhough 1h: Haut was punctmlud with nmchbackparfing byflxetlunevumvolved. ‘mehndwlrewu inlpresxive, anditdidsuggwt 11m1 hadusuial strength Local Area Nerwmks m benommg lrulitynflzxeFhsh-July 18. 1983.021 hubcgunshipphßflleLANPakG399 fcrdmers) ‘und ACCPAC Plus Whduwhm System ManIs=r(S195)) B.C.‘s lnngra 111g in POS Terminal Markat ‘VANCOUVER (TCP) Starting wifl: In investmmtoffloolcssthmflreeyursngmhuegra System Inc. of Yaneouvu 1s shippüg multimiflimdollnurdmfwflndrmfiquchimofsaln

quixcs m80286 u: 80386 micxoprovzxssor. Bmn1 nlc 5 wart: m1 “wen n 512K though S wilh dual 60K diskencs." Ihr. snys, i takrs H111ndvmugc ofmp-of-the-Iinc 80386 PCs Systemhaus: Buys Compuberland (NB) SHL Systemhaus: 1111.‘: buyout off forComptnct InnovafimsDisuibnxfionw.sched uled w closa July 12. was a Satans: with 92.2 cm1. of Computcx Innovation: shares tendecred

—

becncxtmded IOMyZSIo allowrqnahaingshu holdcrs In offer theirshzres a5 well. “It's easiex f0 the shaxeimldecrs m tendcr meir shares now" m waiz for Systuxflmusc w squoeze them o Owens said. Systeznhousa. a sysmms im: ufinmcxm schwarz hnusc. says Computar varionswilloonfirmenooperataas asepcrneti vrith exisfing Senior mmagemmL 0m

Immvations runsjmtmxdcr lüüCompxmr 2-.stntns uns:Cm-uda. BEDFORDSOFTWARELTIL Bumaby. B.C

madcapxofitofCääfilüüüin fluyearudodMa 31. up fium C3151!!!) I. year erlitt. m" man l0 C553 1115111011 ÜOmCSZ

IBM CANADA LTD.‚ Mumm. 0m.willelimi nun: sonwwflmmufmmning jobs atitsT u

plmtovßrmennxtmroyemupmoflwofldI wick- IBM cunsolidation. THE GDOBE’ butmccmswiflbebalmced atIBM Cmnda Iabctamries. guwlh

MAIL

--- -

Compnterseflloeswclcome F r u Trnde T O R O N I Ü O I B ) — F m : m d : w i fl 1 t h

SutcswouftbeashockmCanndafs

I-—--

seflioehdnsflymocardingmthepesidcmof-n

> - » < .mzddxairmnnofthenmjorgimfusiotul Iion rqxumfing the indmhy. John Eichen: prcsidaucfCmxadnsysneznsGroxapLuo -

ofthecomrxyähxgcstcomputcxscflice o

—

(PümmmiqaLkmgrar-acemlyhfldamrzfing au: TommmmldnreccntcmfumocixlPafisfixat

party for Ihm- frst assembly line yudusad Sof-

Term P05 tunflnnl. 1111s mw minimal is put of n6millimxdollaxordafim1Afliarxcc Syswmshc uofsamMorlic-ucalifonfin. Allimcaplmz muss 1h: 650.’) 21min]:onwch’ in Ihn:Mail Mannin-

Cnnndiam smvimmdusuyhaslivedwi a Crash-US. kadcin aflbutnmnefior ' u m wir}: und und is yeaxs Ricknus was spefldng t0 Ihe firms.

imexuindusuyfiflmavuuwasaflnndadhymch as fonnu Indnsuinl Develogmuu Nfinina Gnu: MnCanhy und Link Motmnin ‚MLA Dung Mann.

:.capaaity ‘ ' ofDatnuflPzufcssnnalscrvioe := -' (CADAPSO). “Whatwillchmgemdfl-Erae islhatmneconmuiesofboflammtricswifl o-

flwtmxfinalmunhlammrofthoaaaurmnly „inusetoübltVisalndMnsmtnrdmmmnlfhese 1511111111: call up a omn-al wnuzmtu In check Iho buyats ancoum whih Ihn buyu- wails. Imegn‘:

mütinnmusofixiaficunadflxanmostuvaflnblmlt will lmufle debi: und credit cm1 lrmsnctiuns. dztlilzxl activiw reponing. cl-nqu: ufiimrmlmymanngunmtuwoflashavmg 10cm]

Thetmninalhassufiiciemsmutswmamuixla fromnhnst andreoeive smnllinv mzinfrmneur Jtwmains 68Kwh5chnI1ows i1 t0 b: more programmablo man comrmtinnal tmninalalntepahas devcluped im nun/nassemblarprognmmixxgl

furmSofPu-mfftxi:

Janguagecmbewrirrandiracflyuorisnfldresszble fmm the "C"pugrmuning langulgc. T11: inmiunnlssupportsimegtamadmflfimcfionsaoammbet

ofuniucmbchkzduadoomnunicatcufiflteach

6 -T'heCompumP:puAugusz 198B

733-1322

1cS Hns Canadinn Premiere RONTO (N8) SupezCnlc 5. thß latm version of Computer Associams’ elacuonic sprudam for MS-DOS mzchincs. made iLs shezt [im anadian appearanne a! The Botmm Linc Exhibition 3nd Canfermce her: Iuly 13 und l4 Th: prugmn‘: fealmes include dynamic "i101.-

oflxcnzThcmtitissleekly sryxaamaimmhfimq foolprixu clears valuable. cmmun- spwc. A complem hmdwm sysmm including SofTetm ran-minal wilhburcodereuderandrecaiptprintnrcmbe purchasad for a5 Iow a5 5800. htegrnis lislcd an 111e VSE und Ihn TSE (symbolISI) amd 1m haenrecenfly listaedonNASDAQ in m:U.S (symbol 151117). The ocmxpanyproject! sales of S15 mfllian Lhis yenaffalcphcrne: 604-1

-I

morethmistheuserightnowfiwsaid. benefit mthe Cmadimoompum- snrvine hdusrry lies mexpandad. oppnrtuniües im" Cmadinn Unsiness geznerufly.” NEWSBHBb-Wafiy Wmdsfwnaem USA). KenMairefßaxem USA).Danafllankxnhml {Saum aiuidwm USALMasaynkiMiymawa am!Keizo Yarmnanam (Japan). Grau Buck1er fcfllfldfl}, Steve Gold (UK) und Peter

Vcüni: (Europa)

NEWZIBYTES Cmadlan human chfifü Grau!

Butter. Saure: ID IP2008. PC Cmada 1D

PC1176.valce (416) 285-0644, 359 Kamm!) Rd..#203. Scarborough. Ontario M1K"253.

650MB Hurrikan: Drlve Coming 300l] NEW YORK (N3) -—Advamed Graphit: Applicationslnc. lansm PIiImt-‚PC markztwilh a.65Dmegalytc. Jö-inch rewrixable lasst disl: drive amund November. acmrdmg In Presidmt Alm Goldrlch. Goldfich says Ihr: laset drin “will b: a ‘smzdmdnosdevioaorasmdaxdosndawige: " andwillbepricodnunall‘y atS4.995.Goldr1ch'

sayshisfirmhasbemwoxkfixigcloselywim Olympusmdflirlontlnprojefltwithlhnmxmmt of Sony. Maxtor, a-ndFujitsuThehmdwm will

inchndathzdrivnlhcctnlflollenamithedavice drivcr am! Software will include a nlilily

allowsmeusertnpufißontlwdiskswithnomgard m Ihr: DOS limit cf 32 mgahytß. " W : hure rfiwfinmsectmxovaxlfimillionfimesfüoldfich hold NEWSBYTES. "und with no dan lass o:

degradatiotnwchavenml-‘liglusimulnmronil.

nmitonnetworkslherehnvebeennoproblems.” Aowrding mGoldxich. Advanced Graphic Applicationshasbeminbusixwss sinoe1984andcurrmtly cmploys 5D, most of thcm anghieers. " W : arerecogrfizaclasmeprurfiu- drivcraxidconrroller mmufactma in optical technology." h6 saicl RISC Rund Becomcs Rislder BRUSSELS. BELGIUM (NB) —Thm:amCL1!rcntly many playns inthe RISC(Reduced lnstruction Set Computer) mnket. Cmcntly Ihcre ure AMD wiLh thc 29000. Motorola wiLh Ihr. 88000. Fairchiltifs CLlPFER. IBM will: 111e propriemry RTIPC procusor. SUN Will: Ihn SPARC. Intel will: the 486 (not officially mnmmccd ycl). National winh 1.11:: 532(notreal1y RISC}. MIPS. and naiv Cypress Samicoxidiactor with 1h: SPARC. SPARC. which stand: f0: Scnlable Pmcessor Archiloctuxe Reduaad Campus, i5 a novel idca which offen a basi: CPU ccll. dcsigned with .8 mioronlinus.undoffers 20 MIPS frum tha33MHz part. Designad In sell for S700 in quanfity. i! isurxiqm bocaixse the Chip offen "windmvs registexs" sin-Lilar mIheZSOchip altemzueregislu sets. AI. ampoint, the ussr can switch m molhcr window 811d no saving of rcgiswrs i5 necessary becausc rcgislus am: designed t0 overlap. Just Ihis

pointissuaxmbesoimpurmuflmevezyone

cbmpunmujq lhost maclaines. l5 almady in amtml. Undatmtui, Rndgnn says hix Chips will scll cm plicc und pafommzcc. “It's Ihn m05! powexfill monolithic microplncassor ein: produoed." H: says bis RISC Chip will 005l lass Khan half that of Motorola’: omnpaling offaing.

..‘

—

Half I Spent M; Vacatlon: Solling Amlps C o m m p d m : Bminnss MaTURÜNTU (NB) chinuwfllbcscndingmmethanllohighsclnool. Collage an! mxivetsity 51111km: In Amig: dnlzn’ m m 5 acmns Canadathis summa: In dunonstrate thc Amiga 500. Commodocre aays its Amiga äctimTemnpxbgram willnmmtilAugusßl und fncns cm mniler: scrving Ihr.homc umher. The Student. will wotk in designamd Yen-innig: B 2 0 5 8 the ommiry, wher: thzy will givc anduainingonrln Amignäflüandpufidpm in specialpromofinm md Indcshows. Allmembers ot’ the Amiga AcrimTeam hava colrlplelcd a compreheaislv: unining proyam an Ihn: fcatmes, softwue, applicafions, opuatißn. cm: and 1113511-

you could print your invoices, letters or other data with a pre-desitgned overlay stored comfgruter in your laser pnnter? '

Super

Cartridgc Availablc 55 fonts! miyperacas 1 cmuidge!

INVOICE

A3895

—

New Compaq Machlnas TUS'I'JN‚ CA (NB) Wha: Compaq decided to goilsownwayixlthePCmulmlmdlaaveme lBM-compnibla: umbrclla. i1 was a quastion whether thind panies woulcl oonfinue offcring pafiphflals toupgradcthcmachinemwall. a:least an: will. CMS Enlmcmmts Inc. of Tusün an-

nmmcedhmemitwilloflzrafmülyof8harddisk und tape drives for ihn nawas! Compaq Daskpm 386 machines. with dfiva ofuptn 3201113313168 whishplug inmthecompumsfSCSI (pronmmoed scuzzy) iruarfaoc. Compaqisalsorollixigalongon in: expansim plans. having become rhc 900pound gorilla of the Housmn eommmy. Thc city. which ‘u: slrappod firmwially. nevenheless a m : up with properry tax abammmts. road improvcmenrs am3.3253 millionplanto tum FM149 into an 8-1311: Frbeway so {hat Compaq would kecp its new jobs Lhcxc. Compaq. meanwhile. isholdingup armoumixig its plans while i: smdins gxccenmail offen fxom oihc: ciücs. l-luge Neu Plant HOUSPONUWM-Cmnpaqofficially announced lt willbwßfiacres oflandnear in: prescmhcadqimm-s Em- expmsbn. andbuild 1.4 miflion of spasc 111m3. lt pxesexll ins 1.3 million sqlme feet

Japan Chip scInflaL Wmcbuyflsxißhadm Iapm v:buy onthelapmm spotmarkagwlucchips wer: chupar und plmlifiil. Thema}: differenne hupvxsisted. Wheremcayoucmxldbuyachipfor 100 yen, m75 cemslexsthmixithestntmtoday lhal. Same chip is 51.50 m S23 cheapa. ‘I11: mason for tha chexperpzioc: i: dialmany chipmakus in 111c US. Iulxioed256K DRAMproduztlon. Ihm failazl mmalt: a smoolh trmsitioxt I0 1 megabit DRAM: fmm 256k DRAMs.

CyprcsshassImped inmlhemicluplnouscnmazkm with a 31bit RISC-basod dfip seid IoperFmm a: 20 million insu-uciionxpczmond, o: aspezadfive timcs Lhal of Ihe Intel 80386. It's mgetod a]. Ihc Unix worlcsufion mutet, spccifically. thosa who

VVhätifi„

slcills. promotions and mesrchaxidismg.

oountriesooctmadhrunadimlyfollowingthcUsl

Top Chips: Motorola,Intel and Cyprum? SAN 105BCa. (NB)—lfT..l. Rodgu-s, Cyprcss Sanicondimoi-‘s CEO has his way. Ihe new Cy‚pxcss microprroeessorwillberiglnup Ihorcin popularity with Mowmla’: und Intel‘: Chips.

HPLaserjet+ Owners

Lczimceofthefilmaeomdingtoconmndm.

—

total conrrol.

Theywealso hadmmcüumicdmiinpxcsmmion

NEWSBYTES-EUROPE consulrad was mxious to talk about ir. That's becanse modun language oompilers which are designed m have marny modules. opuate fasta‘ an th: SPARC. Mmray Frei-mm, Cypmss maxkcfixtgmanage: in Elarope, cxplaixled funhet. ‘This Chip i5 so weil duignod ofspaeeon149 acmmflmxcallforthreemw rhat w: know of236 unulators whichnmfasru cm manufacuarixig plants. fom new ofiice buildings Lhc SPARC Ihm they du an tha real 236 Chip.” and fcaxrparlting dank: an thc siw. which-was AkhoughCypresfeekmnümSPARCchipisthe purchascxionly aftßrHousmnofiänv-ials coughndup fulurc. AMD also feals rha: irs 29K Chip i: Lhc Slfrllmilliorninvai-ioufli-noernives“, inclufig an funue, and imdoubtedly Motorola also feels Ihm S-lmc fxocway diroct 1o dowmovm. Con-npaq will Llw SSOÜÜiSIhefuImAWaMHpsLhIv/eto wail evmmally hiremtflllmor: workns a: arcsullof 2nd sec. this aclion. 1.1.5. man in _ Chips Cheaper Japan DESKTOP PUBLISHING A dnmalic diffmtme in the TOKYO (N3) am! ochgr batman of Japan prioc

Semlconductou- Development In Taiwan A5teporled in NEWSEYFES- Japan last week. Seiko Epson phms 1o move its plannixlg. daasign und software developmmu mTaiwmihis wcck. Seiko has amouncod Ihr: cstablishmeiu ofasuniconduclor design ( z u m in Taiwan. Major sanioondamw malnars, auch a: NEC, Toshiba and Fujitsu.have such oemers in U.S. md Emvpc. bat thay only rnodify basic circuils male in Japan. Seiko Epson is giving imU5. arndTaiwm minus

B Tim:will: Blg Names Seybold mm SANTAMONI A.Ca{N8} —'l‘hismaybeit for Seybold Smüxiars andmeSmuCImCmvL-aifion Cent: (Seplzmber 14-17). While Serybold is hnppywith tlla Silicon Valley facility. thc mnual Desktop Publixhixig Confu-eiwe Ihn: the group holds Ihm has outgrcmm it. ‘Iltis year's affaix will leavedozmsofvendorshflngingwflmidouthrlm mmlikcsomanyoftheptixrmsthatoncegrew in Eher: in ablmdmoc. Notonly will thc 63111171! flom b: packed bulmon: thanthe usual number ofnew moduct a-nnmmoqnmts are expected. And. (h4: stars Willbeomovu-tlzvallcy. Tllcopmlng oouzfamce scssion aloneis mfuum: Steve Jobs. John Wamock. sann McNcaly, Alm Kay. Paul Bninnd und Eddy Shah. We hear (hat Mosoorn: mayba mxtyear‘: vorm: so mjoy thal sun while yaunnani try mtto wrizlkle. ZSOFT. Maxima. ispureparing a [ u mvmim of in: Publishcr‘: "Type Fmmdry which tmmlatgs fomsundewMicrosoflWindnws foruseinapplicaticms lflc: Aldus’ Pagemakcr. ‘The progrnm will include a dann mmpression algofiflxrn, und 005|. about S500.

Good news; you can! Call Lhe Laser Printer Specialists au. Dante Group Software t0 find out how you can stom your fotms “electmnically” print allem only when you need them and v: a lmndle m1 preprinted forms and lenerhaad. Hacmess the power of your lasen call now.

dome

group

SjOflWCl9 lnC.

(604) 596-01 11

HPLascrjm- is a rcgislnmd tmdmurk of Hewlett Packmi

i/cP-XT Turbo

COMIES WITH PRINTER, MONITOR AND LYEAR

WARRANTY

;l S1449

l} . w“ |llllli' lllllij. i "ll _ . _

ä?

Sygtem Includes: 4;‚77/10 MHz Motherboard Baueryffimc Clock

. .

dilvvwfive o 0

Seriell/Parallel Ports M0110 GraphicVideo Adapter

2.:“:-

_ ist’! '

II: '

;

Also Included: ° Extra Slots o Qnc 360 K Floppy v 1150 Watts Power 0 640 K RAM ORDER NOW 3nd g“ o T11. High-Res Amber Monitor D E “ “m o 9Pin Dot-Malxix Printer ‚CPWUTER shdmg kcyboard tray 8: storage Cables for ONLY 550 (Reg. S249) lf

‚a

Electmnlc Salm S125 Billion in 1st Quarter‘88 WASHINGTON (NB) Aocording to m:Elcc-

—

nolfic: hduslrics Assooiaxion, U.S. facmry shipmanrs of alecuonic equipnlcnl. oompmmrs. and producl: totaled 5111110515125 billion for Lhe Erst would crcatc Smmmpatble mflrstafions, und a. six maritim af 1988. 11m figun: cxcludes impozts. market in which Motorola. warhich supplies rhe Elfiisayslluisisagahnofaboutlöpucexuova tho

Thc Computer Papst August. 1988 -7

i‘!

„„firs:halfoflastycar.’l‘hccornpuxgrs andindusqjnl

ricloctxonics suctor registered 5413511500 orthe. Ihm Zopcrdcnl ovcx last year's Almtal, up man 534.3 billioxx. EIA says. Total employmmn in m: ‘electmnic indush-ies in Inne 1988 was abuul two i?million, up fivc pzxmml OVCI‘ Inne Of1987. AT&T. of New York. hß anruouncocl n virmal

Have

lthe Selection.

LASER

best cholce f Vancouverfs for buslness g,

Computers.

v:software and accessories

SAMSU

TELEVIDE

"lhfiingfraememdwillbcglnreusigxfilgmlployi1: oompum und lang-diszmoe .5es t0 strengthen will movc 3.000 ‘Ph: jhusinesses. ipovpktosalasandmarketingATäTcontirlumm glose tmney in oomplmnrs und has been prrmcd

jmlbyoompctitorsforitslongdistanoebusiness. ,311m hixing freue i5 on indefiifimly. 3USaMnh Compllllr Tnnslalau languages

5 REDMONIIWA mB)—Advmced Prodncm a;

1Technologie will delivu a aomputn" called. Thc:

Noicethisfalllhemadzfirxafixstamoumedm

Dcocmber. 1987. um handle simulmmus transJlafions of English, Frmch.Garmin, Spmish und ‘Iulim. Chicf cmculivc Show: Rmdcl Süd The IiVoioe can handle about 10.1110 different senl

IBM XT/AT” Compatibles

- -

Lotus ACCPAC

Aulhorized deaier for:

Ashton-Tate

AUGUST SPECIALS

fdcfcmcoontxactowsbdngprobedforptocmemmt wilh an i: will

Borland

says

ldomfonheArmyfflnUfi. AnomzyinTucson. iMiLJsotmslduiIgcriminIlchugw aguiizstthe 1 giant compumr company und twn ofiicills ovcr ‘ Illegedovabillirlgforwmküulcufl-"Wtl-Iuwlwcfl. Ariz. Unisys vohmmrlly disclosed m: Fan l

IBM XTMT

lcRo cemnE software Computers trldamlrlunl IBM roglmrud

Oumorltlon

Huachucupuobmünisyssaidixiastammnentthm ' '

whlchmlyhzveoonn-reddid :"any „xum excecd. 8750.000." Thc cunpany added it “inlnmktomopunrefullyvrithfllegovenmerltin the oompktion cf du: invcstigafion.” In othm Unlsys news, rhe oompany has raponed wenn! second-quartz camingx. dcspil: a.doclim in de-

Logical Connsction Archive 40 MB intarnal tapa backup .................. IDM 500W UPS ..............................................................................„S649 RG 62 coaxial cabln and switchboxes in stock

oooperaxc fully

iinegularifies.into ils billing practioes for wozk

Laser 286 Fileserver with 80MB drivo ....................................„S2995 Taxan 770 Plus Multisync Manilor..........‚.‚.....‚..........‚.................S875 Fujitsu DL3400 wids carriaga 24-pin prinlar Microsoft Excel top-rated spreadsheat .....................................„S395 Word Perlect 5.0 ............................................................................‚i349 Multlllnk Advanced Rel. 4.0 .......................................................„S495

m.c

tznnes.

30Unlsys tvo Cooperate with Probe 5BLUE BELL. P8. (NB)—Unisys. an:of scvcnfl

- -

Pagemalcer Microsoft

‘

fenseoontraots.Unisyssayseamirxg5inc1u5ed34

pucaumslflßmillinnfortlzquztcrÜsccnß per shme) compared m S12l2million (62 zum; per shme) for the 1987 second qmm-rar. Soocmd quarlarrevmuas wer:82.4 billion. mmpuedwith ‘S13 billion fonhesoomtdqxmtwoilulycax.

äiäiäfitäflfäfös“äälä“°’ Phona 430.125: 0m 9110W“; 1

Pnblk: FAX MachlnesDebutlnCaIlfm-nh SANTACLARA. Ca. (NB)—Necd|D faul a

„douxmenlsmucwhcrehltyoudoflthavenfu ; mnchim handy? A Samt Clzn finn has Ihn

mzwm

qnswa-ptsblimuofiitcaxdopezxadfax machinslomtedaairpozuhomhmdonluxpublic

NEC c„.„a„e„„.„.... ß

Local Araa Netviork

Videoshow Graphit: Presentalion Systems

„

_ _ { E M lnn-odzlcod a new 1in1: of mirficmxiputnrs called the A5 400 Serias an Im:21. (A8. il mm5 nur, sind:for Amlicafion Systmt.) Besidm having more speed. Stange. anal pawar than Lhc Sysmm36 3nd Syslmn38 niaclrlnu 111c)‘ replafle. Ehe nnw machincs also feamm online servioc und Support. rhe first full implunentaxion of lBM's vmmted SAA Standard of oomloclivity. and a n fl W wilh 1h: people who re-scll IBM mithin: und w-rit: soflwmc for lt. Theo: Busi_

uns. Thzmndzinnmoombirmfmhnilocspnhilitywithastanslardvoioetflqhonauflopcralc similarbmesystanumdby mmmaticteller nmddms—imsextaaditcaud.puzshnfewbnmm andyourrumacfionisckmc. “Wcpnldalotof mmfiacmmeaseofusefAwzynelnkgvicz

ptesidmxofsalasmdmarkefirlgmldNEwsßY-

Tßäüpublicdocsnüwmlwfoolarmmrdwifll something dimlooks 11h: aoomputgr."

ness PammsmsIBMnowcallsu-xermwmkcpt hfotnmdltlnpughou: lhe design 1:00:55 of Whal IBM was doing. und 1,000real applicafimu wen: shown. worlcing. in IBM dunousn-niom world-

nridnmthadxyofthemnmmncuncnnl-letekme ‘A mmlasllow-downonallthemwmlff: of-the-line Symm M5263, i-xuroduwd as a lowcnd machinc wir]: 1-2 nwgabyns of main mun-

oty. IOS-alzomegabymofdisksmragc. mdothu

femmu. IBM zdaniued Lhal “migratixrg” System.

Sfiapplicafioxxs IotheASMOOis alinlehaxderlhm Inigaling System 33 appllcafimu. so thcy offer “Fhehlodels Ihisfcxthcnnallandlhcünfid. 10 nnd20. each abnut the sizn ofm nffioe lnsh cm, which plug imo In ordilmy 110 Volt 00.11101, and fealuze imemal memory ofup m l6 magnbytes. wim up m 945 megabytzs of disk storage; *Thc Models 30. 40. 50 und 60. mounn-‚d in racks like old mninframes, with carrrponenLs likc proscssm. tapc drives. menaoty. und oommunicaxicms Systems youcm mix andmmhasyou plcase; 8nd ‘OS/WO. amw opaating system which is backwardcompnfiblewitholdsysmnßö 3111138910grmu. und upwud oompafible through SAA (stand: forsystuns Applicnim Archilcctmtflwirh IBM PSIZS. PCs. and mainfrumes. The mnomcerrlm was mal: worldwidc ove: a QOO-mdc salcllitcTV hook-upbeamed fmm New York t0 audiemes across fixe U5. (Thcrc was 2,000 onluokm in Atlanta. for instunce. 1.700in New YorkJTln saxzllite feed was followod by m houl’ cf tcstilnolfials in auch City. (In Atlanta n Mode! Züwassupposedrofisefinm mecxchuma pit smmlmded by fliealxical smokc. but regional exec Tom Smitl: cannad the mnoke a: Lhc last mirmtaffhulcvmlwas followed byfmnfood 3nd an afwnoon of dmuansnrafions a: IBM Geld officcs.(Atlanm's andiannewasbroughlto lhenopof thencw SO-SIQIyIBMTowez. amllefrommeFox. whu-c Ihe-y saw dozaens oflocal softwuc outfxts slnwixtgflmirbestmfi, livcandrwmingmnAS/ 4003.) In addiüoxx. vmions of Ihr. softwze am worldwide (lik: availahle in abom 25 EnglishhpanweJraJimmtBASIC. Pascal. und C) und gerlexal delivcriu worldwide l3ogin in August. Prinz.buodon Ehe nndelandpaiplnu-

alsyouwanncmnmfiammflßoümoverfl

million. NEANIIQG—'l'hisisIBM‘shst.mdmaybebest. Ghmcclnfoistlpmpriclaxy axclfitmrmemdallwmmllixlg uwclopcarotmdißmstomersfifiwyüe oflqmg nlßßdiscomrwhmyouhxy erveryflihg hudwaxe. sofiwnte. pximrs. . Suppm. W e n

—

Thetwobigadvmlagtsloilsfuxbooflnarcoon amlpivacjnhenfis. Al-nlelrcocnflychaxged‘ oomputcrpaper-LlxouglnßhlflmmilincduLuh: S18 In scnda4-pagcfaosimilsdoalmexu. caiunandonllxmsezfioefunclming unlmetmuwill malte 1h: ThePayFax booflschugemlyss furlüminumes blcshoofing 1nd soflwaxc npdatw) q m m : Systam 36 und m emlxaa: very temptixxg —usuallymmeth.anuloughmsendfompagß— anxßßüforeachaddifionalminum. Andnhomls Systcm38 ums. (Onelonulowlcucbillßvfly forlhe mopenmrnonnnllyhaslnsmdlbcdwumßmfor monmfmevcyümgIBM pomisedJAs und 3ten: thoMac mm. Unixusm, rcstofus. you—abigdiadvantngoifyou'resmdingsmns- mwnslmdwill: fully-lnadod Coznpaqs and LANs. FaxPhnxlysllncfurstPayFnxmaolfinoshxvabeen Ihismayptovemoflermcanliv: wilhout.w w w w v w

insmlledaxfoußayareahmelgincluxdixigthe Holidny Inn Gulden Gateway in San Francisco

‚ u n n n n n - m - n n m m w r

4»

SALES°SERVICE-SUPPLIES

o‘

CALL

\ \

683-5225 Natwork InfoSystems Inc.

B07 535 W.Georgia Strom. Vancouver. 3G V68 126

8-ThcCwnputcrPaperAugustl988

W H M M W W W - m v m m fl "

andtheI-Iotelsofitslinlledwoodütyuüflifomia. English-Japanese Tl-uualnfluu rrom IBM Jacnd oflhc 3 m . 50:11:01.50!) mit: am pan TOKYO (NB) —IBM Japunhas dzvelaped ByJhc ‘3 t0 h0 opearating in 10 U3. chic: md apuogrmn whiclnumzslaus English sexumccsinro 20.000 ‘msullcdby memdot1992. CONTACT: "Japanese. ‘Ph: system for human nssisred lmCarola: Hoffmth. f0: FAXPLUS. 415/8934501!) guagc translaüon (SI-LKLT’) clairns in tmnslatiaon algorifllm i51.5—3 fimns m m : cflicient thanhuSumma Blfl frnm US Military Contractors pmsnuncn (um _. Lack of mmganm. mm rauskam‘ 1und3. SHALTlnclMsm Engtnethotk und training in schwul: utginoerifig lishnnnlysisfeamewhlchcln-lfzesthcpmtof foruchwuimEnglish-Iapuxcsenuhnnpmdefiuncctmtruclorsdcvolopfing fctfeaxurewhichumsfersfluresuhotmnalyzod umdybycnncgxehlelpsogxamsmceordingm km Univmiljnhlililzyoounpnwz couuncm lach a Englishiximoflaufiglhhexprcssionaßwflllu fiocusod appsonch m schwarz mgiiunerhug. au.- into ahalfexpressim oflapnnnse. mdalapmme sammle:gma-afionfutmnIBM Iaparnhasbeglm repott by m: D a m e Dqaarunwfs Software Irlsfimtc nt Camegie Mellon non- n-mslalingits ownmmualswixhflxspludnncLThc chxdedffhefnmsdidnotmcksoftwuu eminent- Erst. "IBM 3174 Central Uni: Guido" was pulgIBM Japans hagprojoclxadoqlmlclymdlaokedtmlform 5un- lishoclnttlunxidcflcofthßflloflth SHALT in 1h: Japans: the to raluse aiming dmisfot developingsofrwareorfmesfimlfixlgthc amman. ‘sinemdunstofpojcxslsfThebommllneis mutet afizr funhu imptovcmmts mduced efficimcyqxodlacfivity. mdquality du:- Teletel Iandsln Japan Fraxrc’: Tclctel. lllß m05! dcvclupmnll." suidTmKßsaofflie TOKYO (N13) ‘ ingmftwlre instlmtc. "N011: of us cm manage Software vcxy vidootex sysmn in m:world, i: hoadod wcllfhck Faguson of Hansmann Air Foto:Base for Jnpm. Franco’:Tcleeom is currmtly wen-klug wilh Philips Ilpm an. lhc pcoject. Telwom Im: _« in Manacluudls lolrJ flle Associaled Press. ohtairwd sales Baumes forits lmminll machines. IBM’s uns: um: A400 Mlnl-Computers 5 ATLANTA (NB)—Aspredictedin|heJL\ne2l callod Mirlitcln, in lnpuLThcy cuuld shipas ufly ' editionof NBWSBYTES- UNITEDIGINTGDÜM. asthisfallIlwMixfiteliseqaecmdmmryuprioe «

FOR

Janunwwmmaunmwwwwm

—

xiva’. a stntistical multiplexet‘ I h n handle: du widmeten. tcrmixtnls. flxmngh scvm asynduonom RS-232 im CAPTAW for pries Vidaotcx i: an information saaxch servic: using einstmals. Newbuidga says the- 1070 i: a costda13 und i5 telephone Iines.By cnlling up Lhcconxpunter unter. effmtfw: wzy cf disributing 115-232 and stock l0 instan for cm scaxch munts news. simplc shopping. you market quotes. and Weimar reports. Software Cumpanies Fron: Japan TOKYO (NB)—Japans: software devclopmmt Symantcös 5 New Products For Tbe Mac oompanies havebeenestablishingbases inEmope BHM0NT.C9„(NB)—Cnnfirmi11,gilscmnn1i1man: m th: Maxxinmsh matter. Symamec has 1nd U.S.A. a1anunptecedmtad rntn. rclmcd five neu: software productx, inchiding m 1 officc in will asrablish TSD. Tokyo. oorpurnt: Los Angeles-bnsad upgradad dasktap pmsctuaüm pmdncx. MORE um0 5 m 1m: TSD Ametica will davelop applicafion softwm II.InBcnt3.0.TTIIIWK’: LightspeedC SÄLTHIIQKE; for Japanese oampanies entezing 111e U.Smerkst. Lightspaed Pascal 2.0. und Just Enongh Pascal TSD will Support softwan devclop- W fl ’ ! ment for 111e cnmpmies wilh which TSD has MÜRE II. considued ( h : centcrpiccc of comrmed. Mmfih-bmodTSDwflJbe setup in Synmtec‘: Macintosh offerings. "s a complem und presentation mftwlm sysAugust. withjoint' invesrmetubyPzul Akim. stcp plmmittg. writixxg. mm ndvmoedouflinilgawordptocesfeaturing brotherofPmlmpme" Prcsiduztäquinoacnddirw‘ Software Associnxes. TSD will m. full dnwing capabiliry. and the ability in 1o: of 2nd 35mm ermust 20 pamcm of th: snftwm dcveloprmu man: customized oolar overheads anusw: At 1h: slidu. oonfctetwe. Symante-c ordmreceivcdinIapmLmHüJippineTSDwiIMn mmoad 11mlslide designs cmated with MORE H fivc ycats. Nleanwhile. Ins: will estnblish oorp-omte officas cmbemntviamodmtoMAGICorpofEknsford, slides via Airbotne inmeuibytheendofthisyear. Software Ncw York. which will deliver Research Assodatu (SRA) will sct up SRA Eu- Eitptess. within 2A homs of a call. u S15toeuch. cost in thc fall MOREII is mpe in London Iltis Ocmber. Toyo Infon-nnim Availahl: for atmen:MORE ( expecml I n n e n . Itis also S395 o: S89 at System (TIS) m: up TISUSA in Los Angeles nuilablc u:PowerPoirll. Cxitickedt lfresenm. und (h:beginning 0Cthis monzh. 0 1 m m far S89 in 11limiwd time ReadySetShow Futurlstlc Communlcaflots Project Launached offen TOKYO UWE-T!" Minislry of Post:mdTeleoomnnmicationsdflrflfljhuxelcasodarcponwhich Mnclnhdsh Today Tlhluid Folds dem]: a 2151 Ceamry Universal 8: Intglliguntt SANFRANCJSCOCNÜ-Asexpecxcczkmw CommutticatiotmNetworkflflüüasystunwhich Communications has pulled I11:plug m1 its fledgman-ins both ztificial intelligema und Ideenm- lingMac-ixtlositwcekly tradepublicafiotl MACINTOSHTODAY. Resident David Binnen. in the mmticatiom wdmobgy. other finalluly lüssugtfllsrcadmthcendasoomeüt 111e UICN i: cxpoclud t0 pexfonn. among tasks. ahmmatic language Emulsion between hast asyoafve come In lcnnw it.” H: jxliscs Ihr: und dedicatod staff, then explains speakersonthctclcphone. arudwillhavenewdnn hard-warlcmg “W:just didn't gct 1h:rcspmsc line. the hemmt mmsfermemodsinwhichthzcallcmcednotknow fiomadverfisers wcnocdciomparmlloompfli)’. the protoool cf 11. runote reoeivixtg station Thc UICNproject is nntjustpie-in-flic-sky [hink- IDG Cotmnrunicatimis. decided suddmly in and 110|. to umünne investing the ing. Therepcrtwillbefltebasis ofameefingby very recently forarekmdxofthc He ycafs und between researchars who will be in- ncwspapcaz” says hshopes publicaticm. pnssibly onlinp. In the meantitne. volved in implemcnlmg the ootmept. mostofthestaffnrsare expemdm beswitclwdlo Voice Recognmon Technology Dcvelops the other PCW publications PUBLISH. has TOKYO (NB)—Japm’s einem gizuNTT mtl PCWORLD. MACWORID. davehpui a Iarge- scalx: httcgtated cixcuit (LSI), Latwt Quartal’ Earning whichcmtdistitxgtfishbemremamyfiadofdfiffex- Apple Shines In amvoiaas. The chip zum: it possible fort a wie: CUPERTWD. Ca. (Nm-Continuing its stellst reoogniümtboaxdmbeonefotmhthcfizcof pafurmmoe. AppleComptnct-hasumotmncxithm cutrent pqiphuals, etubling thcboatd In b9. in- itslatestquanupcroducodafl pexcentinanasein camings t0 591.3 miilinn. oompned t0 353.5 smlled in 11. PC. Salawereupßpercmtm TheLslisexpecmdtobringavczsionofflTTk. nfillionoitcyaarago. ANSWER systmt t0 und-ums. In us:by bmks. 5993.1 milfion. The 51m anribtnns the grau. f1;ANSWER allows customm n: duposit 01' Vlilh- ums m“good progrzss in ihn: Business maxkut,“ drawcashftomthcircheckingorsavings aooolmls aocmditigloasmnemeutfiomßelYocmgAmltfs offiocr. Especially ennomaging ohief thxough a telephon: czll und chwks their voiu. wer: operating zum;salcs of Apple‘! high-end nuchinc. voice dmn saved in im danbuc. agahist ofmdcrfiilflüü yEn0I5380. f5: lower Ihm NTT‘:

Macintosh Rentals 2527s

-ssso/Mo.

‚Lease to Own from

S106/Mo.

OR "rnade-up to Mac n '

{mm

‚

SZISIMQ,

—

Expandable Hard Drives MASS O MICRO f0?‘ the Mac. n 1 1 From. ‘—;r"

a hard drive that mjght Afraid o!’ be m0 small for futune reqtflrements? Statt With what you ran affm-d and add m m 1 : stornge when you've teady.

DeiskTop Publishing and O Fuß 1 Year Warranty CAD/CAM O 3o Day Mauer Bsck Guarantao <1 .Systems a1 | ____

..---._--E’_‘f_‘_?E?3__2’:___„-..- .Q..*.€'E'.'E.E{EEEEEQEIEEEEE

—

theMacinmshH. Brucehtpalkinofflafllbrechlofr. Quist, I. mahnt rasend: 51m. says 50cm:501K!) Macintnsh 11s wenn mmin 1h: last quane: comDCAAnnounccsaFiberLAN Heftmhcx AJIHAREITA. GA (NB) Digital Commmfi- puedmfißflüinflnnevimasqtmfiu. rcnwkedthflflnmnstnrpfishgaspoclofaxpplds catinns Anocialcs mmoumedalocal unnat;

11:1

„u

—

AM4!) jguqn

w » :

mostraoexztmpottissttongsales inüflapewith

workflukmusixtgopficxlfibasinswadofooaxia] hmnntional saies aooumtting f0: 38 pemeat of LAN115::softwarc cahlg. Th: lO-NctFib-et Optin

dmwebpedbyDajnnxgühio-busod subsidimy 10NetCmnmtmicntinmfut-tnerxly FoxResammn-td cm comect sevsralhmxiredconrpuastogether Wifltotnreputztxnsecastwillbaflßilflp: nndc. including sofrwnre. pht: :boutS3.000 for

themnüt hnb. DCA also atmoumed two LAN gmways. IRMAIAN 8002.2 111d. IIIMALAN SDUC Gamwxy

Lwhichlctuscraofsuchuwsaocassdamht

mm1 5x15.

Clnris B1135 Filemaker Top Selling Databme M0lJN'l"AINVIEW.Ca.(NB)—lniIssacm1d Ioquisitioninnsmnnymotuhaflnis, thcApple Conrptmer softwan: spin-ofi. 1ms purchued Nashobl Systems of Fosmr City. Ca.. unter of FfleMaker. the. lagen-anfing dambasa package forflncMacinwsh. The aoquisiünn follow: Claxis’ purchase of smewm of Hmnton. and ptovides

mainfranm systcrns.'rl1:802.2p|odwtletsmn— Clariswithamcrccompletelincofhdachamxh IBM m-Netbios cmnpatible LANs man: IBM softwam products. mainfiames tasing Unken-fing technpluogy. Thß Undermrnsofflwdctiwhiflhmpoflnflyoost SDIE Gaxewny 2 pudwt. cmulntes IBM Ermi- Apple S7 miIlion. Nairobi’; programmcrs will, City nnlsmtheLflNtppears tobedirazlyctmtmclpd renmin in Massnclmsetu whilc its Poster toiLNaw softwuemclmümemtiettmfarflm opanfim will be folded inro Clarix’ Motmlain

Surrey, B.C. V3W 8I6

’

—

52::

Maas man 51495 1121540 51095 Maas soe/i S1695 P2E5O 51195 Maas BSe/i SCALL P2E85 SCALL

E"E°»'i°r"‘i"s"

—

Leiser Printing

QMS

Expert Assistance

(604)5915550 MacStation Rentals

fmm S15/ hr.

— — — — — --— — -— - - ---—

lby

Layout, Printing, coniplete Productlon servloes Design,and Distribution.Folding, Binding, Copylng, Typqsetting, . . ..

u u u u - p

C C

n n ca

jfree!

MacintasliT-M-„Sqftware ßfluyerfs guitfe 16Qages ofpracfuct diescriptiam und piicesfor aber 100 qftfie m05: popufilr scyctware

tfie Macintosh ä

‚i

Mail Ihis coupon to:

Saltspring Software, 123-101 Meadowhrook Drive, London Ontarid, NfiL 1C7, 519-652-9595

mMAxantlIRMALäNlinnswmflsomnotmwd. Vww haadquntn-s. APPLE COMPUTER, (kaputt-n. CL, begm WangRoIIsOIItPCSemu-ity Device LOWELLMassJIiM-Warxgubmatqmhß shipphtg i1: AmkFu Modan. S699. Operation tmveiledasectnitydevicefiorflnwuzgmmfll afthgmodmt wifltuMlcinlmhacfllallyreqtfiru im machine 300seriuoEATcluncaandforPCsi11stn1d- um: ofa couvmtioxial rundem. Thcfucnlls lobe ahnmietwotkdmdworkxufimtmvhmnmts. aormmwimsofiwuewifichalbws timc-dciayodandpezmitsprmfixtgmnhsnx11uongltalicmsiugdealwithMicrmtynlnmof Wtiw

prima. RichmdsmTexasJhnMicroCmnnlpodtwtuses an advanced sean-ity kam-l. clwuonic nimm. TEE EXPLORATOBIUM. San Frutcisco. a andfilnumyptinnlocluxiqtiesflhestrmityka- ltands-outscierm munumt. haneccivod 5170M!) nclisanadditionmthccpaatimsystent. Aecord- wnnhofApplccontpuhets——3fiootnpumninnll ing In W215, iLamblesMicroCmm-ol u: promct includingfihdacinmshflx. lfumachinqatldiil ixselffiom anamplsmlampcrmahuitsconuols. 5Es—in:donnfionfiomAPPLECOMPUFER. hfiuoCmttrol is 51,200 3nd. i5 Ivaihblc hmnedi- 1113 machines will b: used to oducc exhibits, atnly. gmphimmnzdlhnErplmimfimn smagazincakun lexar Handles7RS-232s Hipsctmun ofTh:Explomlorimn.toidNEWSBYNewbridgeM KANATA. 0m. ) -—- Newhidge Netwodt: TES. Cortmhas anmmtced the 1070MnhmuetMuJtid-

11.416

Macintosh is aTradmnaxk Ucetlsed w-Apple Cumpttlcr. Inc.

Thß Cmnputet" Papa: August 1988 -9

1 ‘

i! 1

Ngw Mag fnr M».- Dealers MANHASSET. N.Y. (NB)

5000er hu Ehe dust. 011e Macintosh und: mblicaiiun MACINTOSHTODAY.timn anotherhas 13km plane. CMP Pilblicalions is 1511110111113 ß

Don't be led down the garden track!

biweekly Labloicl Iinwd a1 dualen: Of Apple Macinmsh Computers am! Macintosh developalis. B111 lmfikc 1h: deceuesd MACINTOSH TODAY, whichbolsiod 1101100181591!of 200.000. this four-colur maguim will hxve a cuntmllcd circaflafion of 24,000. CMP 1ms bccn an an aLm-cssivc hinge of new lamchas of uns. unvbilirxgTonuntmicafimu Week International" “Unix Today,” am! ‘Lmig Island Momhly" in 1h: company pub111c last quarur. Almgeriter. lkhes 15 magnfims. T11: ncw Macmagazirle. 011160 “MACINTOSH NEWS." Will appca: an

Get a second opinion from J u m p Software Ltd. before you choose your Software and your network, and before you commit your business t0 one of its most important decisions.

We haue excellent references und only da professional quality work.

1:1 1) 1-5 1:1 4) 26-50

_ _

"I11: Fnnue ofLANs _ L A N Lanzuage 113PS mvinw__ MnoWriw Jnugi-Smdio_ EnxyLAN I1 Cotnpunn am! 1h: Luw BBS Li.n_ Booksellds Best5a1Icrs_ 2) Horw mnyothcrpeoplereadyourcopyo! The Computer Papa‘! Ü 2) Oneperscn Ü l) Nubody Ü 4) 6 m-man: Ü 312-5 pwpln tu 1h: Do kecp pnper afier you 3] you Ü 2) n0 rund it? l) ycs tlom In the company’! 4 Wlmt is your C12) Via: Prcsidcnt 1)Pn:siden '

D 431111051: Manga-

mmÜ 6)Consu1lunl Ü S) E11 ÜÜSaIMadEmpIoy-e: C!!!)Oüm sjAreym: ÜUMaIG ÜZH-‘emalc

021010

o 5}51-100

CUPER’UNO.Ca.(bTB)——Wi1hinmrommüxsof 11s mleasn. vemian 6.0 cf du: Macintosh systzm sofiwurc is being revisad. Nmnuoux enmplaims of bugs have prompted Agile Complutcx’ 1o promisemupdxgvaxim 6.01. byflwmdoflulyjun

inlimcfcrlhcshipdatcofthnnewknagewfimu)

prima!’ dfivx. User: 111.111 110151011 6.0 hul ghfing problams wir}: sound fllcs. scr-ipt. edifing. e010: 11:11:81: filcs. und MultiFmdnt. Cmsequuuly. | 1 : cording m Apple spokeswomm Cyuthia. Macon. rhncne ammlof 19pumches inrhonew syxxnm Software. APPLE COMPUTER. Glpenixlo. Ca. is ex-

Anli-‘fiunlictflw formal responsa In Apple’: Ap-il l7 mit. dmied n111h: allegatimu. askinz 111a:111e vom invalidam Apple‘: eopyrighn. Buicaliy. H-P 11m Appl: dm: not bald valid oqpyInclinugas 1191:3113: xighß für imvisual

pectedmmmomneanewflaxbedapficalscmict.

nfiümgabyu: lapcdrivmamwmonodnmn: mornimr. andahigh Iuohxianmanochrcmevideo

1:1 3)

aihptuucarlysmxzustntdxeßostonhflacworu

Bxpo. Alsointhewhigsmangwvasionof

HypuCrimdaMac 8E WiIhZmegabyEsof memoryandadormgabytc intmulhzddrivc. Snpernuc Seil: 1o Venture Capital Group

iljdidnatwiginarzflnmhfmtfizcyweteflm podxm of mental: a1 Xarox‘ Palo Alm Re(Imm- (PARC) fint shown es 5mal]

äh H-P

MOUNTAN VIEW. Ca. (N13)—Redir|k-blcodSystcmsmayfinallygetsotne

also chirged 11m Apple muüpulnmed NewWave in samples i: gave du ooun unddie "Newwlve rqzresclm 1h: mosl sefious thmatto App1c'smonopo1yar1dfl'1emostprotneffective und vigorhing m a n : Of qus wmpeütion in this market." 111e mmmsuit Appkflsmsponsx 1e:acotmdadde.

nleum-ofiruuuto fiscalmliefifltefirmhassi l0 531111: covamd SuperMac cchnology 111e Sigma Parmezs venmra cnpiml firm of San lose. The dacision u: 5:11 tcrsigma culminates monlhsofspaculafim ahom 1h: im: ofthepcofirwhichlns able ScientificMicm bem 001111551 by a.W160 rang: cf suitcrs. fmm forme: empioyweas 1o major cncrpanfimxs. The _ pmthasepic:of supczMac will be detamhed n:

I l

——

ApplcEmecIItlvuScIIlm-geßlocksofstock Many invesrm": CUPERTINO. CA (N3) nach 111e investlncm: of om-purnc imidets

dnselgnmyhmwthcomlookofflmireonqanqiesbast. axfifluyhnvemreponflizipnnchases

mdsnlesmtimsmflflminsidctsbuynoursidQtsftgmetheyhuow somerI-iinggoodishnppcnWhen insidcx: 5:11. outsiders figum bad news is coming. 1190:1111)’. a1 A9916. Irlsxders 5010.113 abig way. D01Yocam. 0110411011: via: prdant und chinf

1) Ratethnnrflclesynunadmnsmleoflto Ncwsbym _ C o n p u l n Cdcndnx: Ncw Pxoducts__Cooking Up a Natwmk„_

Hotel in Las Angeln.

Apple To Replace Bugs in System Software

„Tihisweckfl-Pcomtmucdifipplmcharging unfair busincss ptactices und vioiafiom of 1h:

Just fill ‘n thi: quasüonaire and send lt Into us. W9 "will mail a oopy of the paper in ycu and you won't hava 1o miss a single Issue.

II (lihgond, 1 % )

dBascIV Developer's Edition. Frmnework I11.o: rwo Macinmshpuudiacm. Thcconfczenoeis slatcd f0: Scptcmba 13thmugh 16 a1 1h; Cenrmy Pizza

PALDALTO.CA(NB) -—Manypeoplewbo've belicvc 111a]. Hewlett-Packard. Ihr. ‘Microsoft. is 1h: real tmget of Applds amed "Iook and m1"iawsuit aimed nfrotccting 1:11: Apple Mlcixumh User 111161150126. Wen d11-1—P mmptmus 10 beaoome Mac-like. Apple am 11155111: 10s: im captive audicmc. And tiley dm way. thanks I10 "NewWavc". upcraring mviromnent genialen-Packard‘: nzw whinh is the target cf 111e snit.

‚

c0? 001101133

MeutwhilgAshmn- misofietülgaspecialdeal t0 Lhosc wcll-lnceled enougil 1o aasnd im Scptnnber davelopefs wnfermoe. Sipi up now (registraüon 379S) und xcccivc any of Ihn followinag:

fl-P Files Counteräuit Agninst Apple

Call Wesley Kenzie, Robert Fisher, Stephan Schrammßlifi‘Enquist, or Ken Greenlaw at 688-5867.

FREE Subscriptlon to

ploy up 1:0 1W peoplc in snfrwm: developmexm salu. mdnmietizlg. Iustnamad mheadmlixe isTermce 61:11:11. avmune capitalnew isL Edwud Esber, Ashton-Taie chairmm. had beta headiug the division since i1: fcuxidixzg in Febnury. Fullwrilc Pmfcssional. anquired from Am Arbw SofnI-‘otks. is cunumly AshIon-Tflxfs flagship Macintosh

—N0 b1!

11-25

c16) 101-150 D 7) 251-5111 D 8) 501-1000 D 9) 1000+ lflwhatlsyulrnumpnnysinby total annllal II]eslrnrenues." D 1) Undc: 5100.111) D 2) 3100250000 D 4) 350011100000 D 3) 8213-50011!) D 6) S5million + D S) 51-5 million D 7) 0111er

qpenfing 0mm. Imloadbd 100.000 shares. lbaving1111113111wimjust 2.00111111:».- Spindlcr. o r5811:5 und denim via: p-esidmt f markdting. 501d all 1115 20.1110 xhues. JeanGassea. seniorviccprcsidnntforresearch andmarketirxg. soldhisholdhgs a5 weil. mdAI Eisenstadt. senicr vicc pxcsidml und 50:10:31)‘. 301d 30300 shme-s. roughly one-founh of hin BnldinssAnalysis. howevet. said 110110 wurry. Applauccnlivsixsuzllysellstockixlfltlalesptiflg. bucdonfltetimiflgofflwirstockapfionplmu. Daniels.with Yoczn setting his Apple. Stock a:

11) H01! old ar: yuu? D 1) undcrfi D2)25-34 D3) 35-44 D 6) 01101-65 D 4) 45-54 D 5) 55-64 lud o! education? What i5 l2) nur highut D 1) High schon! D 2) Sonflcocmplemd pcm- scocmdaxy D 3) Universny degroc 13) Wi m i: yuur household inoome‘! D 1) und: 83110111 D 2) 83000049999 1:1 3) 54001049399 c14) 550110059599 D 5) 360511069399 D 6) 0m 570.000

57.75126: sharefihesales leafthitnvfith nreal

| profit of 33.7 mum TECI-DFOLOGY, ING. Lan| NEW IMAGE of Magie. u kam. M11. 1111s mded | flWhatbestdesuibasymn-nffine? videadigiümfarMacmtuxhwmpmemMagic Ü2)Loca1 Dan-Icad ÜUBranch 14) Whmdldyauplckupymireopyoflhe I In: um inproducfionsince l984.Ncw1mag: P3P“? I uysitwillhanormehllwmmficsmnll ‘nnnyoulgnuenceyuurcompanrsdefiläam n e orrenfingm onpurchanng, rhaupplyg MlowinflChockall Lfiwlntwouldyollflkphnecmnreofinthc I l I Dijaooouuingmviau D2)D=Ihop l ‘PO O sflnMrFur“ — Dfflconpnerwnwlzing Ddnmnynarlnrdwue „ w ? Tokyo-basad safrwm venDnoonwtaauflwue Dfioflineecpipmm. 16) Type n! Computer 8: 0 m m :System: | mmKowa Jahn 0 1 m h1: dzvelupcd a 5111911 Düomnpisufimcry Dflofimfianilm: Home Camp!!!" = . _ _ _ _ _ _ _ _ | scmncr fox Macintosh s5. 11. am)pws. m Dfllclwottlnoqnipuxml Dlmon-Iincoornpnnhg Dlumncofusuhuve DIZJoIhu | gcaxmmhasadauumufcrspcedofloomcgawägPmhflsYmm 0113W”: W 0 “ ÜPHTÜIESNE mWhflukpyN-stducribesfllelnfllutry | iyymspusenoni3flüfilcsfastuthmofl1er mobjectislncedbydnc youwu-kin?

‚

Dnwholesnlemde

„wir

Dfiflesomccbuad

Dfifliankingfizfin.

Bad)“; „ m . “ Auch“?'

D4)0011311110001:

D 3 ) rmmflcuning

D7) immune:

DBJacmnnHng

‚W1C,‘

Poml Codc: i: scrvioctgovczmusnl Offer good til Jan Aumun1983

10 vflmComputerPaperAugust 1988

Mail To: Thz Computer Paper 3305 w_13th „ i “

1. 1989

scanmmasisoonu scannenrhemaggqzpenxmlhcsczom. The

DIJmuiIu-ad:

‘Immun,’B_C_ V6K 2V‘

| | | _|

‘scammhasareadhtgareaoflflfimmaßfliknm. hcanmkepmtographsüumflypexwd. 100111»: includirlg adlpßor. oomte-cwr. am‘! softwaze. is 78.000 yen er S600. Mac G21: More Bot!’ 1710m Asimn-Tm TORRANCE Ca- (NB) Whfle h: Minn-

uns}: market may 11a:b: bis enmigh m suppozt Lwo wcckly Macmtosh-spmific tabloids. lt’:

big mough f0: Adam-Tue n: Lakc i1 Ashton-Tatc 1ms estabiishod a nnw which will cmMacintosh Software 0101111)!

saiously.

thednneofsalgexpefledtobeifiugustlßcämfific

101d

Micro s-pokuwunm Melanie

NBWSBY'I'E.S.Inmestinglymnugh.SM “does notexpecttoreaiizemysigxfificmtgamowloss fimnfllcsalcfsheadxiafimeflnpmthzseyxice

willbebnsedmmengtboukvahmoffileßsarsof SupurMac minus cenain 118111111515. SupcrMuc trinkt: hr5: 5:11:11monilms andhmd disk drivas

im 1h:Mqcintosh.

Blyth 171m5 Callfurnl: Stall Mwes t0 NYC SAN MATEO. Ca. (N3) Blyrh Softwaxc. faanous for im Ornnis dumm: sofiware. has instimtcdamajoxmmganizafionaimed atmm-ingoosu. 1'110 151m3acting presidmnhufirud Blyfifs Califomia. stafi of fiVe und 1'185 6105811 down 11semim U5.sofrwue dcvelopncnt leamin 0rd:t0 facilitatc msearch und dsvalopmun back in 111e 0.x. Paul Wright, cnmxan of B1ym Softwuc‘: pmmt compeny. based in lnndon. England. hold NEWSBTIE "the fiscal year has bemdismpointing” andmajor changes hxvebem necessary. F011’ uns. 111e U5.pmgramnfirig (cum. 11c says. was compefing wilh Blytifs U.K. pmgraznmmrs and rhey wer: wnsidered m langer necessaxy. Secondly. Blyth intmds m 1111101105: Coxpotaxßclass Software. aNew Yorkfmn wiuch sellsahighlavslfinancial malysis rcporüxlgpackage t0 Forum: 1000 511x13. T11: sale. Which will requim a substantial but unchisclosed nimmt of ruiourcasfiromBlythisüxclpbeculmmarmn theendofluly. Atthat Iime. 1115:1111: also lomove its U.S. hexiquntcxs E01115m Mamo 10 MmhnCiass islncamd. Wrighltolad tan where NEWSBYTES m: of 1h: biggest advmnges in buying Corporate Class will h0 1o wquirl: its mmngemcm zum, a highiy suwessful gnoup of peoph: who will 131cc over 111e rain: u Blylh. Wfightaddedmnth: 5111111120 offlcewillbecomeafiflly staflod suppmtmdwesmn mgiorml 5111:9 offiee. Brukflimugh Mzth Prugram For Mac SAINITACLARACa. (NB)-——"Whmcdculators c m 1 : 0111. 1111111110151: 110cm“: vcqr easy. W3 buih

—

Mathemnficanomakeallkmflsofmlflimafics 11m1 casy.” said (h:dcvelopu of a revolufimm-y new mm1prodnct. Stephan Wolfram. flankacl by extthusiastic represmmtives ofA 1:.IBM.AutoThe oelelxadcsk, S1111Minen-grau. IndN tion was about Mathematica. apmgram cmxunfly

s: ’! availablc f0: {n0 Macinwsh. which can pufonn virmally evezy calmlarinnm afrantim ofthe dm: itwouldlakempcrfarmilbyhmid. Mlthcnlalica cm simultmeously produc-e Z-dimensionnl er 3dimensional graphs. und includes n lmguage um cmlmcusmmizedtocxcatcncwapplicafions based an textbook o: teachixig modnls. Everynne i5 tavüig about it. F01- insunce. Appl0's Lury T0310“. vie0 prcsidetu of advamed tachmlogy. s l y s of Mnflunufin. “Itwillrullyrevdmimlim the way people d0 math." Stave Jobs. Appleco-fomdn mdclmmflyprcsidem ofNaXl‘. is thefimmprmnisa mbundlefl-m t E00 00th 1l.l d: wuflcsntiorls h0 3011s. 00malflmugh Jobs rcfusod t0 discuss when

!!!l0 qmrerwillbeinuoduoed. Aumdesk cttmavafimdmwillnnlmIBM SPS/Minc.

MS-DOS Vu-ximx 4.0 i: bcing xclmscd t0 lm6ware manufacrmers fixst bot is eaxpecmd m b: 1v1il1bl0 t0 und-max for S95 m lau: Ihm 00|0-

b6!

PETER NORTON COMPUTING. Santa

Manila. C1, h1: grown {man emxing 3500.000 a 3m 011983 t0 meking S112millionü11987. lt rankt: man; Ihn l5 fasum-growing softwxre

ccnnpmies. nccording t0 SOFTLETTER. und is now Ihn 3200111305! irldzpendmt U.S. s0ftw1r0 oompany. Journalist: got upaclnet ofmmm seeds inllnemniluriththisammunoanmt. Inditwu uplmmd Lhis way. “A good sudanes- always plansforflnfnnnt mdncxtyear‘: crop. While ymfmwrifing funlmsprouls lnbrmkgxound. b0 onllwlookomformacifingnewvmnxremmwe

Vemlpm 3.0 o! Lotus 123 Real S000 Nun PASADENACflNIH-Lnmslovm wac oulin full 500cc u:Cal Tcch last wcek for a [xevierw of 3.0. making a piumutiun 0f 1h: n01: verxi cf 1-2-3, ptoducr. managur Chris Raxidall assmeld those asseanbled um:mapmductwouldbe fomtli quancr. dnlivefnd. 1x prumised. inthatth: 1110 lamst implanRandqll dismissednunors enulioj pmsmtly mquilas ova- 640ICB I0 tun ImdnDOS und thatdcvelopers in Camhidge am

havingfitsgenhxgizmfinhmnhemmnkmd umIhn ncw vctsion would not ofifar only

spiffy

new E1000; lila: multiple 101'015 lau would perform und in 14:33 mcmory man puevicrus —

versiops.

ZSOFI‘, Medhganlc (Actlvlslon) Merging GA(NB)—ZSoflchai1mmMark MARLETTA. ‘Ihepzograznwillnlsobanoanethefonndafionof. SOFTWAREHJBIJSHINGCORPORAHON Znchmann. in an excltnivo immiew with newmginazrhig appllufiorxsfrmnmnndesk. “It's Mmmmin Vaew. Cm. i5 doixxg quirc wen. thank NEWSBYTES. admitx his 51m’: mager inlo 1h:m05!incmdible n00] we've ever 5000.” gaspod you. vmhennin of5336rrfifli0mx338p0r0m1 Mcdiigcnic. ionncxlgr Acfivisimis not yet finalAutodcsEs Eric Lyons. direcmofmclmohgy. In innen:m 0 : l9 figura. 8P‘: ChicfFilmicial h0 ' addition. Sun was. Ardem Computu. 01'500’claims Ibe immense oomes Eton: mpoma izaediawyetssfillmgocingovnmppa snid. anduntil lhmhecmhzvemthmg urznally StelluCompnnnmd 100001101. whichmnkeupöflpuomtoftmfirm’: tosagrjaboultlwfixlifsdüecfimßmhedidconplus m ndapt Mammut:l0 their machlncs. m e i n e s mw. "Ulis is a significmil dqmuxre firm dm die direction of M0di1g0tii0 is mxkzbd Rausch cf Mnhmnfica. bywolfrmi m m 0 in 1in0 wilh Z300’: busincss. PC upplicusmallcclzmnmxfssys fmmoutpaslfocmon Champaimlllimis. i: thebrahiclfildofaclmowl- Jim H0ff0mm. tions ' PC Painthnlsh. Ihr: im fahnar life 1s 00.300 300m5 Stephan Wolffi-an. m:firm‘: pr0si- Lot-aufs 1.110 gnnucmmmgnonn: lhcmezgc: Ami Efloflslioostlstfllfllvlaker docmmo dmt. He was the youngest recipiun ‘ ' ' Z501‘: m Inka control ot’ f’ is C1. ilhasxi’! expect Ilmlcut. SANJOSE. )—To ssy ' fromüiltedxmoflvmg’ hisdzmncban‘ inphyxics mic‘: M PC dcvdqmmil. und m11: mcndczageofm. Heis uuzrmtlynprofessur beeneasyfonfinysoflwmstan-upmgetfln 100k 11th: Urfivusity oflllimis Mnhnnalicais cunmfly available f0: 21301010001nosh Sßforsfilfinndmahrlacfiimshllfan-SWS. NOXT 8011310113

PALOALTQCa. („NBII-‘lhinlcywcmmxlnet 1st1xe-of-llz0-mclmpiu wmhlafiqncxalodby 1

wamhcadezlbyonmofthaindmtrykmmderkinds? ‘T0020 1:: DOW in 301mm 1nd Pinsblng. two cities whm NeXTIIIc. i5establlshln alsoffics. Advertisutienxx fornlexperxmnähaveheenpostedixiflwsecifies’ localpapars. indlcadng m:10100151: 0f1Iuly 10101.00 du:f0: NcXTs first computer are mosz Ekely an tagen ‘Umadateofflicittuodmfianisalsouidmbeh parfec: Einflug f0: fall pumhasing docisions by urliversifies 1nd 00110505. Dnly mwfactoreoulddelayfileinlroducfiaonofflle NOXT machines. Mailing u:publishad 1090m. und flm is n possible dispure batman Apple 1nd NexT ova- cnpyriglm. Th: anmncysfrounbothsidcsuesfinsaidmbehaggling over dctalls regfldingEhe similnrity of 01th finn‘: 05010135. Munwlflln. Jobs 50111011005 of 1 blnw fmm an: ofhis biggest I 0 0 . Camngie Mellon Universily. mimastminblaxl‘. mmmuedthuixwill develnpversims 0f th0M10h0pn1lings3/sl01n f0: 11m Macintoshll. That's die opetating system an which theNexTwmkslafinnisnmaredmbe nnmixigmxdififspwwdm meMacimodLtlm NeXT mnchine vfill Im:5 0 m 0ofizs individmlity. T0makcmatlus w e m ; Ihr:Uxfivcmity 0011000000 thatthnprefmnd machinas f0: 0200111503 summa lhis f1llwillnotbcfxomlhcPaloAllo oounpany.

butfrmnAppharxdlBM—th0Mncinmshmdm0

PSO. 1in0. JASBJINE TECHNOLOGIES. San Francisco. has lowued mdupgrldeditx hat! disk dxivcs. Capacities nvw rang: frorm 45MB In 140MB und arapficed Erom S799 t0 51.499.

.........

„M.

v h v w v A - a

„—.-.-.- 2

spannte.-

h v a v a v h fl h fi n fi t a v l w a

wurldtolooknilsncwkindofsofiwuqbul Loms’ Agendgwhicliisnowslfippinganayhelp mmers. V1100 Softwue. 1110: 10101101110; 11:0 newsofiwarecaxegomyforrwoynaxs. wasumfirs: onflncmarhuvith 1"p0rs0m1l infarmazimunm1g0r"orPIM.ca1ledInfo-Jfl„bockinFobzumy. It‘s got five windows: oufline 1300005001". 1 E10 30110011101’. und managen". woxd procasing m; calendax. Thzy n11 work 103011101" l0 pmsimably smltlnoughmdorgmzizconc’:lifc. Info-XLSCIIS

forouflyüßoompnedtomehigberpficemgfar oompefizigGrmdvicwfimnsymnmmdAgenda {vom Lotus.

Bm 1054:1103: of i110 propam’: uniquumss 1nd prioe Ing. V010: lind a “tremendous educational 01.11101." Gazy lose. V1’ of markeüztg told NEWSBYTES. inbringingnmrs of Ihis tool “max 01:1 drmiatisally 01010150 productivily” l0 lhc public. A whire paper was publishad by V1100‘; Pluidemslzve Smdousxpluininglhenfiwcawgorymsoftwmrasellersmdeditomvflüchis nnw inilx 300000 Hut Valors efrons a: publlcity are now dwarfed by 1420:5‘ plzmwcl S6 million advcnisiixg und educafionnl campaign m pzomone its own PIM. Agmdn. 51.3%: 1000. T110 mood was Lipbcal. whcn 1.001s ammmnced dünnem of Agenda, because "Lautmalte: pr000n00 will significmtly helpin 0:10:11.013 PCuscn about lhis mw category." Info-M, mm on any MS-DOS machi-ne with a: 1015:334k IndMS-DOS 2.0 0: hrighcr. Thc package is 501d a1 Egghead sofiwam 500m5. US. CompnhlLandFla T0 G0 Public HAYWARD, C0. (NB) CompnerLmd 500km; mninilmß milliomhu filßdwilhlhl Secmifies und Exdmnge Cummission l0 0501’ 31.4 ptanmofthnonmpmy forpublic smcknle. Thc pospoclm 1.11:: lhal(h0 public ofiering ofldmillion shuzsbepdcednbezwemfils 1nd

—

519 1sh1r0—1f1irIyhighpi00acwxding Lomosl. annlysrs. whopointmrhefactthatsmhapriceis highu thmßusinnslmltfs. which is growing an1. Iaslcrralc ihm Compunerlmd.

Zachmannmhxvoabiggermleinserfing

ocgrpmy‘: dimclim. CESOFTWAREZDesMoines. IA. iscraating a {h0

thc verxiqlofimQtiickMlilpackgwfimnfior fioruseonIBMmaohümItwiIlnm

Macintosh. mdulMS-DOS. MSA.‘ Atlanta. 1ms wcalhcxed a talceove: attempt

from ardesn City. NY-based COMPUTER ASTES INC. F0:now. CAPs Anthony Wang atcvary nnnby MSA saidlfis finnwasrnbufiod 0100m. 1nd nclumwledgud th: Bord has fxomsharaholders. lvlsAstockdxoppadto 59.123150: slure in th: w1k0 of CAI‘: u n k o m m e JnmqCAI hnd 050m0 311.50 per share. Lotua’ Shlps AGENDA, New Type o! Program CAIVEBRIDGE. Mass. (N3) Lorus Developim new ment has begun shippinäigenda. i: mppmed t0 personal infonnafian manage:

—

raquired w divid: lauge. hnrd disl: drivgs imc smallc: puxfitimzs. Also new i5 Support for the axpandad memory spocificafionwhich allows 1h: oompmztno rcäsmm’: mm64-0Ka10nelime. There's also aDOS Shell. afilodirecwlymmagemmtsysmmfmlow-mdpusmflcofllptilczs lhal. allnws wer: tovisuallyorganlzethcir hard disl: files nrith pull-down menus. ‘Phi: {cum-e mxy hxve b00n 2h: 1 0 1 1 m f0: Microsoft's dclay in an 1h: mnrku. Sources izitroducizig ihn 101d NEWSBYTES-EUROPE that lhc Apple!’ " lawsirit required (h0 Bficronsofi “look and f Washington-bucdfimlmtlkcahmiseoond look u! irs visual copyright. Analyst: ssy IBM didmost oflhc wart unthcncw DOS arldllnmsaditbackm Mlcrosnfi.bot]! 0m0f respect for {h0 mftwure mmpmyä prcvious Werk on DOS. 3nd au! 0F 001100111 du: the public n01 paccivc IBM als abuxidoning its newer operaring systnm. OSR.

Ihre venerable 1-2-3.

.Pfl0mdR00ordSm|-lngand10ckin5 Irlnterspoolingandstming ‚Electruüclfiail

‚Advmwedmlasmmty ‚ALKEITHHSOÄNHWG-k '

ßmüngPrioeofßw

Usage

mmecbtwommpulau:

mlowprhndhehapabfiügafuflmti‘: vjlumnwdlnlhmfiwqlbflfliufirbflsbudnchwrfiugiuuficfiajbwwudflfihfivga

wnflcda-Ldflfuticlivßlploüsmne.‘ Pchfiglzüujwxlfli. Furmonliümmlflmull (604) 681-1373 9ms m a n wg:man

"55u“

7.17.W m m s ? ’

'hhffinpdwAldYvrhüluhuu"

Iionfctthelumch. Agzndarmsmflcx

52.001‘

highez. andrequires fidOKcfliäMaxidahnrddisk suggestnd mxil price i5 5395 1nd 1h: i: availablc immediatcly. produnl How ‘weil will Agenda du? Opinion i5 dividßd. T110 “W111 S000: 10mm!" q m m 5 m m Alsup. edilor pf P.C. Lamm pmdicfing flm: Agmda will beünplhuvexy ulkechboutprugmm lhalfalls Halm i1: faoe” beumse i1caiftmultitask. O11Ehe orher band. Esthu Dyson. 00510: of 11010130 1.0. 101d lhpmwspapez Ihn:Ageada is"fundan10cnla1ly diffuenz. It's remmchusly 01.010133."

110W

REGIS MCKENNA, hänsulf. has penned anothar pook. “Who's Afrnicl of Big Blue? How C0n'|p‘in:i0sCmChall0ng0IBM—mdWin." His Erst blockbusler was "T110 Regis Touuh: New Markqfing Slnmgies f0: Uncaruin Tims." Th:

h0 nevzr cansidered

xmtil

LANtastic Network

ulsfoliaxlerhrfltchläaponhasbeanindmelopnmt fortwpntdahnlfycmxlnuuisdwotixlggreat ‘ 56 m11care u;the pmoduct. including budge

dm-

selling tecently Symphun Salm Push Lntus Eunings buscs [er PCs. Whaxchmxgedlzisnfindwas asmdy CANIB Muss. salcs o!’ E. (MB) Strang thuilflfia ofPCuners in Synxphony, its imagnnad mfiwnt packnge. 10d hedicllastfallshourhg now have lind drivcs. Mixing: L001: Dzvelupnmil Cum. l0 S173 millivn (38 So Ray's Digital Publlcatiom Im. i5 n00- rrying centspetsbarefinemningsforflwsecondqnarm m.1s h0 Inkl NEWSBYTE. “d0 l0 this indxislry 0115110506121 Thztcomputs l0 pmfim whax Borland did wifli mmpilers." He's offecring ofSlöß million (36 cems petshare) o0 sales of mailin 1in0. organinnd by SIC 0000. 594 millianfortheseomidqnnrmofwm. "Busi- customizcd 1001508100130: Kfloppydiskfündambßc

nus was booslndby moulstmdhg quartecr f0: Syrnphorny. Hierher solid pcrfm-mnme by 1-2-3, 1nd 1 01:10:15 qulrlcx cf inlcmulional 5010s.” said Jim Mnnzi. Loms prresidmt. Goldman 51th: & C0. analysl Richard Shetlund esfimmcs thax lmussold285JJODu1fißof1-2-3in the qumer. down u bil fium [h0 mwrd fixs! quarsales I01‘. 1m: still a solid performmce. The f0: 1-2-3 indicatc Ihm Borland‘: Quamo and Microsoft's Exo0llarm‘: laking mukclsharc fmm

Just ours.

01000:. T110 1300x101. develnpodpilnuily by Lo-

——

—

Don't believe all those low cost Computer ads...

bringtheHyperCurdoonccpImmisasuamsson Applylcomgmms nofixe-wand of IBM PCs 1nd

ncwbpukwllsmmytalcsofsnmcssgleannd fmm 51.7 McKqmfs walks thraugh the lulls of App10. —'T_|10progpecmsnot05thmC0mputu-lmdsnld 0111100 m its last. fiscal ycar und Conqipq, 1110001015011:who hmrc lakcmoniBM and The boolc urill bepriced 31517.95 when posmd 5110s 01371 billionfot the first eightmnnlhs i1i: wpn. 10101500 this f1ll. 0Ethis year. Prufineachod 35.6 millim last year. systemboastsscveralifllyflvanefltsovflitspmfla- ‘I11:public offering is being mnmged by Salm-nun Ycllow Pages an Your Hayd Dlsl: 0055011. First, itiircludesmpportforhflddisk Brothnx.Menü]Lynch Capilal Makel: und San GA (N3) John kam 1115 110011oompiling 1nd filesgrcatsrmmflmegabytes, someusaisnot Francisco-band Volpg 6': COViIlgIOIL Solling datnbases f0: almost 10 years mw. but

New DOS 4.0 Final] Releaed REDMONILWL )—Micx0s0flh0s mleased anupdarcoflhewmld‘: mosrpopular operating sysmm, MS-DOS Vusimifl.Th0n0w opcrating

Hclwork Adapter Card

—

i: is bißad toward man: mrablishnd fmns docsnft have pizn 1310003.” 11c says. CD-ROM vasirms ofhis daubßas. h0 says. vaill b0 available ormelheplzycrsoomcdown loS500mdmasu1ing 0051s go lower Ihm lheif presst-n: 32.000 per disk. Ü Rapp 0150 has 50m0 intcresfing i001: 011 how t0 publicity. He's scnding compumt WriIHS gathag of his danbasc 0Ecompum 11105020103. un copi It has 1.276 listings. all in an ASCII F110

Hedac _es? Eyestraln?

Ham'umnu-k1bl0‚nm-dtugm0|hodf0r:00(hansad hndmhcs 1nd mal: in; by TV. cmlpuwrmouilor 0r 111015. Enjoy drunali: relief in 11:00: 60 000000: by ming OPTICOIJSN lnmntTmdon R0li0v0r.

T10: innovative. high-twh design umhin: lodsy’: unc-qf-Ihc-m tmhaology with andern munson toclnfiquu. 0111100115"m m q e a 1mydiJo0|nf0|uwill: unüdting hennfin: mmhu 11010101101. ' Qninkly Relieves eyumnin und mental ffligue. ' Hclps lllcvillc Imsicu und stress. ' H130: tippt:00d: plin. noch slilincau. 1101110: whnl: body. T0005 upfacial 01050105.

‘

‘ "

Try

m: miqul puducl: a1:

Wille Hurt Pruducls Im.

P.O. Bei: 67544 Vanoouvc: 3C VSW 319 (604) 327-6602 01’

Woolco Drugs I0 Day Man): Sack 6011705100

floppifs.

7 . ,

l 4

The Computer Papa August 1988 -11

1 l1

zl IBM Reorganlmes, Consolldntas ARMONK. N.Y. (N3) —Inxcm.aIiovnalBusiness Machincs Coup. has annotmcai a S600 million Ashns Crank Up Hut an PC Pnaducdon slim-down pogrun tlut will füllte! consolidate industriulizedecmm'I‘QKYO(I#lB)—'I‘hcnewly and trim the oomputer giant‘: pnymll opcraüms miesofAsiaarebe-oomiragmeworlcrs largcstbm ef PC production. ncl. unly mmuiacmfixig 0111er by 3.000 no4.000 unployees. Tr u g u: txadition, will b: laid ofl‘ a1Bis Blue. ‘nur the comproducts. but building new firms und nobody will offe: early retixemem amfinmcial inpany _ esflblislüng their awn brand namcs. In resign. IBM says Ihr:mmlcmring will n i m m PCpxuduotionisestünamedmbez cmfivu offagainst Iniflionunitsper year. anumberwhid:farexeeeds aus: ahmnsaoommm t0 bechmged Wall Slmel. analysts eamings. second-qumer Andfiiwmfieaplmswbe thgompmoflapm. I m v c u away wnstoresomezip thefixstiizthc world with mlBM PSHcompsfible FIÜSBGÜTHBIBM zu thecumpany’s eatznings. which havebemslugClosely an Aeer‘: heels m: two oflacr Taiwm m finns. Auto Compuner and gishforthepastmuplc ofyearx. Explainingrhe Tcxry Lautenbach, Wllo bflilflle Copan. which alsohave PS/Zoomparibles omning morgmizuian. formte: ofIBh-l’: opernimu inlamxxespmsible ofiäfiieirassemblylinessofarflmbigsellixigpoim lry, said, “Our US. volmxcs cf business hure toTaiwmqnadcPCs i3lheirlowpticz. andrhue bumsonmwhal lass thanwe though wc Infact. fixfiflfifi. acaxethebasics an. still plant-fingfar powth." thqlggressivumsnffielfisimlwmpfllmhdimuy of 1h: murgunizafion: "'All manufncurring

whlch am bepm im!) mnstleading danbnsemid

C O M P U T E R

P F I Ü D U C T S

TONER CARTRIDGE RELOADS "w drilling holes ‘ n 0altemtions

icanfidges thoroughly

HPII 579°’

inspected, cleaned‘ und refilled

isbfghmingwvmflybothhpmenandUSfimu opuationsuBocaRammFlhw-illbcplmsedout.

NEW CARTRIDGES SERIES I —------—-S159 SEHIES Il-———--—-- 5169

—

OMExtendedEditionArfivQPSüSalesSIow 05H. Extended RYE BROÜK. N.Y. (N9)

Edition Lüwillbeavailablzluly läauxmzling t0 International Business Machhies Corp. 111e new für Ihr. PS/‘Z lin: cf personal opgating sysmm cosnpulcxs i5 05.’! Standard Edition Will: Ihr. adäition ofadamahasemsnagerazidacommmficefioJns packagc tha! includcs tcrminnl emulation. Expndedßditian l.0isS'795‚ mdthmpgradc f0: Stmdard Edition usexs is S645. IBM says i: will aus}: shlpphg Exnemded Edition 1.1. which realhe Presentafion Manager phical intum Encnded fafie, in Noveznber. Upgrade:

ll-l’ Laser‘ (Malt-J'ai

Super Carlridge 0

ZSsIa-ndardfivnlmrflrfiguinom

' total 01'455 ‚Fonts 0

compatiblc will‘: all HP ä Inland loser producfl

EaiünnlßloLlwfllbeüsthisreallylßM

‘ca-sylo H 3 8

|oruoawmsopnn—-—S799 arm-sagt m --s399

’

875-0977 QUANTITY DISOOUNTS AVAUBLE

Make sure you're Covered With

BED-SPREADTJVI" The Perfect BedfordT-l" Companion

‘m

Need more than a number {mm last year's total? WlthBED-SPREAD you get all the facts. und you get them in a lormat that helps you to understand 01cm.

There is n0

more effeclive way t0 communicale the intricrale relationships and hidden trends in a mass of numbers ' lhan by swing them in _„ form. spreadsheel und graphic

Unfortunately. producing this kind of

product used l0 be laborious and time consuming. Until Now. EASE 0F USE...

‘vrith. Using Lotus" command and macro stmcwre you can print and display a variety of effeclive charls and line graphs. AND MORE ment in uthcr ways as weil. lts datnbase uacks client files and ‘rts

modification of your Original income Statements and balance sheets. lt can transfer your daily journals into spreadsheet for easy audit trail. And by

covering yourself with BED-SPREAD you can export gmphs and sales figures to Pagemakei“ and VenluraWn Create a first dass business report

BED-SPREAD is easy to op-emte. Its main menu utilizes an inmitive pull down menu System. Its spreadsheet is in a format you're already familiar DealerlqquI m ;Welcolne

‚au. *2.-»:::='--

r tolMsAi-ncxicaCoxuputerMarkets D3,‘ ision.onlyxlmtop- of-tloe-lim IBMPSflModel 8031W xales gmw during lhc fixstquanez M1938. Tlie rest ofthe PS)‘: line ofpersonal Computers frqm lnlunarinnsl Business Machines Ccrp. ssw sah-‚sdeclinesixxdollarsarfltmits. Acoerdingtn {h6 Model sogained 41 percem in dollan ms. und 47 pcrccnt in unils Sold over Ihe OctoberDUN 8: BRADSTREET CREDYI‘ SERVICES quarru. Thc IMS rclail audit of Deoember 1987sales Munay Hill. NL. has mwciled. a_Service that dann-s down 24 Deuten: in fcund total PSIZ will allow computer users m rece-nre fivo-year "Bzpercmtinlmirs soldfor th: quancnflw financial sssessmenls of US. oompanies. Called ln aidModzlfi wasdownfßp-exceminmfits thesexvice Duns ForeSiflt. oonxpmtsncanpllf’ axüdollmJheMocleßfldowi-BS percmtinbofil. finsncisl snd bnlmee shect dal2. will: infomxarion IlRMMhISOdoWn 15 pcmmtindollnrs andld petoexuiznmits 501d. asiclflzeMedelfiodow-nfl iuLhcD8cBdatnbßcof9n1illionpuhlicn|d pQcmtindann-s, lßpucenlixunfiuLNow wecan wwwwwwmwwmmmmu» w» vvvv.-avwwuw vvvvu. smpwunduhg wilylBM decidedtotakeflsde-ixis wwwwvwwr P 5125. _ m; Nut, IBM, Adobe, fixieTedmology Nqvmlbu": Cosndux Fall in the US. Wach {bis PALO ALTO. Ca. (N3) Humors are rsmpm: spnce... that EM. Sheve Jobs‘ NeXT‚ 3nd Adobe Syslums IBM AImmLFIÄYÄ. saw pmfits full l8 pemsntin nenlkingnukcyrcgmvdhxgmeumhmgeofuchdmseeondqumeronasixpu-cmzbmwcixi nologyv. IniustrysommssylBMwmhmlirmme rdirmumTheprofizdeclinc was afmcfionofme Display PostS-cxiptfimhädomforlmiilimown tljnhasxigxmdwith SGOOmHJiOnWIiMUEIBM mokaspntofi ls computets. bannen‘ rauen! itsu-Ixmn-ing. Wilhßlll Ihr, wximoff. anm- NeXTznlioanc clmnmmoffülelff’: UnlxoperProfilxfelllo mingsysxan. N&ifl1etIBM.Adob:‚nmNclfTare mgswouldhavarismm? «an.

Wordprooesslng 0 Database o Spreadsheet o Graphics o Macros COMMUNICAUON

—

S964trtill5anlfSlß3pershuvflfxmn5Ll8bll1im1 tafltingmtnindimyrobemussayweshouldlook (31.95 prr share) fot rhe senond quarta- nf1987. im anamtounounen: on Ihis possihle menge a Revenue rosem 513.6 lillimfrum S128 billim. trois in September er (kmher. IBM Upgrade: RISC Workstation IBMCmsJobRolls BOCA RUTAlHZFLflWm-Inim drin m c u l RYE BROOK. N.Y. (NB) —IBM lus toller} out (xediwedinsuncfion edstsanditspaymllnmMismuvixlgthcglarmr tlEmnewrrIoddsofimRISC310megahyt: disk out cf i1: B008 Raum. FL facility. the ofigfiul sct) wcmputzxs. md n new

luimeofxheIBMPC. MmufmmmgofmePS/Z dfivefflulmgerlffmnclfimscanhanxfleflnmof lincisbcingshiftedfmmliocamlfllvfsplmuh Ihencwdfives. givingusasaecessmfilßomegaPut. NC, undEmB-ocaplant is" bymsofimanaldltlstoraggfilsmmhflhu ResearchTrlmgle ' clomcLThcmnvewillredneelßMkßoca mmomxoed several pmgrams. including ADURT stafi" fiom 7,100 to 5.500. To mni-nuin IBM’: VS COBOL. for oommercisl cusmuum in Unix l30isad5hop hfimry ofm layofis. alldisplaoedßocaworlneus flwinmmalmnznnwRTmodel IrefloormdBSS 135 whilethemodels Uhu-nun mit. b: offcred elsewlme. ßsigmnenß will bzw: 16 Ihre: All machims. megabym amftexpecmdmmketllßnLTofinfliermskeilm mndmg mclal oxide offfu they am‘: rcfusc. IBM will give rhose who of complenmuary a. weclaamt. legwc 2 years‘ salary plus 525.000. fl m g Will! (C0508) memory. floafing purint medicalarlddflmbmzfilsfortwoyeflfnhclpin Irldl lmneglbyrlesofhnddxiveffioesmefläml fimlinganewbharxlupwflöflührenfifing f0! 111c Mendel 130. 530.595 for Ihn: 135. und expenses. 11m‘: m1 all. RO1M'sPBXmmu— 332.165 far die B35. fucnm} isbeingmovedfiomflledivisiorfsown DEC Pocnderlng MIPS RlSC Mlcroproeessol‘ plant: 1o mIBM plmtii: Smlose.ROLM opera- MAYNARD. Miss. (NB) Digital Eaquipnnmt timshAusfimHarealsobeingmn-Lbhedurim Corp. 1ms ackxrowledged Ihn i: is txlking with IßM operatims nur: Mmufactuxing inTucson. hflPscompuzei-Sysmnshc. aboutusing MlPS’s Aflwillalsoheplmedoutnndmovedmsmlose. RISCchipiILaDigitnJworkstatiouLTlierlmiux-thn NY. ‘Ph: fimfs Digital was talkingm MIPS lus bccnpcroollting Ovation;NC und P iIs Tprenmworkswill getoutoimazmfacnuingmid für weeks. Diphl h1: customuily deve into Software developnnmr. und repnir will b: ptocaessms internally andmmrhg m oould

—

bei-cm 1h: prospecls of thItclosely-lwld firm. A alhcadqunners. Analystscorßiduslltlnesemuvcs InoveIoMIPS byDigitalwouldsleu beuetback neloome und ovetdue. IBM 11a: sluewdly cm mSmMiaoeystmwandMotomlnImmhichm plnnrsixihigh-ooslnrensflikeBoc-I. uldculsmff- uyixigmwoocazstnmm mfl-LeirmdiuceslirxstrminginsitcspopularwilhlBM employflfis. where dm so: poeessors. Walze]: for more fireweuts in Bocangnixi qullifies. Wen-km who decide to smy Ehe worlcsufim was. wilhtheoompmiywillmostlybemovedinmsales MOSAIC sorrwms. Cambridge. u m , I n :

aenualizedinlimoklmrfflfisuflwillalsobecut

arten-an“

(604) 731-4033

psitians.

IZ-ThcCOmpmeIPapaAugust 1988

lndall P5i). mannfacnning willxhiflto Researeh of the PS/l Txianglc Park. N.C.. wheze mach * Mmufacnuing a1 mmufacmring talass plane. the Thesen. Art, plml; will muve 1o San lose. Calii. Charlotxe. N.C.. und Poughkespsie, N.Y. * T116 Thesen plant mnkes smnge products. HOLM’:teleeommmficafions plant in SmtaClna will close. with productian shifting m Sm lose. 'l'hcROLMoperIfionsiIzAustiILTcxns.Willbe consolidaned with lBlWs msin siu: in Austin. * Clurlcucand Austin willtakeover someassembly work dann ‘n1 Turm-m. Memory cards und powa’ sysuzns will still b: mßde in Tnrtmm, snd Ihn pmgrnrn developrnelu responsihililiß cf Ihn Tmmuolabcxatcryvrilliznczease. ‘hielirooklyn faciliry will serve es a diagnostic unter. Iaking cwa wart donc a1 locaticms across the country. will move In Assembly operazions " in Brooklyn Poughkeepsie. The CorporaLc. US. Marketing S:Services Group. and rheämericas Groupheadquarms staffs in Westminster Coumy. N.Y.. and elscwhcxc will also b: reduoed.

bcgmslfippingTwm-Uxtvezsionofixsfifm sgreadshaetüsigtudfrtlhlhixnpnfiigsysIunfwemqnecttnczpfinengendnlofmarkd sharcvay quicflyfslfidMosaicpresidmz Richmflflexjimhamwxreleue.

IIIAIGnrhnCIEIfYTEIisIIIJihWIIBEIImIIiIgB

desimcdnoaflowflaenseormoreammmemn-

pumtsinSofiatlifeaIIdbusinnmCmmflyflIn:

mexmmmadtobzlBMATxFCsmflcunfible

sysuumbnnnoMacs. SoviehbuGetPCMagadIe MOSCOWJJSSR (NB) -Infarmedsmnnßmfl umthm‘PCWcrid"sfmwhl‚oRtmin‚Sthc first U. S. oomputa’ publicatiml. msy also b: aocompmied hy a und: mixxitm. Our insidc

—

AdoheJumpsonX-Conmmmßandwagon AMSTERDAM, (NB)

AdobeSystmnshasjoinedIhaXConstnIhmLma caunrfimn w: foundcd by (h:Mainhausen: Insfimtc ofTcdmoloumflT). midpwmotes. us Ihcxwinüwxmfinflofsofimllas wart. Olhflmanbus oflhe omnmfium includc Apollo. Agile. ATELT. Bull. DEC.IBM, HzwlenPackard. SumTekmaIix Itdxuox. ‘Ihcxwmdowsgrswmisnsundnrdfudisplnying multiph applicalions siannlxmunsly cm a complflsflbmflnßidfllllfllfifllüoflflmfihflniäm

estnblishastasdudforsofiwuuvmdmsmwark

aIDund. rauher Ihm hlving In redasip the uscr inzaface fw auch oompmxkxgmmixxg sysmm emrironmmx.

lcrryBymgMDofädobcSy-smmliwmreck-

ommatikdohdsmanbanhipwfllmpdividmfis

forPagnmAkn-Iigns.

"Wchplcacdmbeootmednmngstmeleaders infinoompnxamdaisuywlmsemflnbushipüithe cansxrtixnn will Support lh: ounfimmd umzuwamemanddavelopmmtoffluxwmmwsrmdufl. Adobe i: n peu uivocnl: ofcstablblfing standzrdsinfliecounputhgirmmyfhcssifl. Fujitsnmlolnxfopen Fujixsu will becomn die firs: ‚k3nnen: maker m

joinxßpemxßpmwucstibfishodbylßnmjor

firmshflnuSJndEurqnimhfiingAW. DBQUnixymNClLBnllofEInngfiSimuu AG. ‘flxcgxonpisaimixrgaosnndaxcfizevlfllx. which wIscIumdbyATEl‘. Pnjiixu will innodtnehniidtaracmaspruoessinginm UNIX.

mtdoesAImxrflI-Immuhmwbmnäblm mflcsshcrcudilhfltfirst.

Nur W h d m n Unveiled REDMOND‚WI.(NB}—M.ic2nmnhasunvcilad Iwo nnw versions cf i1: populaI-Wiiadawxopuzt-

in; cnvixumnuwbichfealxue Ihnnbflity wmake useofmon mmmy.

undp-ovidchnprovndpufmmmoc. ‘Ihenewst incamatisom dubbed Windowsßsß vnsion 2.1

andWiIüws386vusbn11,hvc“u:a-buod‚" einziges. says Mitzmsofi Vine Prcsidmtofsystem SofiwueSIzveBdhrIer. refuriIIgIoApple's“bnkaIdfccl'lxwsIfit|gfinst lhcWindov/sfiodtlcts. ‘fhenewmfivusimis

dmignednmzkemeofttzexnnmmnryinfifi-

stylcPCaprovidingupmmcxnmKofaddressahle manmy urban man: Llun l mcgnbyt: o! cxlmdndmmmyisavailabln. lnefläflnflnfllx limitfmbOsnowbecomcsßoltThcsamgocs f0: thcß86 vusion. Bolhprodnczs teshipping now. Whduwsfiflöhasamggamdretfilpiccof S99 while ß35nms5l95. Awmtbws nehmt:

dwelopmkinwhinhcmrununduflsßhum' ismced’ utionMmlgcrwilhnlmm"

MARKHAMOnLmB)—SunNfiuosystcmsof

aISSDO. New GronpFornedIoPIomouWlIflws REDMOND. Wa. (N13) —-— Mictnsofi Cmpon-

Canadalnmhasiaxmlndavlalus-addedresnllnr

malten. and 13 Fomne 100 eompanies.

SUNLaunchesNaflouflGaVARPrngI-am

(vAkjp-ogxmmlumdodmpvcsmnmepreseine in venical marhus und ganual-pnnpose oampning. THOMIIpInyiSmcIIIifiIIgCmHdSHI VARs Wilh oxpaimos in Unix 3nd nechmical

backyolnfis. SmClnldaszysflncnzovcisailncd imommnmmringilsworkxtfliun mucinl nmlivaafioxm “nur. pzvinmty served by San.“ huhmgiflslhcncaxstepinheafinguptha pcnumlcumxgnnm.

BBMGctthgToighalflSC?

NEWYORKmB)—IBMhn:p|:mdndoom110151: about Iheir uscofrednoed insuuction se:

(Riscflatllnobgynvhichmhflnysilmmsflnuugh

aseriexofpucmxßutofidflsfiunconrparfim said hava not bum tlsing R554: man: conunulbyIBMmIdncun mfigtueout whaIBigBhnistaIkingamAnmM staunen: saidfiwebclicvcllnluaymmwhobdevelopirag

aninfonnarkm-hmdlingsyuxnwonldprobably neadmucmßMpulcal" IBMsaysitisnoI trying In kfll im oompaimax. The aomparxy i: wiflingmlicuncinpammnoflaummpnfim. So fn. 81m Mitzosysmmis. Motorola. und AdI h n IBM has vanced Micm Devices den)’ app-onchedthcmlodisclmkisctwhlnbgy. v „v.w.wJu.a.un--n a m r a v v w w v v a „w v-vMAA- lau-nu-rav4w.-

Too Mnnyßureancrflgiholüw Conplltfls

WAsrmwIm-Ioun-Aleadingsovierscim-

riauysmamorscimmmmUssRh-‘mfl-

tifyilzg." und plagued by hmeaucrncy and Dulmodedrnduulogywfifinghlmsesixiscimm und Todmology. published by the US National

Anadanyofüiflxknaldsagfievwrotnflxal

“Sovinrueuchwukmnximgheersresemuble soldiets anempüng In fight a moda-n w i r wixh crossbowr.“ Whil: rasseln: und andern computersanddwkindsofmls availahlcinflae Wust. Ihcy gelfibmuucrlti: dinosnn-s" ad ab-

szndqinlasfafinwdhmruias'insmd.sagdaev isrhßdüactorofitusovinspnelacuchhsfinnemdakcyadvimhsoffileflierhflfihafl Garland)!!!

Soviet Style Software Rnsearch

NEW DEIHI. INDIA CNB) —NEWSBYTESEUROPE h1: lzuncd m intucsfing perspective

onsovictsoftwmeresearch. Wewammldbya inlndinthatnlost cxmstflmuwhochals mftwucIcsmchinfiIcSovict Union isdone by

pogrmmnms subocmh-aclnd by Indin‘: oomputz: indmyjiis thmughlndinflnaxmostrßM systcms findmeirwayimn the Soviel Unioncvun lhough IBM pulhadunlofthzstnhxomirmltyms ago.

hadiangxogrammasaxcsaidioworhbymdlarge».

gw m Clpartered

Headache for Canada's Banks

Speils Relief for Canadian Business

ThcikocounfingMasterPayraflProgmmmayspellfllemdoffllechamred market für small und medium dominafim of the payoll pmcessing

Dank;

man};

sizodwbusinesscs. Now businem owners can complele their own payrall in housa. 8nd savc a bundlc on bank chargcs and inxerest. ‘Ibinnake maflers heuer (or woran: for the banks). lcss work is involvcd in Mastcr t0 complete a payroll, than in filling oul forms for .

m“ 111i; company's money can earn interest for the company not the bank. Agaiji, providing big savings for the small to mcdium sized busincss parflqlflafly if a large overdmfl i5involved. Acpounting M8816!’ Inc.. of Suite 163-2619 Alma St, Vancouver has introduced the definitive payroll program for the IBM and compaflble comgiuters. This easy t0 use pmgram docs it all for you. T4's. employee sepaxptim reports. journals. chequw. pay advices, and detailed job costing an: just aome of the reports i: handles. It even expons direcfly to ACCPACN gene ledger, but saves the complcx set up time often associated with ACCIEACs own payxoll pmgram. Um] now payroll Software for personal oompulexs has been either I00 simple m hamile man: thanthe most suaight forward situations, or 100 big and expefisive t0 sei up. Accounting Master pmmises I0 b: the best solution possillale. it is casy t0 leam and mexpcnsive to buy and maintain. ‘Ph: manual documentation does an cxccllenl job of bringing the uscr quicflyuptospeedoneveryflfingneeded torunapayroll. Youprobably will nevelfneedinbutitisnioetoknow thatfreesupportis alwaysjustaphonecall away,

zion. 15ofinmfiwmwbüahaxsevenhmdwue

havc

erflisted theirmppartforlnzw

votcdlopromntixxzlhedevelopnanofwnflows und Presmufinn Mangel’ pmducts. Thc WindowslPresenmion Manager Mandarine; which ' will marlmfixxg 1nd pablic relfliuns

activitiesforthclwoprudlnsismxthidiraa lzwsuil I0 Ihr. Apple “look und fcd” ' t0 Ihn Miczwofi Wmdcws. agximt dann WPMAE DireamAdmnRnmku. xllabouincgxfivityfhzloldflEwsßYlfisfand we pgobahly wnuld hure arism mywxy wiflnul. Ihn snit." Knacker. apcaking für Ihn muubus.

smflwhwwitisfixxaxoonaemfirxdmnm buyets arcmtomifixsatL "Ilnccmpwalimvsofifimefimnmexcitadabwz

WmdawsmdPresmnIionMmzgczfI-Icsxysfln u:- Ihe ide: of a gmphic argminlhn is dcvoted ' userimufam gclm-aau-basedimzxfmcs. und Ihncvm Macinmsh am! Unix maohincs am among mernbus‘ min-am. Anunal duc: n:

There’s a New Kid i the Block... M -'

Swforusmzandslüoofotsofiwaredevelopux.

ACT:

downtown Vancouver.

EasyWaynPortMscProginstoWmdws

BURBANKüGTBk-ÄPPÜEIIWYUSWW pormdlygivingh1nxycyebnlr_ ueauqemn

“QuickSet has bccn a dedicated desktop publishjxlg SGIViOC burcau

Ihnhtestptoductvarhichmulaasmhflxmmxh

screenphyßyslcnxfMCPisl prodnm which can pocrl: a Macinnsh mfivnr:

prOdIInmmMS-DOSmJCIIiIEWiIhVQynfinIX

diEauwashlookuxifedfaaoouflixtgmMACINTOSHT0DAY.MCP.w1iucninI.‚ightspeexiC.is said In h: capablz ofcxnwaning any 'Minimum applicanon’ In m MS-DOS |pphcaha|' wifitin weclmnwproductisanouriginalworlnsaycampany offinus. und did not hurra-w whanncvcr

frmnApplarfsownwdc. BuL Scxeuuplny Systems’ 0 m m : m m 1wniiing

forflmwlrlngetnutg/‚hxwcvtx. ‘Theg/‘vesem Applcunotneysnmpyfmünhqxpmvfl. “W:

wmtmbmbutifwehnvehgalfighßlnprodime

aoompanhfitypnchgelikadigmwuldlikzlo uicrt man." explnins Stare Gremficld. SaumphfsflnfidmLNowardfrumApplcon theprodnwtyct. Companyatmtneysansaidmbc “studying the vmole mamzr.” Unril u: xmdy i:

oamplmghowzvendomtcxpwltoseeMCPm ülcmmket.

Donn Tarris has moved his Professional Iinotype Imaging Centre to '

AdamllonokenWPMAJn/Zrl-

mldisgplcifwettclruflnguwhwswedrm‘:

longer than an};other company in VancnuverI N ow that we"re located downtown you can convenientl}? take advautage of nur imaging Services on orders a5 small as onc page, especially if you use our 24 _ houx mudcm Service. Other Services include specialjzcd ' sales and training in the use uf f?» haxdwarc and Software that we believe productivity. Call me befort: you makc —your .__.

3 cam irnpmve

nein hardwarc or software purchase.”

Buthe’s not newtothe busin! „.011

Pälfgtiiiiiliiel’ 3.0, irccl-luud, Hiustrzlttar "88 und 1111826 Studio!

Ouicksel Graphlcs 44 Blond Alley Square, Vancouver, B.C. V68 1C? (504) 585-277?

indhnly-litsoflwaralabsmmgva-ylirflemonzy.

In areIatedxmq-‚NEWSBYTES-HTROPEhaard

Tfifimflpfllfi Papa: August 1988 013

XEROX m: 3.1.7.4 "n71;

wer:

Okidata Laser Printer Supplies Drum Kits ------"5299130 Toner Cartridgesn 539.99

Cookig Up A Network An nvervlew o! Networkhig Option: Whcnl was asked 1o write amafiicle thItwould explainhow mselectam-‚xwmhllmcw ilwouldbe marduous tasklwmtedittoaound simpk, bul. how does cm simply explnin Lochrmlogy an Ihe leading adgc ol wnfusinn? Luckily itwas Friday. mldthewnther was fmc, soldecidedmcomcmplatcthesolufioninmorre omnfonablc surroundhxgs. Bsidns. I 1nd Innthcr pwoblem an my mind. A dlnm peopl: wer: expecznd m3aturday afiemoonforronnfitxzliflfiOM (Bring Your Own Maar.) Barbeqtx: A: 11mm: i: oocurrud u:m: dm I hadn‘: really aonxidzred how founesen people (irlcluding my

Special Installation Price

20 MB S449 30 MB S499 40 MB S649 «SV/z

‚ävc.

l—"’rclll(‘()lfl‘(?l' BC

136-59951

wIs

asystcmlhatwould l e t a l ] themersuse th:

Sowhndocs lhishavetodowithngxworking

systeam? Aocarding m Wcbstcfls. sysranxs n: definite mcllmds ofprocedme. M01: Ihmhxrdwar: und cables, mtwoxk: m: prooeduras for

Plus Cumputing Slafion A SUITE-y, B.Cn V35 4195 574-38 l 3

1in1: too ämple for many usu-s. Thcy impose a: Snmker-Nen so exisur: {hat d I t I i: bcing plvcessed by an: permit only. Multinser LAN: A multiuscr LANmalte: itpoasibl: f0: multiple

was toupdmrlnsmefilcmxdprooessme am: dnnwililoutdcstrcyinghlfmyoneislvflpüigyou

‘

—

lau-Slot UMS. and Multiusu LncIl A r t : Networlcs (LANs), in m61: of increasing sophisficaIion und valwe. EanhlypeofLAN uses adiffarmtmuhodof warking lngeüler. Whlch i5 either correct für 3'011! pmposa. er oanlpletely inxppiwopriate. Yorur first smp mwzd: chooshg a metwod: should b: u;

f—-—

I"l’I!l.|(' l ) ( l.\l \ l \ S. HlläRl-_\‘L\l(l» HllI*'l'\\.\Rl"‚

Hundmds of innxpensivc Mac Software files m choosc Erom.

Sneaku-Nct is rhe least sophislicamd cf all four. Ifyou already havemnm Ilunoncoomputzr. you alrendy hzvc Sneaku-Net. You simply plane infommtim U11 a diskenr. nmdown thclmll. loud i: in mnthnmachinc. end voila shamdinfonnz-

relared mpics:

fion.

-Graphlcs and ClipArt

Software

file-adommenndanbasnspradshcmemfilh: fil: cm b: distribulcd n0anyon: alse. md viewed. nmdifmd.orocmsumed. notunlik: thcpotmo salnd

Programs - Utility Producfivity Software

Laser 8c Bitmap Fonts Milch, Mach, Mute... Fink up IFREEwpy of th:

Library Index Disk andexplcrc Ihi: trcasurecreszoffreaaxid almostfme Macsoftwm. Now Ivailablc alt

STRIDER

Compmercmtres nun-im:

Coquitlam

SWSLUIIgheaAHwy.

l4 ‘Ph: Computer Papi: August 1988

Sneaker-Net With Sncaker-Net. 0m personusuIlly czcaxes a

Hypgrware Stacks

DGIIJJSIm-cy

Files have to b: smred in I sixiglc location. Multiusm- LAN: m: lila: buffet sei-via: whcrc anyon: cm hclp themselves wimout lcavixig their scal.

wcnzhs. i5 reallyamanerofchoosing m:appopria t : sctofpuocedmns. 111m’: Ireonly ufew sysmns aampating h1uchcncgcry.souns: you hIv:Lhc rigln methndin mind, filme will only bc ufew optiom t0 choos: from. Contuuplatiaig m}; haben}: had hclped m: explain rletworks. butithaddone nothing mp1:par: m: Im’ Sann-dajfls parry. l couldn't cnvisiorx myymdimder six feezuiucvppcrwire. mdhesidcs. how du you jam a hambmger through a cable myway? Poopl: wer: just going t0 hsv: In help mcmselves.

„

--Recreational

für erwilcitchen. Mulrluscr LANs m: wliere sirnplyslrunlingfilc: simplywen:

becnm: oonsumed (m3 apologies. again) in r : qucsls. andmay never geta chancetoeal. Youcan end up dedicarixig I workslalion strictly m r:qucsls. which is what a file server is intmdcd focr. Mulliuser pear-m-pm- System: ofih’ simpllcity, fil: shutilixig. printer sharixig and multimer capabillty, as lang esyour mulfimur requiremuns amminimaL Cihowing bßTWßen m: vmious types of net-

clctanfinetlnecaragoryappxop-iatefmyow purAccessing I E11: an an: oonxpum Front umlhc: i: I fmqumt undImmal (wenn so ommnmicafion pose.

Scrccn samples of all fom fnmilics. Library Indsx. ondishprovides aeoncis: deu-lptlon: o! each flle sei and clecuoni: scarch capabilirgf. Files groupedpn disks dcaling vrith

bdng ablelobarbuamyourslzak fiom your favoriledeckchainlfthebaxbwmhflppenstobebazy, dmswitch willmkeyomdrda. Imlsavu you n

wnrlchigmgcflwncmbodledinflmmcessu-yclw- cookortwoguurxacreocllnboxafizrgoumesm: trmics. Thse goal of a neutral-hing pmject. shoizld LAN. Multiusn IANS betodevelopasystemuroxmdanüimdedpun- disnyouneedunulliusct m: mnsiderably mor: sophixticaled. und slighfly posc. . mor: expansive. Four Bush: Type: 0! LANs Ilcembe said tlialzam-slot LAN: m: dasigned 11m: an: essentiell}: fourmtwoxk calcgories noshuulefiles bctwocn PCs, andtoacoamplixhlh: Sneaku-Net, IH-imz:(ordevioe) Skating syswms, liskfaslerthmyoucannmixxmidoutfromm:

Box 1049.

nulimNo opsramr inurvmlionis neesded. and m: swimh sann: umrüsten! m nach user. It's lila:

bmbecue. wirhom inlufering wilh cach einer. in many of m:same dran m acoonrplish I11: purposeofeating. drink- cjar: must b1: taken t0 ing andjust all-around good rirnes.

cnedThcdiffetenoeismattheswilchüauto-

a: all. Ihus relying torally an fil: sei's-c: suvixms. Ülittkofafilesuver uIv/ailuwotwaitress. Fil: scncr Systems sizzla (pardnn lhc pun) whcn aocess to sharu-l irlfomafion is a seüotm rqulrunml." md cspemnlly’ if du:infommuon" is ounslzmfly chmgmg. so most administrative and dnmhIs: systemsshoflldreallybeon a fi l : smvcr. File smvm cm handle fnuneen man's. und I cafly fomnm trxys a: oncc. That's Sfifiiflel couldifnpicnxe myselfdoiaig um, so I lcncw that I wouldn't mak: a vary good. savcr. A: Ih: 1 m m :

suggcsls. under peat-m-pezor sysin line. plant. mms all Butdoyoujmtwmtoshmapufinrznardoyou cx: am ocnlputwifcmdnweregoiaigmcookcfiflcrcxumcalson ctenled to wam I: wen? Ifyou m:u m : barbecuc. 811d ca! a1 approxhnately (h: mm to 31m: infommarlon All m a n aqual. I11: be I nun-Slot LAN infomminn, might 51mm u m : Lima. hIve acccss l0 all lrenlizwdd-msom: minus procedural plammg ‘ E W S . and all 2680-510! LAN: m: so nImed bccausc n0 spa- puizners. wotlldbc in male: ifthe firsl B.Y.().M. was geizig an all sysfilcs, thIL would bc hrdwm: i: needul cial Hardware t0 b: I success. (B.Y.Ü.M. was Stfll Improvm wms. at all rimes. methndology IL inslIIled in an expansion slot). Cablcs am oon- Imlmymp-evml lhc Linie. but I nocted m ndxplcrs ycu: ownputers almady hxve. ir. im sccurity o: unnowiflß Pzintcr sharing is umally I hallt-in nctwork lmcw i: hcld th: rensons. v.„ u m “ policy shunled promisc cf oost- savice, 11minaddition. filcs can beeasily “I'll pass you the effectiv: weck- fxmnonccompiztexmmothcizlnouiu words, but I'm not going In ler. you uy my n'bs.” end cntcrtain- wo-slot LAN: offer a mctliod of slmrhmg m: sult. Peacr-to-pvxr systems am worrhy of consideraMumm. bcing bdrbecuc. und setving your gmsts. ment.) whu-e thcrc i: alrcady a oonsidin simaficms tlon A: I oonsid- nmoflyom feetbyrequcslsforsalt&pecpper‚ am! crablc invwuneruin mmpulingpower. und where etedrhepa-oblern. rmn: potato salmd. i: impornmr. Peer-to-peer flexibility peer-ro-peuI bcgm to realiz: zum-Slot LAN: syslcms take full advmug: of every bytc of simthat orgmizhg . Willi a zero-slnt LAN, informaäcn cmthc sys- age. and eva-y mmc: of pruocssing powez‘ IvailLhis gct-together anyusatzTl-n: able. You cm pnt one perrson in chIrgc of (h: Iepncmbebrowseiorcoplcdby cauld baoom: oumplicaled. I had visions of feur- mninlimitafiuni: Lhatinformationshould b: proc- barbecma and und-m in clmgc cf the lcitchm. locn people trying to exnnguish a grcasc fixe essedbyonly on:u.ser.Z::o-:1ctL6lNsw01kmll e154: cm gu about their busirlßs. m’ lcnd befare i! reached lhacix ribs. chickens. and hun- forservingyom gucstsßutymugnestscarrzhelp Evayon: wlwr: one's needed. a hand bmgus. all howlixlg like a bunch of technjciaxls you oook. On:drxwback cf pcct-Lo-peer systems. i: Ihm A wo-slot LAN i: acosteeffective altzrnaxiv: informaficm still Im: m b: szored sann: plane. uying m prevcnt I majar systun fuilure. ‘ Suddmly it hil m: -multiple cooks. multiple In Sncaker-Net. especially if you havc a cum-widerg an m:level cf activity. n wotlmation meals, und only an: barbecu: I Iliink what's able investmmt in coulpumrs already. cm get boggcd down dealing nrirh requests [mm needad hat i: anctwork! ‘If mo-slol LANs sotmd simple. it's becallsc olher users. Ifxmherdefined Iheproblcm-Whatlneedexl they are. In facl. Iheir linfitatiom malt: ihm a Ifoxicofthe workslarionsis overworkdilwill

Hard Drives

95 Ö

easy l0 install. "Ihey a1": simple, muclmfical SWilCheS um: you ommecl all Lha: oomputers sind m. I reaoonmlmd slightly mor: Sept-listicated Systems in mancases. und insist cn it whan Iheusersortheprixxlcrs willbe somedistmcc 1111:1. “Smart” switchu m: slightly man sophisri-

1ms to b: very im.Spccial hardware takcs high speed cummunicatioms.

cm-e of

111e seoornd oorrrponml cf a Multiusezr LAN is

Lh: sofiw am.

LAN sofwsarc

conrmls thermwork. und i5

usually indepcndent fium th: hardw u: you 1.15: Im’ the

zumal nominemywifewouldbescrvinglftlfisoxflyhappmu dem. pcrindically. und shon diszmcu m: involved. Thesenan. butread b: solution. Snnaket-Netmight your warcis Irguably Sncakcz-Nefs most minus linüulion i3 Ihm thmmreimporimproveqnmrs rund: by an:uscr. a1:not availnbl: tant of m: two In any othm. So onoeyoirve served m:salad Lo softwam ‘Ihn pmcedmns and anprovidcs componmls. you: guesns. if on: Iddx slicod radisbes. u: salads [orwmlcingmgediumdixigflmahkeepsmg aregolng orheraddsgempcppcrsnheir tasne difierm. Somefime: that's 0K. but not i fl rystem ruxlning smoodfly. wann: evayanc l9 mioy m)! wifds Original world- File Server VS Paer-b-Peer LAPGS mmwned recipe. Mulüuscl’ LAN Software falls i m ) two bmic catcgozies - “i'll: sei-vs“ Ind "pachten-paar". Reaouru Sharlng Fil: serva 3 5 % emphasiz: I cumal, vcry Doyou have a lass prinxu, plotucr. barbecue Euch133er cm use to his own : I : . ‚ thuevcqnon: wunls In use? Areyou consid- powcrfill cumpum. a5 prlnm-s. dixk drives. und well a: with equijxnmL upeomlng aing pmchasmg printzr: alnng scrvur. an 7h: filc informafian use w m t to Computer puxchasas? Don cvetyone is an powcrful file 5 m m . the With asimple Aprintushwingdevioeis ymlrbarbecm? workstalions oflm lmveno disk drivmcrprixxtu: solufioxl. Printa- sharlng dcvices m: irlexpensiv: md

Roher: Hin-Iran: i: a pur-nie: in Compuflnd, a fmn whox: purpaxinoprovid:

unbidud compaxer advice.

Nefwork

Decision Guide [HÄVE YUUHEVER 1.11111751:: A 912111111213 1211104711 wrour NUN LNDER HINBUN CCNTHUL 11-11014 1111.1. EASILY 111.011 YDU m:

ussassuvaasmssuneumn-asuxmasnsnsnmagpam

- 115e LNLIMITED - READ

CGA

m AM CA’

: | 2 ‘y :' n ä i,

an EGA 11111.5 ÜESlGNIm 32* x aenPcas? 1311103 m: USE 111m an 1111110111 A 1.131.192?

- 1151s HERCLLES.

am an

I.‘ -'

- -_

‘ T ;5

11 0 m m TEXT —msasnsam. g „ _„ .. zoom m13 1s hEiU-DRIVEN? M 3 1 5% 311mg‘: f5 - 131-2112111112 EXCELLÜN AM3 sausen FILES? H" „ u m F; —u m ; YOUR cm 015mm FOOTPRINTS? SÜLÜERMASK? Luunumxts w" SILKSCREEN? _„.“,""’‚„...„‘“ “f | -—USE mtxmans an PLDTTERS? .33 ’ muwhepe’ XT m AT? USE PC‘ nnutlme antuärwäorld o n / o Htrinke rgplägapägm - RÜTATE PARTS? mit: lculno vla ä.‘ F": : :

uxwrex-s smmnmms?

A1113

‘—1

‚m

g’

autonatlc

Jr-o-g

g-j „,5

i'm-DING POUWINTS I5 EABY

A55 0m

EaSu taxt EDIT BLMP E1355 FumPAN 1mm m m 1 :

min-eins .

I5 THE PRÜGRAM FÜR YOU 5150 SCHEMATIC CAPTURE PRDGRAM

PC-SCHEME HASJBTBEEUiEflITTENMDlShDREPOl-ENÄLTHANEVEIR.‘ . m m ’ TAx ExmA AUTÜROUTER PC-RÜUTE 1:350

SPECIFIC INSTRUMENTS LTD

Back

Specials

— -640

OMTI HDIFD Cmuollu 411 MB11m1Da»: WISaIf Parking (up u; 450 KBisec. Du:Transfer) 11i:card WIPrimeI Port M0111] 220 Watt wer Stipply (CSA) Clock und cum: Eimmced Kcyboamd (Iapmese-mzdc) BTC Full Size Casc F111: Screen Hi m:"m.Monitor "will; swivel bang.

--. -

P5134555

fi n lpm' g m“m""s m”

m‘

AD mnTEN

Hut-Im

31:11:11.05 MULNT

„M;

#1699 . '

Ei:

RAM

äääo

usms

PCPROE DxY-QQQA

Upmdc m0 „ü!„am am553m0

„ m m mjwtmcbmgcüß b

gMSCEAE I

m35“: AMSCAD m m 0

äHäEiB

„ w “

Speclals

“"515” ““ m ” —— “MM”

Laptop Inüernnl M o d---—-——S288 f0; m05: Lxpmps fi x } ‘ Prlntgf

(‚enüqnlü P:=_':":"_“:‘i°_"1”_?:i.’f‘f‘_‘i’;ääm

1,4’: ‚

‘I

r; <1;

_ """

. »—'-

2;;

Bonus Specials with Systun pumhase MS-DOS 3.3 ..—————--——....—s11s Samsung EGA Monlwr —--—--s49s Lugllech Serlal Manne —-——-s112

2o MB 11m1Disk 1:35 ms) ————s34s 5450 40MB Hard m51: (401113) 80 MB H l r d Disk (23 ms) v-"SBTS m

1g!

;

3036-16 W 4 m25 RAM-n SCALL 720 K 3.5" flopy Drlve --—--5l28 360 K Floppy Drive —--—----"S110

Only S2028*

"‘

vananuifmfl

_‚

.u mKm mumm “„)

m m 9 11s FEaJtREn

ä wann-kg

11m1

o I

‚

n‘

im‘

1115:1113

agnagsu u)

Back t0 to School

Deluxe 10 MHz AT

ALITUMTIC VIEED

um BILL „JENKINS 291-5171 1

"Wi-

LATEST VERSION1 1,0

.__.r——-

3 4 - -

plocement

nm-‚d 1o add a Amme: laplop might solvc your pmblmns m w. But whafi aboux langt, whm ycu may other prcscnts HeasiPQnniJu-‚xcomipuwrs modem? O1eormmmicmwimmmfram? Orcxpmmdintd i5 um9 1b Spart“. I1 111m Fax seawitive mym. 1in1: uf pzice DATAVUE eompumrs: 111e portable getan delivßrsallthefeatmcsajadpoweroflhcoflmleadülglapwpsu ngxcaxprica-„For S1699. youMHZ). (43711954 dualxpccdprooesmr chnactuxzä displßay, wrrxl80 limsupu-twislbacklit easy 8087 ä. dual 720 K nfimodrive (mtexfaoe fcr cxtcmal 5.25" drive), 640K RAM. sarial peu-alle! pon. und AC rechntrger; user manunl. Map11: socku. MS-DOS.

OMNlNET

COMPUTER LTD.

Prmm specms

cum. man Pflnter a:cabl: 4259 sm 11111-1111111 mmcabl: . . - „ - s 3 2 s

34m1 hinter 240 CPS 24m wide ein-lag: 3750

1111111111

12-51»: Open 7 Days a Week Mnnday 1o Saturday 1 m m Sunday 3728 Main St,Vancouver V5V 3N?’ (604) 872-1136 ‘Quarnirigs Limüed The Camping: Papa: August 1911s T5

The Future f Loca Area Networks 53m

__-

COMPUTER LEARNING IS NOW A3 EASY 5S WATCHING T.V.

—WEGUARANTEE IT!

Arcyoufnrrtrawduyingukunymucompulcr programs fimnoomplicaled mauuk?

DOITIWISISIIIYMOJOÜHIBWIIIIIIIBIIIIHIIIIOI lmrgweeksirxaclnrsromflnI/ideohofs-

fanperneaquickuldesysofiwuclcflnIngryrwmdesigxudmgachyoustep-by-aep ntyourownpmcmdmthepgivacyoryou ovmhnmcoroflice.

‘Thmwdconpesm awuranennenunmg’ uldvcryrxofessjmufly’ '

donefllheylmnvflablealamurlbcrofkvds uevqyafiordablc.

APPLE

Appbworka Word Prooosslng

spmdanoots

Database:

Pagormkor

Ventun now avallnbln!

a cm

Po: man Informatione111:

Iohelpfinal-

hnlhandwnllancnxptmmnuuzsuneoftheissues

Jrbornfnraxomcmsinghivoc

Afinnnmlhofhallonringmetoslowmmnox äiufunrrudcsiredforflumflö g mpnhcgruwflxofpnpaxmnxydesklhcvebrxfldondapnrhmmyhcyboudpolishadmycrystal j Moreeompkxixyrneansmoni’ fnc‘

Iwixhrcleassschndurlnurdmch-

ndny: oorpomre Locnl Are: Nctwodc

mRaInppUrL Misseddudlinn

buyainmfmseubkfimxre.

lbegmütissu-ierofnticlesbynothngrhn 1987 wastlzycuoffineLAN. ‘l988reunsmostlikely iobcrunetnbuedunhcyetoftisixrgprficcsfw mm-obuüublcDRAMchips. Allhnsnntbeen quictonfiaenewdevelqmmtsfiomhowevu’.

IAgfornewproduczxcmbecosflym fl “ 5 h “ “n 5° b“ "d gnevcrreoovaed. Puma-moto-

Mmdpflfvrmmmaydiswwmess Po: a: Gelb”: Todayscorpmkaxnwwdecisicnmzkuhasa idanise du: m Ihc delays in fewnmtfwfloßloaonfidflirxduaminingami- 4DBASE IV. End users are thc nmicrvearivepeoplcinthewcrld cro-buseddmpooamgsuategy. {pul-

theyucbourdtofindallfla: a Hat-kurz improrveaneru: n: wntinuing m “ obscmc “bugs” which the dcvebperk min; missed. re- g pmgxessathuknflckspefid-wimastltpowa quirhrg IBM n Ilrget technical mpIBM‘: 25Min mdcapacityofthn PSn Lama 123 ‚pon infiasmncuxc lo dingnose ‘ lnmPrncv/SSGSX l Model70. CPU, mcgabit andfix. WordPorfoct DRA_MSacluaIIyin_producfinm dann Im» Daskdrivesnbrgxtafanenuadlcnexpen- w3Allthisaddztxpln-moteexpmIIS Word sive. Twcntymcglhyßdfivuwiflbeobsolen sivcsofiwne! Wordshr wilhinayemzucumpaaaeliabledomqgubyw ;;_‚ WhIchIsMnnImportmt? D05 drives komme theminimmn ryrlnn dickem 4 A! n wenn dinnet mcefing,

frombeginnuwexpatAndbestofnllthey

8in1:

WMChWaybGo?

Hardware-SmIu-‚Fmerandchuper

cithcrnstafiabmarLANenviromnmLWORM ‚Bmmmfumflauxdcßo «r ‚ „.. Opdcalcfirkchivesuecnmfirgunvaymmxg- ofMicxusoflxcflecnsddutwhcrc Ohm nfxware oomcs free will: Ihc Hardware. morcmmufamnuxmbtroducitlgnewmodeh ‘ abadarlAN: (with wildly vuying specificniutxs). und und] withinadccadcwemnyptnchnclhcsofiwmwc ; ncaimdgetflnhnflwtchchldedfiezl Joking? 05B ad lhcLANManager wrimdrivesmponfisedaomcfimcin 1989.

m m,’ „w typesofhndwnbewmesnrulitynuuzufacu-

vrusxaguaabdsmchasmmpmpdfim

t5:

dardspavhgmewuyformassmatapodwfim Zl u: (includixrz IBM) m: corning under nunmofomnpdihlecommmicafiamwnxponezmbum onlhesemedia. LANpwdmserswülbcxblcto* dous p r e s s t : frmn Ihdr cnsonun u: be man eoonornically choose cotmnunicuiom media m j compuible witheachoduzThiginoonjunaion ' ' ' adxieveflxebesunixofcosLperfor-mnwgflcxi-‘w wizhsoftwaraaflmrcaisblmurg’thedmmcuon‘ b i l ü y m n d a s e o f 1 bememdiffuautypesofhudwue. WidcAruCammmicatiotßptodIncuarcfnstu. JI Novellhasdcmonstramd avasionofNctwme hsuxpuuivqmreflaxihlcnndmoreroliable, whichxmzsonaDECVAXunthxwlüchflbws MacinloslfsmdPCülotrmspudiflym-cxiston i

Masako Holdmgs Ltd

481l Mlhood Drivc. Richmond

(604) 275-1565

Dealer Inquiries Welcome.

dannnihxsyn- thesamemtwurhxlnearefllkinflsofgamwayx mmspmningtlnglobahiormafionmxynnwbc _‚tohrgerlßMsysnummndmoreappexr-fingdfily distrihnmdmlncafionswhmirismpaofmused; inthcmacm’ tnminiarmmthcscdissmfi‘In Iocallyxbutsfiflbuvfilubkcasflyasnncusry? ankommt: beeom: matte-und. mftwurc bocomesflheßluflwhichbirfisflxantogethaxso In genau! dann. Ihn hzrdwuc pries Bar per» Ihnflxeusumednotheawmofmylhhgoflre: finmmoecmninnclodaclirmhnthucisgcmdl dnndwmvirurmmxm0S‚DEC‚3270.Ma4-.m— quwsoftwmplaeexhighndemnrdsonflurume toshbtc-‚Jthmflwyrenxostaxnfmubleurd powerfnlsyslnnxheffectraisingthcmirfimumr fnmiliuwimxtgndless of Ihencmalsysmnfir) usedlofiysicallysmmthcirthta. capadtyrequiredforavpedficmsk. connectmtybetwemsnnflar

Sonnrc-BIggenSIovmrandMoreExpzndveg Softwndnvelopusnreabletomeetnhcyvw-ä ingdunmchoffiremaxteqxlacebyhfildhglatga,‘

Boxh openfin; sysmm and applicarion softwmprodtrcßmbyfirthcptedonfirunxfumin ‘ wdays dar:

more oompln pograms. which wonld necutoi

’

slowuümtfurfllcimreasedpowerpovidedby]

sysumsmmeinuficcbatwunm

thehardwm. Soundninaplesofar. qmhcafionptbgtun. mdtheharflware. Forum Renlixyunmintoflnpiamawhmyoumlizzl pnposmwewiflhokarNoveIhNetwamOS/ -g'

'I'I-IE INEXPENSIVE CI-IOICE FOR QUALITY SOFTWARE

zmdfireLANuannsenmdvfllx.

NovellNetnn Nuwncisbyfirthernonpopulnrurithnsoäfi

umpidlyasüxchndwureteclnxology.

Nerv sofiw-Irc mieses uke erden ofmaglfiwj,

mdemnrefimeurdefimrtoproducemmflaeydid 90mm: vendon 1o statt wen:

drueofinsunedNetwutOpetatingSynansJt kquitemmmcrmmflyininflhmnjxmluu)

andoffcrsnvuisxyofhrih-irafaflmlamnfwflithe fiessucltnsmwmaficbgdhlocklocjout. lo

u-anspamulymrrrur disks. intfflmplclc cmsaction Incl: um. und UPS muribrmg. Pet' wortmuwpvdaxßyetrxbcfuethfirirxnoduce‘ fommoe In: nlways beim an lop of Novell‘: tion. Micmsofihu oomplamd Ihcig primityIisLashxNav/Ireääbilirywnmmflrc dcv mkfocproauashnedmmexmg Windes: ringe cf notwod: commrxicafion inter-

40.000 PLUS PFIOGRAMS -1200 PLUS DISKETTES ° 400 PLUS PAGE DIHETORY

80486CPUchip(nmyetinproduaiom).

SIM=COM SERVICES

Computers -Software -Aooessories Cusbom

ability

facer. Unflreoenfly, Netwue um prima-ü)! a plaxfmmfuDOSbasedappIicafiom uoexecumirxa multi-mer mvir-uurnau. In the last yur.Novell h1: nddodOS/Z. DEC VMS. und u

otbcralwrxrafiveuwirvnmaarssqrpancddfitafiy by NBIWII. In addiüon. powuful md flexible

gamWaysnoIBh/Iminftamuafloflxalarge oompufing mvirurmalß m: avaihble. 111i: is consism: um: Novell‘: lang-rund goal of providing Universal NezWm Architec» an,whneby Neuware will provide neun b nII oorporanaoompumrgcrxvixmxmmm, xrmrpcrcnfly

14150-101 Ave Suney, B.C. V3T 4Y2 585-2326

totheusenNovellisdamonscratingporüonsof thut goal mw.

ThisEnOtwIJXLpIymAKDOSisdcacLadu-nnn-

smted vcrsion ofDOS 4.0i: Imutnflyready in

PC-SIG Authorized Dmler

IhnnavuyfiudamnnIIcvolüchn-dwxcbv’

gomdduamshipmandusasbymwber. Despixc iLs limitatiotis. ihm: is a karge body o! DOS based rpplicaüons hasmlled. guatmneeing several more yeaxs 1o go. ‘

1-6-Tho Computer Papi: August 1988

Miamufluldmßidevelopedfilmulfiwhichofsigdficuundvanmgesava-DWJBMOK RAM Iimit i5 gone. applinlion prognrnr rnay

nowbenslxrgeasneoasaysinccixisnm:

mnIti-lxskingosßeveralopaufionsmaymwhe

cauiedouzs‘

innfnmoreelegmz

fuhianthmmecmdeTSRxpproachraqlIiredby

DOS.

hordanenmmmfialewitholhnstafimna

productalledtheLANMmngerisrvequitedkfiaoaofihnscunIBMhasdniroInMicxoeoft. 11mm: ponims of 05/2 and LAN Manager n hndrnrcmanufacnnerxfilhccurfirisxhnyoudo nothmre m Iioemeeveryflfing. ycu ampickuad choouwhnyouwangnnddcvekapflurutyvmself. In addifim. sumepalts. lik: ihn LAN Mmagerrrenotcomplae-Miuusofl liccnsesthc

busicfmmawomundthehardwmrnmfacnn: dnesmorcwmkmgetafirfishodpromxct.

Thisaareofnflairshnstwoinmporunnramificn-

üom-firstOS/Zisnocugcneficasllofnlhcro

willbedifiererxfflxvuaffiundiflcxuuvendmx.

uchofwlfidxäfiadmnrpecificmannfwnutfls hxdwamaudmzynotnrnonomm. Sewndly. npplicnfion schwere may tat: advanmge oforv: vcndorsimplunmufionofsonxefnnmwhidxis

notstupponndinothurversionrmMhasnned

dunhcirversionofLANMmaguwillmtneoes-

sarfly b: compuible with Microsoft's). In an indmtry Ivhich bis beenfueled by standardizafiolufltisismoddstamofaflhirs. Software devexopax my find umm: products a: nol.

woIkmaIIOSITgmdom-porateptnthncrsmay beforced inminflcxiblehardwnedocisionsbnsed onsoftwnrelimiufimu. Irissfillmozarlytodeuerminzwlnlproblmnr

mismxycnnmosrzisdefininclyflnmwküm

thcblochaxmdasmmthereisverylitflcrulap-

plication softwm: nvaflnble, md few user's yeL Cenainly. nllof rhemxjor softwm Verdun hzxve anhusiasticafly anmunced mppart im it (they Iuveliul: choice) andproäxn will arrivefical soonnow"(rxe.xzyear?).

Animnerüngnom-mzlANMmnguxwhich wureleasadb0EMüabyMiaoaofimmnflyhns

mupdmoominginflnenutfewweeh. Pmof Ihis update is inqxovod cachixxg softwarc which

will"hnlpdoscfliepetformznccppbeßwemLm Mangel’ andNemareHocording In Miaosofi. UNIX

UNUfislheoldnstmtllmnrtvalerah-leofmllfisyslems. tisamirü-compnxter 1e mctoperamlg‘

OsmhcnhmabANainceütypicaflyiscuffiyg-

ureduapowarfixlcmudCPUoanmnndmmany

dumb mrmimls. Initsearlydays. UNDCsIfieredfiomincomparmilities bctwecx: differem mannfacnn-ar‘: “flavorfofzhcsyslem. Sofiwar: dmrelopershxd m wriu: l0 thn lowest common denomirmor of

UNIX vcrsions. andperiphaalhaxdwnß. plxficularIy terminaluprogxarm whichrequixcd 15function keyr wer: not ueeable an lcss expansive In;

386 DIIEAM MACHINE

LAN Language mitmls wbich had l0). UNIXkpcyularityhasgone upmddcrwnovex

lhcymsUpgradedstandm-dswarairxmdxmeda couple ofyun IgmandcnccmorcUNIXWas gaining inpopxflmity. IBM.DEC. ATäT m nazne

just a few big players annom-noed mnjcx suppon für UNIX. Unfnrumalzly. ilmxy nothappen. as UNIX

man: whavc slwtilselfirxfinefootagamhhflny of1988. nnidfnnr: nf being Iefi.uulby Ihn ATkTl Sun Nfinosysluns joirlt developunau t.

fulcludinglflMznibEC) fcxmed flmqxnsofzwmfimflafimtodevelopfineir own Standard Now AT&T i5considfling sptilufing

most

UNIX develapluent 0E imn a.scparatc ocarlparly. So. m standmü this year folks. Im: maybe only 2 neun year ... ? "Thereis asignificmtbamafvery goodnpplin-

fimsofwampaxficularlyforsvmncvezficals. Nothing 11k: Ihn salacüon svnilnble in xhe DOS world. bm all cf it inifially dcsimcd f0: multi-usa’ operation (a5 opposad to applicafioxas inidally develuped fotsingleusuDOS undlnupalchodformulfi-usel‘ LANoperation). Infacz. youmxygetUNDK 1nd notrealizgit- fm" hstmceBmyanfs VINES LAN Opezaüng System is based on UNIX servers. UNIX won't go awny. but. th: lach: of otmsisbcnl standuds aml real vcndow support will prevmt it fmm making significmt mutet share gaim. Whera Is ‘I'm Future? W: who wcrk in LAN envimnmmxs now ukc

forgmuedmcrealizyofmulfipknctworksaflcoxt-

nocwd. possihly spnnning huge gaogrsphical distanees. With gamwnys m "tätig-L" envimmnmls. flünqxcsmu avaysmall segmmtofmecnmpute: wofld. thnmajoriry nfusers are sfillrestrictcd m aspecifichaxdwaxu Vander. andfims afixed view

of Lhc oomputcz resouraa. Software developers with similar pmducis in diffcmu hnrdwnre enviranments must mimain

and improve sevcnl vxxsimas This beoomes more and man: inmlznbl: a: arnd suppon cum: cscalulc. They an: keenly intu-

IIIHmaIe Performance a! an

Gloßary of LAN Temn

Extremely Low Prlce

_ADDRESS:A1.ufi.q1sc1ocafioninaoompuwr'sn’ memory. Alsoamfiqtaemmaberidunfifydng

APPLICATTON Werk Lhal is dann m: a

1. . (iI.IT"?i|1arydigIT—mustbt-.0(“ofl")ml

BRIDGE Afinkberweax zLAhPsmsxxallyof different topologfs. BUFFERAn ucainRAMmai formmpormy

BYTE Nonnally I11: 8 birs what mpnsmt a ' . clmracm in CACHE A buficr I m : mocifically uscd t0 disk amess by swring largeporüons of spe-q 51:5 m manory. COäxAmadilmßrg/peofwifingsimfln

* Herc-Lxlqa oompatible graphics Card W/pfinter port. * AT Enäanced Keyboard. (Kaytronics K101) clock mit}: hatten-y backup. Real ' AT tzizpewith lneyboard power i turbof disc light. " 16 mhard/flflppy flinklock, Controller card. ‘Slflxpannionslotam-Bbits/l—32bdtu'5-16bit) "'200 CSA/IJI.» appmved powar Bupply.

‘

m clble.

CONSOLE The scraen am! Iceyboard of 1 SFJIVER. CRASHSlangtum meaning that hardwareor schwarz has smpped hmctiunirlg pmpcxly CPU Central Prooessing Uni: the ‘hakt’ of Ihr. oompula‘, executes 11l inslructioxls.

emxfigtnedforflaemmlcostcfiwfive eapacitjr. A9 man and mm diffemnt sysum: bcoomc

ommwmdmsmwiflhzvcnclnioeasblnwthey vicwünoompnatingresomve. asinglcsufinnon your des}: Will pmvid: man: In the infommlion

youreqImQuxdpIwuILEIinIhemannHyoum-e mostoomfcutabkwimrcgndlassofhnwitwurcuieved. HowToChoose

hirepofeflionallflvifiefromareplmblecunafltingfinn. SouryJutJoqymn-nciglxboxxwhodues mm:

woskonhissecrumykmulh: ofioeisbiüfmüxperflflflluughhowiflfreely (fix-pause aivicc im whifl: 5'011. m: M. w-ül b: responsibloshmxldynnfoflnwir.

Iümwingwhichsofiwflepwkngewifldoflzjob

wfll dcmminß Uhu! lfind of System you und In

implemmxinfinthasamoughpowcrmdcapmiry mcpummwandforflnnearusmzdmnflu) future. ReuwmbetJnnLANuwixomnmLyoucm

aMpowu-inhxwunenmlmpsasymnudigyou donotmedtoreplazemcuisfirlgsyflanfluvem -

lan rhare nur-ü] be whichplaufingand '

somedimzptionforynms uaiztinghefuruhnndcanmnnmze."

Mit: W00’: i: apartna wir}: Sqftrat Systemund supImx.rmponsibisfor M: mit, portQfNcII-reHIANs. Hcakoaachcsiizradudfiofl to LAN’: drang}! 1h: Vancouuer Schon!Batzrd.

_____;

‘

—

This is a very fast System top performance.

DMA Dircct Manory Access - u tcchniqtpe whmeby dem i5 moved around in memory sirmmmeously with 003:: CPU tasks. DOS Disk0perafing Systmn -rhemosxpopxh: pcrsonal Computer opcmfing systenL DRAM Dynamit: Random Access Munmy rufen: In Lhcoonxpulcrcfipswlfichmakzupflm computefs working "memory".

'I'ae SCSI controller gives n datn trnnxfar rate 3X faster than a normal unit. Ideal n}: a Network file servar or CADICAM warkstalion.

One Year P rt and

Lfib:w"

Wan-anty

E-MAIL Einen-mir: Mail.

FIBRE OPTIC Ahighspeedtypeofwiring using lightbeamsto umsmitsignals in spccial uptical cable . GATEWAY Alinkbemreen aLAN mdmmc othnersystunJxsuafly aminiornmirxfinnc. HARDWARE Physical oompumr eaqniptnmt

Vaneojnvor Omas - 1041Wust Broadway, Van, B.C. VSH IE2 4604)733-1535 Richmoixd Offioe #104200 No. 3 Rand, Iüchmond, B.C. V60 23.2 0 (600276-9588

qrwcmtouchit.

1mm. Mlllfliüsmumdmdzscxibcopuatingsystnnswhichalbwmmyusersaxdifiaunsmtinmrositmdnnmndhndwne. MULTITASEBÜG Used u:demibe operatina Systems which allow Ihn a m :sufim u: execunzlurnmcprogrmns simuhaneously. NODE Any stuion on a LAN 0S Opaifing

Systun-flnammolprogrmnwlfichmmmgos

ucculinnofothunpplicafim_piogrmnsflsn

Answopernhgsysmnwhachuscsmodnys

man

RAM m ! )

ImkingforaLAN? Fmdznnmhzcwhnneeds tobuummnmdNowmdinflwnenrfinme. Fmd flwsofiwarerequiradmdoflujohidafllywim local snppun 1nd. local mfemnnes. Do not b: blindodbyhmflwnteclnimmatflficpoirmhfldwnc doesmtmnmr. Ifyuumnotfäaounpluaparxson”.

______

-__

Wfitts

wializedhoxasmqupen-hgsuchulfighspfled su-vens, Irchivc 51:17:13. diskless LAN stafions. umununicafimxs mvusunTlnunLANcmbc

" 80387 (‚Po-procassor Socknt.

dar: stora

mIncaxe1spedficdn1.

hlhcdistribuladLANpoenssingmvüomnmg

g CEX 336x20 IBM COMPATIBLE.

* 80386-20 CPU Running at 20 M111, 0 wnit itate. Phoenix" ROM 310e * 2 MB 359.61: eolumn RAM Memory. ‘ One 1.2MBmappy Disk Driva. * 60 MB Hard Disk With SCSI Controller 1:1 Intarlaava factor

nstcdintheahilitymmainninmzpuodznlmmwn HASHEWG A nuchfique nsead m rednce the m all uwirmmlmls. Slowly, but mehr. w: 51:11: m b: mnking prog02K Two o: mme nerwotks xus in Ihis direcüun. Manufacuuers Indiz: du: ocmnaected via whinh nmv am. I: um. ahridge lhcy oannot imposa thnit “Standards” m man. larger netwofi LAN Local Aren Netwmk A5 themvüonman who n-y lose mnkct ahnte. umconsists o!’ 2 or nur: mcnLs become closmmoremfivmal softwarzmols necmdmgeflmmmmhfiormafion will beoome availnhle m cnablc dcvelopets m M0 DEIHMODaIawrIDEMod-ulamr 1 huldmxintahasinglepuodmxctoverdiffumhudwxc Ware darin: which stand: dala via Iclcfllmle systßnls.

wmksufim.

man fully

RECORD LOCICING A critical LAN atmccpl whichprcvenrs mulxiplametr‚fimn simulmnously nnaessing thcsun: datain ashued

SERVER A spezial LAN snfion whidx wuuins infunnaüon andior resmnoes shand by oflmsmioms. SHELL A spucial program loasded inxo nach netwoflcworkstafion whichpaforms Ihcncl-

INDEPENDENT TECHNICAL 1 S E R V I C INC. RICKCUCH DEANGREEIHWGOD

- hcmsunwxuA-‚a. Visum‘ IC m 1 5 : I

q. ‘

__ mm„u

QUAgLIFuIEDySERv-ICES

„

115251.:: "ussuuci

“

EMERCENCY FILE SERVERS

"mmanummmarmzsmvnns

fisoMb-nrim NETWORKINSTALLATIONS I

Cgmpgn-{gd

NETWORK CONSULTING

NEIWARETRALNING

Cnmpaflblllty Topologie:

Nein-Ire

Bfidged

(IN-Ihn

‘Ihm-Kg!!!

Hardware

310014111

w-Servu-

C1D“!!!

wmfingtnhmlhnfledbyflulmalDOSor 05:2.

SOFTWARE Inxlrmtimls to the lwdwarn.

Softwarcpmogmnmcausamehudwuemem-

SPAHONApcnonnloompmeron anetwark. SPOOLSeqnmtiaIPu-lpluulonlpmonüne -refu1b|hecon1rolof:baredpfinlctsslmh

Ihatmnifiplepxintjobsfimndiffcruuwuxkst»

flonscnnshneloonumnpfinifl. TOPOLOGY Rufen In m:mgxhod in which oompmmn ofaLANate oormnmd. TVCOMMUNICAU0N Gnunlly saxling dmfimnonasufinn In molher.

Tralnln;

Qualified huu-ucwr ITS Supervisor Training Manual Heu-am ‘Ä Supcrvbnrs

JSet-mit; lmplcmemmou 1 Print Spooling

j Da:Back-up

InnüUIicflIh-I-Ifii-fi-ii-flflfl-E

Twlsfflflfimfllowspeedkypefifwifixlg gmerallyequfivalnxtm laclcphwbewxrmg

WORMWmnCJnMRcadMIw-mfmloa

dass ofaplical disk slorage dwicns where du: cmbc wrium once, but xcad ovcrmdover. I

Tlu: Cmnputfl Papa: August1988 -17

Pensum. Bumsen TFflFHFB

machineyouchoosc. you cazlaJso SIOIC applicafiotas as wen. This mems ycm could put a progam likeMacDraw man your PC haxd

lFEflTuTE

drivc andnm i1myour Mac. Grantod itnms Iclativcly slowly, but itcmbeussfulinmviromneurswhmhaxfidisks aremshna-tsupply. Unfommuclyyousfillcaz-rtnmhla: softwareonyom PC.

PERSONALIZED IBM P.C. COMPUTER COURSES

FlleTx-anshüon

ThefileunnslalionprogrmniscalledTOPs TranslawnThis allnwsfilcumshfimbetwemcnmnmlPCmdMacprogrmxs.

BUSINESS AND HOME .32“

UnforumatelyütmlikcflnmainTüPsprugrmisastmdalqne pmgnmyluchmenuyuuuumuizthcprogrmnymamworhng

mmusemltwulflbcmxxflzmoofluiftheylmdixhuegtatedhto

Beginner 8nd AÜVHDOOÖ C|8S393

lmroduction t0 IBM-PO and popular aoflware prograrns ..................5150

Lotus 123for beginnen: ...............‚„..........S150 Lotus 123 Mmme ....................................„S150

Bodford Accounting .................................„S150 lntrodudion n:Word Parfad 4.2

..........„s1so

ACCPAC Aocounthg Systam .....................S15O Bedford Accounting ..................................„S150

12 Hour Courses S150i 6 Hour Courses W5

DayOounn-Blnurstdayngamloalpm Nlght Gourses 3 hoursi night, 7 10 pm

Limited enrollment per dass 1 Phase Call for Lab Rental a m ;

gcorporatlons Call for times and dato:

682-5448 -

{Adlvlslon o1Eva Vlncente Media and Talent Group) 20D 247 Abbau Straai, Vanmuvar. 8.6. V68 2K?

——.

Another Mainfi’ All those Iabels! Isthere any other way?

memamTüPspogr-masmapfionflmyouuaxxferfilesbetwem eompuwsfllfisfileoonvctsionutflityisthesmmoneusedinby DaynaFilemd MacLink. I: cotmim fileoonvetsions foravxriety of

TOPS

You hmrenmnzrotxs PCs inyour ofläce 3nd you recenfly so:a

Macintosh inmdoDukmpPublislüngoryuuhxvcaMacofficc andyouaddedaPCtobebertaablewsecviccyomclienxswifltPCs. Nowthequasfionishowdoyougzxmmtoworkmgexhnr? You might considcr lovkixxg atTOPS 2.0 uncnrork solulion desigmd In imcgrm the n5:cf PCs md Mac: inm arelafively sann-

Publisherswinbadisappomtadbyimlackofgxphicmmdnmgas.

Innddifimlnfltfilermxlafimupafilifiasmnnfixwdhflw TOPS umslawr. 950mm:5nd: a5 Pagemnka. Exoel und Word offumedfilitymsnethdrfilcsmeithuhflacatxfmmmfxcfili-

lssswudüxuawiromnmx. mPScmbcusodonmexchsivelyMm tafingttnnsfers. fmmaPC ornwaflvirmmxannbutirsfeaflresshfinemmcimegrafionoffln EWG.

TOPS mkes a distfibuned sava philosophy which aIinIinares ms neadlnhavcmcxknconxpuhulhfli: Ibcdndicalodscnrafllfi: als: aflows fiorgreanernetwoxkresilimcnlfcnneompumgoesdowmit doesn't bring down du: whole nctwctk. Toßisalsoalxunmesawrasopposedtoflnsimplerdfisk

FmmmytnaswhajntwmttogctthcirPContotlwoffice

hserWtim. memmmalisahirofadisappoirxunennnltdosn‘: hacludefllcseimhutfiunsixzthcqtxicksmtscgmenLlnswadyou huvemslogtluoughflxeleclmicalpotfionsmfigureitmnßvenmlflyqrouwilldocigfllulhcfntflnlmflcsxyomPCprogunsuppwls

thair „parat: pmgram -8Op5in1 files 0o PostsamYwcandownloadyourfilesfromthsDüslevelbyaoc-„assing TPRIN!‘ fnlbwed by [dcvtc IypeIY] [dgvioe tanze/Y] [zum nmeß][filenanwie]. Fommatelyyoucaxzdcvelopadan fileno mainflusectnrmetisfics. utdjustaeeassfllflrfl‘ acnclyom file fimofApplctalk whichmovesalnngnaboutflßKpcr sccmcl. zum: Mostfilcs whichlackPostsaiptixlfmnafion will hnvetobe ahomthespeedoffloppydßkanoasaAsvairhaflLANaügeß pfimedhxmablomodeandyouaxdupwithcoufieflypeface. a 5km‘: with m a n activity an thc network. I: i5 hnwevar 11:01.:200 fahly pmssic typenrfitu stylc fom. Eva": files nach a5 diese generfimesfnsterthma 1200baudmodemoz25 times fastathan 2:960) aIcdbyWoxd whichdoamminmePostScfipt instructions. mustbe modifiedbecmse Word minks i: i: prinfing l0 a LaserWx-imr via the band nun Inoüm oonnecl belween two machincs. Using TOPS a5 a slricfly PC nctwork. specds csm be Ihre: timcs fastcr man Ihr:PC sexinl cable not over Ihn: AppleTalJ: link. lo Mac oomoction bccausc cf lhc a spccial schwarz: dxivcr callcd Who Should Buy TOPS 690Kpcr Seeland. still. FlnshTnlhThispuls Ityoujusthavcmpass looddfiebackandforflztoyommacor notfaslomnxpared withlfighsgeednetworks. butbeuet man the Püthetnaremuchlass expemivewaystodo inheclneqacst solutinn isusing mbwmmtxxiufionspuogxanxsmboflzsides anda ApploTalk yed. nullmodemmlinkfilatwo Hour i! Wort: TOPS is really a series of programs and hardware usad m hridg: some t0 m. up und usc. bul. i1 1s oosl ofloctivc. If howaver you dumm worldxflhepuizges youncodlobuyumTÜPS fortheMao rcgulutlymedtonmvefilesbackaxmdfoxthbetwmxthctwo elwiron(schwere), TOPS f0: the PC(Software). am! a FlashCmfi. an seid-h manrs.orwishm shneprhnmgruomces (i.e. lLuuWrilcrLTOPS boml für Ihn PC. (Alrcnufively, you cm usc Apple’: own Ap- uffcrs anefiecfive ani wefl executnd solutim. plcTalkCaxdfonrtlnPC. aTmdylbxkCardfiomTandyora Thlngs 1 Wlsh TOPS um Hercules Nemrork Cud Plus) One 0fachof Ihr:Software packagcs TüPslachErMailcapabfliüwThepxixuüagsetlqaisnotme muslbcpurchasud fweuchfimbhhcontlmnexwork wdtma m05! srnighr. {an-ward an the PC sich andI wish Lhc NclPrinl wen: flnshcard i5 raquirad fm- uch PC. Euch mftwne packagc hu a includvd with wer}! packnge. Full Postscript acaess wnuld b: ideal sozial nmnbcr. und cm only he used once an the nstwmic. hmluded from Ihn PC sid: instand ofmzlcing it a separat: yxoducL TÜPS also inthaMac soflwareis afilewmulatnrmdadeakacccssmypfim lach: Ihn: sophisücaled network stafistisal repom availahle Erom spoolcnlncludodirx die PCsoftware isapzogrmnwlfich allowsthz olher PC LAN Software. T11: ability In ussign costs für rcsomoes PC mnseprintearsm thenetwork andthnpu-intxpoolmg und wonld bc gxcat in multi-deparunent compmfies. For all xhue Fm" applicafions which Incl: drivcrs für Poslscxipt. TOPS sells a1 slmfwminss. itissmoothtousheasy wsetup, msilicn: anddoes separaxeproganlwhlchwillcomm any ffleswhich mllpfimunm ageatjohflte femmelzmrcafly looking fwwmi t0 fromTOPS i5 Lhci: iuznplanmlafim of PlashTalk on Iha Macmtosh. ‘Phi: 1in1: Epson FX-BO m PostScript files. t0 Swing up aTOPS network 5sa relafively straiglat i'm-ward affai-r. blackbox Willpxbbnhly cliponthchackofaMlc 'I'heMac.sich i5 "ally uq In myonehnv-ing fzmiliuity with Lhc incrtasc thc somc-whul leism-cly pacc of Apple Talk by a fachm- of Mac intcxfacc. an Applcmlk o: PhomNt-‚t cabling so if tlzree. ltisapparenflyhthewofltsaxTüPs. —KSK pfimusor otlmperipherals araalraady being „ihn-ad. it i5 nannte: of drupping 5 0 m :sofiware inxo the System filc, rcbootiizg und you Prlclng: Tops f0: 111e Macintosh 5'224. Torps for thc PC S224. Flashcaxfi S295, Nah-im 3173 Systam Requlrements 512 K arereafiymnmwiflxthenwinToPs progmmruming unDAuJ-xiar Ihn Apple menu. Mac wbcitet. PCwithmleast omopenslot. Harfldrlvmhjghly It rnay take a few minutes of ‘fmousixxg arotmd" mfxgtu-e au: um reomnmmdedCGInplmflUPSukSmldicrasysmnsConIpmy idaa of "mounfing" anal "publishing" a volume. You. "publik" n Avaflable fxum most Apple Dealexs. “vollauf (o: foldcr) t0 makc i1.acccssablc l0 others onthe netwotrk. Youfinoxmfavohmm whan you wannnmakeitappeuonyom dzsktop 1s unmerdixkdrivefousc mmalpgyfpublishinfis like puning yout files up for sale. “mountinf i5 whm Samson:buys i:

navauThis allow: nmmzsophislicazedfoml ofnetwoüng. Allmemonrhenetworkcanaccesslstoreddanammermrkmarr‘ Iypliclfimxcmlllnwmulfipleusm mnccess n5]: concmrcnfly without compronüse t0 da1: imcgrity. TOPS i5 notwhatyou wouldcnl] Iigluming fast. This i5 afimc-

alraadymoumuviflneadto

called Posrscfipr‘ clPzint t9 convcrt frum Epen

Wann

Q -.

k j

Yes!

Continuous Envelopes Print directly on y0ur_ envelopes and d0 away wlth all those stick-on labels

Telephone: I8

263-4036

The Computer Papst August 1988

I0 n5:an lhcir canmuru. DOS Software

TllePC sidcas withmost lhirxgsPCraqtliras acmallyopmfing the

mmuaL Firstyoumus: inslall thcFlashCwdinlo Im cmpty B-bit Slot. Thmyoundd aIInemyouCONE-‘IGSYS file. Fnallyyaureboot. Nmnmthesoftware insullprogrum Loloadflmxwoessmyfilssonm the hnrddrive. Thm "LOADITJPS"am! "TDPSMENU"In gut

to thcTOPS pxugmm. aving donaethanyou areready tio"publ.ish" somevohnmesiflfis i5easy with a manudfiven pmcus. Itsaems you cm publish only fom- volumcx I]. I. timn: an a PC. TOPS on the PC can be use-d eithar 5mm Ihn menu drivm TOPSMENU program, o: from 1h: DOS mmmmd Ihm. Sonn: o!’ I11: TOPS pxograms are memory resident in das nuworked PCsfllxis stur-als about 200K from ymzr PCxpplicamns. This potmmally can intzrfera mmlnrgcrprogranu whjch require morecf Ehe oompmefs memory. I1is dcfinitnly a.man to so: the office PC's band drive appear a5 an imn an Ihn Mac screen. Files can man be oopied u: und fwm Ihn: PC will: Ihn ease characmrisric of d1: Mac user inlerfwc. N0 morc hcad sczutchüxg L0remember rhe nrchane " COPY *."‘" commmd. Not only can you smre einher Mac m’ PC dalafxlcs m whawvcr

TOPS mm an einher:- Apple Compumr: awn zlpplcTaik or 1h: (es: cxgeizsiyjejfhqnclfgfiam Faralion 6052:4151":

l W

NOVELL 4 STATION LAN l

AST Premium ‘.286

—

Novell ELS I

w'rth a fast 4o Mbhard disk renne file Server.

l -

Mountain 40 Mb Tape for quick and easy backups.

1 Year (90 day on-site) Warranty for peace of mind.

to get you started.

3 Earth Station m

55;, an’

EABTH Computer

Tbchnologies

(pick one)

For Accounting:

For Word Processlng:

— Toshiba high-speed wide-bed printer

-HPLaser-Jet Plus printer

-Either Microsoft Word V4.0

-ACCPAC Plus V5.0 Genera]

Installation & Site Certification

diskless Ian workstations for hlgh perforrnanoe.

Uninterruptable Power Supply to assure reliable Operation and security from “bad” power es well as total power loss.

I i

the standard LAN operatino System.

PerfBCf

OI’

Ladgef

iAccoqntsfReoelvgble

PLUS - Enrollment in a word processing

gggggflaßfgs“

PLUS -One fuII day of ACCPAC oonsulting

oourse for one staff member

Softrak Systems has Iong reoognized suocessful Implementation of a multluser network systemrequires a solld blond of both hardware and Software. We also believo that multim user oomputing should not break the bank. lt should be easy to use and well supported within the oommunity. lt should be reliable. Softrak has

that

assembled a hardware/r Software combination which meets these requirements.

Softrak Systems has been provlding oompanles all over North America with expert advice on automating thelr aooountln uslng Computer Assoclates A CPAC acoounting Software. Awarded Computer Associates’ Access Licensee of the year in 1987’. we have already been recognised as providing Service above and beyond the call of duty.

OFTRflK SYSTEITISIIK. Thg Prigg:

WEWELCOME IAN P. FFIAZER, THE NEWEST NEMBER 0F SOFTRAICS NETWOFIK PRODUCTB DIVISION. CALL IAN TODA? FOH FURTHEFI DETAILS ABOUT THIS EXCITING OFFERI

736-3741 303 1661 WEST 8TH AVE. VANCOUVER, B.C. V6.1 1V1

919,995 Tho Computer Pupcr August 1988 e19

The Shareware Shelf -

EIsyNet II A Shareware LAN Ifyou am 10016.11; f0: o.sixuple loculnetwork um fnr two PC's 3nd one m‘ mm prinmrs, ASYNETIImayMjuSIwhaIIIwdO-clwordexed. This netwofi: systam reaquires an]; RS232 pom. 5 0 m : twisledpair cnble, 1h: EASYNETH Software. andDOS 3.1. 3.2. or33. EASYNEFII 1ms aocessweed of 115‚O0ObiLs pzrseamid with a maximum uncut cable length 01' 7D nwtres. EASYNETII pemfim dififleru Ininommputers t0 linktogetlm inashazed tesoutoe envirormmt. howcvcr, problcms may result if Ihn: syxmm biss i: muklcxvcrsion. Inslullafiun is aulommoclby tha mogmm. but some initial confixsion may b: expoctcad duxing sct-up du: t0 il: vcrxalilc nauxe. Bach PC i5 müqualy named. arsd rhe program usesthcscnmnc: l0 Icccss5113, drivcsormiruzrs

lmageStutliü Alters

NlacWrite 5.0 Adds Spelling Checker,

Reality

Disappoints [Jsers

und PC.)'I11zuseronPC2can access only a singlc directoryan PC213 Harddisk. You could. insmll a dot maurix printer an PCI. und a daisy wheel on Imagestudio System Requlrements PCL und eiflxmPccauldshareacoessmeimcr v.lProduct: Macülmshflusorbener.Hxrdcfisküivc advisablc. EASYNETHOOHIESWiLhn printer. prinxmoole: gCompany: Lcuasetsuggefied RetailPrice: S750 progran‘! n:nmnnuze the ‘wamng to fingsh pnptmg‘ penod, allowmg 1h: PC‘: m connnue wnh 1What 1slt? productiva work. Imagesrudio is a sofrware program foa- edixing EASYNET II i: a ploduct of EasyNeL Systems ;jblack und whiu: photographic imugcs which hnve 1mm. hfississauga. Onanie. 111e shareware varscanned by an electronic innage Scanners. 1: been sion of EASYNEI‘ II is an a single archived disk, 1is a bit like 1 MacPaim pmgrxm deandcaoxueswith aflieadmxffilewdescriberhe ‘!signed im" use.sanped-up With high resolution scmmed imset-up prooeemzrcs and haw t0 00x15mm: the link- mges. I: feamres a number of spacialimd editing ing cablc. Thn: packlgc i: available oomplelc wilh 1001s includixxg a fmgczlip L001. a.wann’ 610p 1001. cahle anal mmuzl for S199. but you can registar a ohamoal m1. and a paintbrush um u-nich you you: shaxcwarc vcrxiun f0: lesx money und «r:- ‘ c m crcau: marvcllous custmn fills. ceiw. technical s-Lxppon a:a lower oosr. EasyNet 1 Systems also produce Easynet 116 for Iarger Incl-a Graurnan lNew-‘Pen [unanf2mm runnea nexwoiting synmns.

nnIhr: semndcunmter. You cmümit acoess to

a hard drin. by assign my drive 1cm: l0 my dircclory. Pur cxanlplc. t0 Iinfit access on aPC t0 1 wordpooessor. you nocd «mly l0 assignadxivc I10 {hat dimcwry (i116 “G: drive” an Lhcfrs: PCis C :dir0c10ry"0n Ihn: 900acmally th: "

ProductSource: EasyNetSystems1nc„42S3 Vil-

f Product: MacW'rite 5.0 System Requirements:

Any Macmtosh Company: Clms Suggested Re— tall Price: 5175

Appla‘: mw indzpendezu sofiwarc compmy, Claris 1ms relmsed Mac-Wäre 5.0 as a major upgrade of the vmerable Mac-Wäre.MacWrik is Ihc p m g n m 1.11.31 30l. L110 Maxinlosh an. 11s feel and convinced many people Ihm a graphic itnuface 2nd WYSIWYG (WhatYOu SeeIsmmlYouG61) wen: Ihre way cf L114: future. Weil im! news folks. MacWrits 111e 011cc sparklmg gern nf Apple‘: cyc i51001:1213prctly Grad und01d incompuxisonto Ihe new cnnmnders. i I'll: Im M a m a runnr I'm: am» ucllng E

d‘)

lage Cum": CL Mixsisxmgl. 011111-10 L42 152 (416) 27345410 Gordslznrrxonds

||||u||

ULTIIJTIES

APPUCRTIUNS [II BEIEALDGI‘ nl nun.“ —z2 um 5m

uqgmanuwhnnuwsofirmnflln Ü u l a n u m - w man um: In w

Ü f fl fi fi s - I j h fi u m fl a d sI. fl n11|: fl

I!!! a l l " ! ! !

M1911.

runcwtse URDER SYSTEM-Ion: w: u C1 flflflüfi! ITIBXDE ‚fl m ufi

tusmm |2 orsn sm-fwflr Elmmu amzabt an: antun-dar: au": 54mm

nun-m-

LETTEHS-LUTS n1 man erm: mommtrfionwwfimxuzutnm W M ‘

CIman

I] MML mSTEfl-Iaevcmnm vuugrruiim u g a n d n d l n h m fl l l fl fl ä ’ ‘um:

um:

nummgmnommemm 13035511-0

Hermann-Anhand!

„umggrjgr

ÜWDHLO-

managt-antun:

uzusnscn Dmmmnmufsmm -roggqlwlflhqnn Sallfirwufllyfwt

m.m 9 ; man cocnmlfdi Dfllvxns

was. man. 701mm:

“

m n v n u r m fl h r m w - ‚ N fi

909C.

IFIIIEDXIW.

CDFNWEUNICÄTIUTJS

ÜPs-‘IILI-flundnmfinwfoormmflmanagen Üflflßporfiläfi-flrnfiwflfilbflflil

onuuwsaumowmamficflnuutahlfin hold-

[ j n m x fl w m m u a a n n u u m h d w n m a t r m v n s m m m fl fl fl i fl min.

flmom-umaoxusussmmuu ankam.

Ü m - Ä fl fl l fi l i fl

Uni-U! 111i

«Unamaosonlflwunl

Umflffifläiflfldfllfllflwm wnuuod-nlnlwhmuhnmunsfiw Camflhwllllfiofl‘

URTMMSE HEAIJRGEFIS

ÜE-nmx-Auuuummuwwm

qgnmnpulkurlifiüaülfllülflmfl

vom

npomfpmxtxn_mnngulbuvwu a m m r m n p s n n w i fl fl l m w a fi c fl h

umwu-mmwnnmmmw ‘w ‚naguwunnnmnmm

mludmwmm.

UPc-Tolls-Loudmamvmsmm E x fi m f m m a o m l fl l f s ß b u l l fi HEILEN U110“, DE G!!!I15.

Dannicalotßeflwflßfliüfl WIHPCMT Doelnmfiüflfbffifl"

E] munfiflnflluvt BMW‘

rgrgwcuflhflnjdlhfilflmwfllflhf.

l1 0 & 5 flmnnuvrs m m 2 ’kmEKlURE 6Mi-

ÜFmITDIFlIIflDDIIEfl-JwwflolgwHilf WIE 5E

ÜIMPIWIICY-wnumwmmamflnm

THE GOLDEN WDMMT 0F 1155m" ‘DHEI n m m n m v fl n fi t fl w fl a n h ü n

rc-anctunc GRAMCS üirrw-‘fl kann C1 in man. man-I. umu m ! u m " : mp5

man 54cm m: alnlseruullhnuuvyvaflmlouflno

C] rHIEsmMEs-um

ÜIJOS-MT-Omnon: m a n 9 F " ‘I’ rdmlwruvntßfllflaslcmlflflüßßlm‘ üfilfllsilfltfifiß. Ü HENU-IBTII-Ahisuubmzssuulo

‘Lnnn u: m: unnEHuID‘ «Anm-er Ü . Etc-Luder (Im. ä In ‚ "‘ Rund

N1“ ÜHUUG

ouflnlifii

umnes

[J m? GAMES-The m nummern: F’: muss-nun 99061 an a Ion

masumqhnmqnpmflmlynflsfl.

Ü II WITHIODIGKWI-TH "Nimm" ynbyfi-gjgfiltflhßfliflofiflfflfiifilifl Mflilfinflhfl.

ullncsnnl-fltk.

Cm: nun-an.

tummmmmrsmuuuxflrvwdmfl.

Gamma mman E-nx-IMI

‚ou

Pc-IEY OEM r: a5: I F J - I w!" Cm mm als I HIN! m m ‘ ! 91ern. ne- «am man; wslrm. umv1üfimsmlm "es PC-GHAPH-«IJEU: u m ! I: D 1mm PC431um?! N6

014l: 000m6!

I2 D15! SEI-HIN!" Ü DMCADDSD WM.’ Huhn!- nl J-u w! mm- a muummm-u w-Innnaillawwf M M “ ?

Paulmann-mm am: moncmnes

C1noumsEunHsEn-Amuuemumuuvqn-‘zvvflulmwbldmflwüfif! umvenumwhhflü Via-Stumm”

E] xmuou UHLmES-k n: ruml man:

muumugpwrunuxshrflufulflmflmild maInrshdUmUMMu-shmmm E] 51x11mm (z uns: San-Sa am a

spgurngpfihfunplnmfldwiNfd gßgy-w-gcqflnrhnglflliflnulhrmu

runnm.

EIA m m m I - w m aomnomswvw qruruunhauflunnifllaflcmfimhfinfimm

nannmmimnim. PRUCESSIPIG mmmarommmww 01110031] DEMO 12 015i SFTD-DIIN- ßjrc-wfittamsuscn-oawunvu |[

ubflumfesz-m! 51ml?! WM? 11l

nmon nall Inwlm‘ Cancmer! I!

«um

u! 15 W

uwnnwumsgmhi"

[.J IJICTIOIIIV-wvmr

CHISM-Onn antun-WM" Inmna

man

In:

III-h!

ÜEWYIIIIHIMRIISISEU-‘Dflffl

wflffl g r a u t im B‘ HMMOI M8201. w m y c n g n fl q n fl i fi m fl t fi i fl l

m:- mu1nd „ u m anman nahm. n u m m fl m - w w u um

gutem: M6 OGOWVIIIMn

uslm-msuL-A um Emmnghgu Hnnlnn

M imurdwuvfi vom»: M u m m ‘ ! ! ! umwuusunnidsnnnumaflocda-ewmfl

mit.

‘ i mmehr Ahuimrulrhnldllh

Mumm-San‘

DPcTTPE-manonswn-nnm-M Iflwd-PJINGSW.

—

1011m

PÜ-SIG. MEMHEHSHIP

Irnnwwl 904116-0: v 116m0?‘ fimrfiäflgflafl

rc-nuslclnn 4 m m : mm ov- nur PC. U w: IM D"! i111"D mm MAI-Fan w 0c wenn! w: I PIW.

(in

9.95

ÜTHER

‚

_ _ _ . .

_..

118D 6%

„j

HANDLING

“I.

TOTAL

m c fi m u n fi u ü fi s

H m n a n q u m n q n u n ü fi m h m fl fi u n

‘E ä

SHIP T0‘

25 ä

nasse m; L] MAsTcnomo D V151 0Min m. 2191111111014 DAIE

S I G M T U R E I ‘ ?

PD-SIG-RO. BOX 2053, sunnsv, 3.0. vsw 9x5 (604) 597-0331

20 111e Compuxcr Papa" August 1988

Don't au: m y m n UFO piano: wirh fmqtfimdio amund

iSpced und Scrten Chrity 9 Working Wilh auch imagns is (im:ccnsunmg ‘und somc whatof ablind flighlon a Mac Plus 01' i5E. Theta is aconsidcrable speed improvement an 11.11:: Mac II as 1x211a5 Ihe ability to see man duail Jof grey scales in Lhc imagcs an 1.11: highcr rcsolugtion ‚ca-cm: ‘Ihis i: m: m szy Ihm Imngesmdio 01 3E, itjust means {cmfltbc mcdon u MacPlus smding moreproofstn the LaserPrintzxtoacixieve 1Lhc dcsixcd cffccfs. gEdiflng Ä Image: CdiIiIIg is lhcspcxixflty of the house wiih ‘Imageswdio. Will: a 1in1: pracfice, realiqr, mrcalily a1 least. cm b0 alterad be1EP1LOLO5IBPII1C ‘ yond beliaf. Whem you so: what can b: dann with lhis progrum. yuu wwxft ltust any of those UFO jlanding. o: sasquatch siting pmms again. ImagcStudio i: udccpprogram intheserme dm 1it is fearura laden. and providns Marge vaficty cf ;effect.s 1.0 111e dodicatod uscr. jFile Handllng ln-nagesmcfio nommlly savcs in aoonmc-ssod for1} j;mar. ünosing Uncompressnd speeds up i n : m111g mdopcrxhgofüle filabutfllc filc Inka up2— “

‘Ü3

timesmorediskspacaflwinmgecmbesaved

‚;a: citha- TWF, EPS m-MacPaim (72 DPI)formal.

‚Printing Optkms 1 Imageswdicrhas a wide rang: ofp-hafing op-

‘jlicms. Youcanscalc lhßitnagcsizc inpzintixlg (er lin saving m disk). a5 well a5 alter w: diam': pamms forsch-m very inmestingpuixlfingcffocß. '„T'he"Set Halflonß" oommnnfl allowsyou t0 altem‘ ‘jlinesaaem angle ordzfm: saocrluulom seitens. imeseefieclsbreakthcimngeup inmdotpattetnus jwhiahcnndimbeuseddixecrlytocxmtcplatcs f0: äpnnnng.

5.6. HE31DENTS

EPSOI rnmin uIMHES-Soool. m an L3 cmnsamnm [ M a m a

SUBTDTN.

PRINTEH UTILITIES

2%?ää

x I S S - Ä .

unmumq...

*—

Mac-mit: 5 .0’: graut nzw xpcfling ehesten Neu du am xpirmüzg nach ball armer.

CIILTMITIIUTEÜVUH-NOUUHVH. 1:1 SYSIEIII-anfin numdrmn man mLUHLEIWIWIHMQUIB EIm? umncs-u a m:man wenn

mnwooroncnonowwwrnhhibrfl-

Dann-summa

5 E !w v - v ü w

i} II

PUBLIC DOM

rnüntllnuhnn. [.1 GEIEMDUFT-Fmn

antun Im!!!

‘

gOutput Resolution Amme: issue is Output resolution. A: 3m dors „per innh. the. resolutiqn ofmlosx 1:51-5- pri-rufn-s, ‘Bus

easfly

w ahxdrbß gmmfiieäß ven prmtmg an ncwmmt g;üogxaphslgolggrmw.

cclimvs. ‘Thistypeofreprodwlimis

3unsuimble im magazim qualiry publicafimu. The j 5111113: must. b: printzd an a 11.1512: 10501011011 darimersmhas aLinoumic 1000:3110. nzrasolu-

11cm: finm 1200m l-d-Oüdntsper inch 1.0 gcluwny 5mm the “jaggies” 5 c m a! 300 dpi. Tha Prlca u! Admjaslon

Imagcsmciio i3abit o1’ apuzzle. II is defininely jnot a program far every 011:. Working with m: fimngcs mquircs Erst und fcruuost aooess t0 an image sammm-‚Naxzyouneedmunmjnboth RAM ‘und xmrage because L11: filcs um vcly big. T111: more RAM youhava. Ihahighea- thamsolutianyou cm w m y u m docmlcru as. You also neacl lots of 3ums. Image cctiling. likc phnlugraplüc develop‚ man: i5 acraft which requhu skill und paficncc l0 sbuildinmflertoaeaxetheeffectsyoudasixe. I Fmally, you need a 300d renson u:gcl. 10501110:H11

W111: Claris hu baxically rc-releasod the 01d MacWriIe with n 100.000 ward spe]! checker and a im orher rninor man. 111c tweaks include Same new keyboard aboncurs innluding a Command-A to Select All. Thc pzogram will nuw acwmoduw 131301screens. and will nm Imder Applesharc. 711e spell checker i5 by Miu-olytics. 1h: folks who brought us the greai WordFinder Thesaurus. Fommately i11sa very good spell chcckcx. Imms

2:. you xype, bccping 01' flashzing when you spell a ward wmng. or in a batnh modn.

inrcracrively

allazonccatflux: mdofyouxscssimlnaddifion there is an erxpandable user dictioxmry Which is easy In edir. In 111i: is a vcry likeablc inxplczrxmlation. An hteresting feauue o1’ this spcll checkgr ‚ camparcd In mhcrs onth: markct i3 thalit takcs its cue fiom Ihr: whole Word being clmclced a! Opposed m 111e Erst Fcw lcucm. Forcxamplc ifit cnme aocmss the ward "Velcome" i1: Inighl 51133151 "Weloome" a: 111e c o r r e c t spellixgg. MarWrkc i5 still a vezy solid pnodncl. 3nd Will mset the needs 0Ebasic ward proccfiing foctmany users. Itmay howevemotbethebestvaluc for da: money w h m compared by fenurts 1.0 cithcx hfictosoft Wrire o: T/Makafs WrüeNarw soon m b: released Version 2. (See üble). In adxfilim l0

thesefennnes. the.reareconsiaderablß%flfldifffl-

ences in omm-Iwn ope-ntions. Aeoording to Clzuis Macwrixe oontinues m very wzlLThisiseasymlmda-slmd hemmt: 11. wasurigiafllyblnndlod withflmpnrchaseofevexy Mac givingitan instand werhase ofnvu-600‚OOO users. Mmy peaple apparently pmfcrcvolufion10 rcvolution und this 1sa vety minor mmation indud.

Com Low End Mac Word M u m m man... m: wm man ‘ V I

Span;antun-cm;

Faiain x13! "

Domnraxsin

I h fl m r d g d fl n x n Analiufiuhgrumat Aug-kappa:

100.000

7-21 p i :

310mm

80.000 7-751!!!

Z ß b o p a - 5011p l i b g n j y 3° TYu N0 ‘h: ‘h: 1 N:

N0 VuinHoLho Spalt; (hyoinh) No Sngpnhdnmnhiontün!) S115

Mannesmann:

100m0 4-127 p

Y: ‘h!

H‘:

3x5

offlannhaveutdspcndflaefimeonyomdnsm unagc. Aomrding 1o Torn Tracey. Regional Manager

for L/ctrasct. hmgeSmdio 1ms been very popular wirh now per; which um mmy phomgapkm regulzrly. skfllud hands. hnagcStudio can save

timninrepaixingaphoxogmphraxhuthmdis-

puching mulhc: pholognxphcr t0 rctake lhe picmre which somntimes can b: impossible. Humgnphscanbazuilyallatdmmhmcedlomake feauucs o: images stand ouL. T11: u-adifionzl PMT und phomgraphic 3 4 3 c m pxoccss cm oflmbe faster und chcaper rhanWorking exbu-‚Isively wir}: an clocumuc image. The elecuonic imng: howcver gives much man: flexiblity inlastminute resiflng. remuchhg and acmal imzge allering. lmagcSludio providu-s u whole nzw mal C1135: m 111e phomgraphic mancher.

PUBLIC DOMAIN’ AND SHAREWARE SOFTWARE Tirad of expansive sofiwuxe U) d0 a litrle job? Ar: you a tue-w PC U55? Need softwm: on 3.5" diskenes? WCE (Iolnplrtnr Wnrld has (h:Iargcsl omnpilafion ofPublic Domain 9nd Shxewxe disks in Ihr: LowcrMainlmdwiLhover ISOUPC Compatflnlcßixkx, 100

CPIMDiskxnfiovHQDAtaIiSFDiskt». ComingsoomAnfiga. nxxtAtaxißTandMacintoshdiskmwecarrysaftwxrcfm-evflym: fiomthemvioclotheexpetimcednsar. lfwecltxlflhavea pu-öculnpzugxmn. we willget i1. Prioessrmfimnfiß 11:86.95 per disk will: asuncharge DfSLDO for3.5"äisks. (Chzgc: ruft): copying 1h: m fi w x : m11!) WCE CumputarWm-Id, 13485 Ring George Hwy, SurrebDC V31‘ 2T8 (604) 583-1600 WANTED: Software nuthozs wiLh prugmms to be disuitnund

* consulting 8.: tmining * networking

‘tusmm programming‘

managennent

We also sell Computer haxidware. softwarc and aocessofies.

Major new Software accounfing concept presently being released acmss Canada. Opportunjues available f0!’ clealers Wim solid business background

hard drive. 113m 640K turbo compatible will: 12MB floppy am!MS DOS/GW basic f0! onl)’ 32299.“.

m h: published a: 1 nominal-chi package. DATA TRANSFER: Nned dan Irmsfcnod kam m 4 : { m a n t0

1.111156: Shamwan m

rflicrobase Systems

Öall now for a

U504} 946-2338

[f2 hpur commltmion.

4658 55"’ Street Delta BC Vdk 3P?

mwthumallus anddesctibeyom

needs.

and lmowledge ol’ accounting 3nd)’ or Computers. Excellent projected earrxingsl

äFREE

lor infnrmafinn (all:RJLS. Sfgstrnrs hin‘. .—.-.— 1-älflfß-htn3-l3 In \.‘ar1co1nrcr 11.41.11 i15143m" n

—_

i?}„51’:%=V’i%33% .1.f.

.1’

W “m”? 5er V1665

Ailfiäifiiü comvtnsuoms

mc.

Jim Reich 4

FOI’

— — —

Complefe Project Manning Services

Disk k) Laser Type Disk |0 Hlgh Quallty Type Herd Copv t0 Disk Herd Copv I0 Loser Type Hurd C00;to High Qualiw Type

dirvjactnuwvltrgskflls oconsultlmurdTnlnlng -snmlwedProlootPlmnlng -soflwansippnn

— — —

(sagen-arm

amuafinsfinfimxyfiwflfitwpfinaa wcam 31150466-1

Associations, Large Companies DISTHIBUTOHS WANTED

Praflaenf

Wo offar sewices designed b m99: o varleiy of conversion reouireenenls: Disk h0 Disk

Gonsdfirvgnß Ptarmingserwcesforcotmmfionähdmry

Bolforomner

Attention: Retailers, User Groups, Libraries, Government Agencies,

“ W fi fi

Suite ‘i051!’1675 was? amm9.. Vcrvcouver. BC. V60 w?

lfyoucan disrribune 25or morecnples ofTha Compuhr Paper, plane cailln md w will send you a bundle.

cfiephona’

| E604) 732-1446

Call 733-5596

COMPUTER EMPIRE

-o

11213111113 AT SYSTEM ( a m MHZ) Landmark Rating 13.1 MHz e101: RAM

o 80286CPUGTboard) 360K floppy 111-1“; n

0m 4th Year in Operation Over 35,000 Computer Items Sold

51495

mmnoppycm 2o MB 4o MB

NCLhThazddiskkfloppyoonuollu

o Mono/graphic card with prinnzrpm-t 0 ZÖOWCEA power supply c 0

Enhancedksyboard HighResnTfLmorfitol-Mrithswivelbaae Mctal case with LED light, Rum/Tube nvimh

o n 0

cpu 30235-12 (Res- 51995 1.2 MBfloppy drive NCL AThard disk S: flnppy umtroller Monolgraphic cm1 with prinber pon 200 W CSA power supply

0 0

Clock and calmdar

Enhnnoed keyboard I-Iigh Res ‘ITL mnnimr with swivel base

MehdmsewimlEDIighLRese-t 5:3 exposable half height Slots

S188 5109 S88 S145

NEWVIEW ACCOUNTING 5950

NEC P2200 Fujitsu 01.3400 Roland PR 1215 Roland PR 24150 HP Laserjet II HP Lnexiet Desk

DELUXE AT SYSTEIUI (W12 MHZ) 4 layers mothnnboard madein USA 18.7 MHZ Landmark One MegaByte RAM (70115)

-I

(withATsystem

wachse)

’

5295 5470

M00 Band inbemal Modem 12m Band intemal Modem Supa Mouse Hi-Res Mouse

oClockärcaletmdar 0

5135 5118

720K floppy (3-5")

(11,3 51595;

BOA Monitor Multisync II Monitor EGA Card

5585 5780 S695 S995 52595

5ms

S495

5395 8195

COMPUTER RENTALS

XT System 559/week AT System S89/week (Ask for monthly disoount rate) Price:Julia: mchange du: zua-acaliarian ofRAM pricex.

COMPACT TURBOXT SYSTEM 640K RAM 011e 360K floppy o ATI graphlc card (R23. S1195) Clock und caJendar 9 5mal, parallel and game pofls l 150 C3191 power supply v AT style Keyboard 0 Hlgh Ras. TTL nmnitor with swivel base -

t 0

Compact case MSß

ä: GW-Basic with nxanuals

LAPTOPI PORTABLE

NEC Mulliapced 154MHz Backlit 640K 2 mupiu 52675 640K 2o M S3795

FAX MACH-HEXE

MURATA (Japan) S1550 3 uses: Fax

Photocopying Tllephone

4168 MAIN STREEI‘ o VANCOUÄVER v5v SP7 o 872-1668 Tha Computer Papst August 1988 I21

’la cintosh Viral Surv_ival Prevention Detectim} Cure l

The Menimawcjbsu Dicfimmy dcfincs Virus I

as:

Lanhzfectiveagentwosmallmbe semwitha light microscupl: 2. somuufing (ad a cormptiilg ixtfiuence) um

Dr anend one of our Design Cllnlcs for Ventura Users: wa will solve your design and fomwattlng problems on the spot.

tcnnsacomputcxvixtlswfllwfilfiaddifionalrefioiflcummy

WDRKSTATI% RENTALS:

Use our low-cost Desktop Workatations

to oomplete your own publlshing proiects. Professlonal Advlsors on hand. A FULL PUBUSHING SERVICE: Let our Publishing Professionals take your book, magazine, newsletter or report from concept to finished product palnlessly and lnexpenslvely.

—

Normal

ontants o! omputer rare Must Ga Regardless of Gast “W s’"f": [glgxsafglg ‘Ü’

"ffäq

1;’:

ATIXT Keyboards <ft.gfqkgjgggg:jj.'_

839-00

*“"°::‚.:"°“"” 3299.00

1.49‘

a."

37331

.„

(120 m)

5229.00

210MB I-Iard Drives von

8325.00

1l,

.'._‚=

MQ ;S'i‘€f1ii4‘l.ll4_._‘\\_

TTL Monllors

389-00

Mulfisync Monitors (VGA)

fia

z’;

’L=„i.u x 355a» ° - jgg"_‚.9 '

‚w‘

._ “fit; _ \ _

EVERYTHING DISCOUNTED l! FULL MFG WARRANTY N0 REASONABLE 0FFER_S REFUSED

1440 KINGSWAY VANCÜUVER

PasomflShoppiQgOnly. üpmdailyllfiAMloliPM 872422526 Infarmannnunnuily:

f‘:

Thc Computer Papa August 1988

‚gH,

KEII-

flleslogopwmzgruhale

through the disk. This apnplicatioxx opetaled cmthe samdlcampuxn o: nctwork as the will preveruyour Manglila. These nlcwly infÖcwd Files manbeoome cnrrien: C Diskrfioln bring thcmselves und spread the infactiian m Olhfl’ applicafimis. Lhus infectioncanbe sprud m irgfecfed und aüowfor an Starting aseeminglymdlcss chain. aary rwavwy. any additional flappy o: hard any appliculion cmIhn Same disk disk mounmd a1 the same Lima a: Llic infocted applisaxion i5 being In answer L0 Lhis nwd im xuliable detectionmid removal ofvinl andhard disks operalixig cm nm. This can also include other several 3ms have come omo m:Public Dunmin und infections ' flopäins pro a nerwork sysrun. Sharewar: markcL äncy haue ticken varied apprroachu: bm an Though diese viruses am relativqiy new m the Macintosh com- miitod in thei: iment to help users prevmr. deren and helpmmve puterfamilymariouepeimunfimuhnvebemammdforthepustfew Ihcir vmom witlx minimal dcsmlqüon t0 oflacrwise heallhy sysuems. year: an. olha’ computex lines. Thefir severity may ringe fiom tlial. Virus RX b; Apple Conxpura of a nuisanca virus. which may iruerifexc will: the productive usa of Virus Rx i5 n stmd 310m: qplicalion which lists resomce your sofiwaxe. 1o Lhc dcstrucüon Offlaln. A: present rhete are mfly such as INIT and cdnv. damaged applicafinns mld Files. a few knownvirusa: which hav: been xplrcad an Macintoshsystcnns. npplicaximu which an: suspcctcad cf possible infecüorx. The fi m virus l0 b2: discoverefi has beoome krmwn as the Many cf Ihr.files. which appear on the list. amnot infectad making “MaacMafvirus. du: 1o the adminbd dcvclopuzucxitof Ihis Virus by somewhm canfiuing for m m y uscxs. Apple ha: anlicipared amagninc publishu {mm Montreal,Canada. Thjs Virus appears m things are suspect o: have been relalively hmtnless und was supposed t0 have been this und provides ycu with wamings of files which a of Lhe likclihood of 50m’ System being ill. und infecmd silmrnary a “World Pute" programmod t0 ranuw: itsnlf aflei presanting The summary iseasy munclasrmdmd lhelistcmbe savcdforlatcr musagc in March of (bis ycar. MaciMag gzfined world reoognilion compnrison m’ t0 assisl in Ihr: vixal removal prrocess. a5 bcing the firstoonflrmedMacintoÄshvinm und having been poawd VirusDetettive bylqjiql Shulmarl, 515.00 shareware furashortpetiodoftifllefless lhan V24 hours) on anafionalbnlllu-tin VirusDetcclivc i: adeskawessory whichwill Emdand ‘l band alert you of the existent: of the known vital strains. ofothar Mac cnflmv raise hackles the Bcfon:I go any funher. and vital aid, unlilcc Lhc ofllms. cmba modified by thc Tliis siasxs. letmeclarifythaxldonotfiaclthalany oompumrvirus is user to infecüous rammte:ummay new idcnfify hmmlcss. These oonzmnhmfing rfisouroes which infecl. a uscrs lnterreron b): Robert J Woodhead Izuexfeton 9 c m :you: n i m m t of causc an mikmwn sysmm. without um:lamwlcdga. am for possible infeclimis. When a vital disk checkmg grief. M; usc cf ihn tcrm ‘äelafivfilly harmlcss” i: relative m lhc is datecmd the zpplication is listad a: the bonmn resmn-ce am capable of aznccunt of damage 111a: mm: dasa-ncnive ‘With a man lhatclzl b: cheched of scrccn youx along doing. N0 Computer Virus i5 truly vital resourcas. An Option is list of lcncvv-n 111e suppliad against The seoond disoovered virus was hamod Ihn“Serums” vims. after the f0: rmwval of ofländülg r ß o m c e . an invisible file which i: crcatcs andplaoes in your System Fulda. provided Ferrlt „u, Nedry by larry tohave 111::Scorevirus was discovared thiqspring butis suspected Faritisaspccializedvmzsdemmrdnxigncdtosrfifiout. . Ithasbeerlmeoenm: 7: beznarolmdsmocnseulyaslastSh and ifdirectnd, removc Ihr: Scoresvinas. Ferrithls beim yundcrixivcstigaxiomin ofmuchattuuionandirsflswrceis: repormdlolcavcsomebcnignvmlsruomcwixtan the U.S.A.,by IhnF.B.I. Sauna was tdiscovetedhDallaxgTc-Jtas und fcr fifis reinem I would monmmcnd using "Kill andisxuxpcclcdtnhavcbeerldetelopedmuebyndisgrmflcd a-pplication a similnSaures". applicaficn. employaa afrqbeing disrnissed fmm alocal electmxfiss firm. ‘Thi: Kill Scores b): MacPak arldApplc Corp qfDaIlM Virus has sincc blau: diswvered inlaompiuus rmgfirlg frum nmjw ukgFariLlüllsooresisdesignndtodnmctundmmve hardware and softwm: mmufacnnas In U5. Govanment namtheSocnesvinlsfromyotn-Ipplicafimu. Itisaneasylo man the und complicnlad putgr systuns. I! i3 fa: mote pownxful use. applicaridn Lhxtroquircs nothing more man 5:10:1MacMagvhxxs andhasretainedthnqecretsofizs‘ueawdpmposam adiskovr applicationmndclitkymzrmoune. Prlurtoushgflfisor spixnofils dissactiunbysomeoffixqtopMacintosh axperts inNarth ing othex my amlication, which rerrlovea raomccs. insura Ihn you Inc. Ammica. including those a: Apple Compuln an have accnuamback-tlpoopy ofyourfloppynrharddisk. 50cm: via-u: I n : becn hnown In cmise problmis with eine: Ab: Sqfiararz 8311013791131, Agar by xnd Icavcs 501x14: with very Mabbraw. progxums. naost notably amalJ361 bytefle thatjust sim onyomfloppy Agaris of A raliablc disünct sigma of ins existmc: in a Mac's system. sign irlfactad. Whcn avirm adds to b: urhard disk. wairiaug im pu-zscncc is the einziges Which "Icauses In the "Neuland" und rasante: in an atpplication the: appljcafionfls size ixjnthar the Felder. Assuraing your craasocL It Ihm becomes a System; "Scrapbook" icons in simple. matter u: pariodically check the syslcmhas thcsc lwu des]; accessorias installed. youcmmke aquick siza of dem-min: if i: has gruwn in size. mdicazii-ng an In Agu 100k a1 Iheir ioons l0 verify umtheym-e Lhatof the nfiniarure Macin- infection. of Ihn Findnr displays the file 9121:. in Version Thccmrent 11a: am! Finder. lfyom systcm tosh. Lhz samt I: thosc of the Syst „ in x11: filefs "Gct Info“ würdow. am! both kilobytes, bytes beta: infectetl und you have both ofihesa daesk acccssories inslalled. These nre Lhc mosl. counmon viral detaction aid: clu-rmLly availrl-leir icm-ls will b: changcd w thut Qfu garmin Gamma-m; a blank, welLbutmolmccof ablenndamaaartodnflunühtendedjobn l dog eured. page of paper. undIhnen eure i5 wmth a of pound applicafians u: mly prevmfion ofuscto infonnyou aftnryutn-sywhasbecmc infecred. Don Bmwrfs CESoflware was Ihefirst m comaom wilh z: ‚am „ m a n 9e Roms 4s ‚z-sex in; am aviral aidaxrdhasbwl dunonlycneto Iaksapueventative " i approach with Vamlne. Vaocine i5 plaeeacl inm your | _ | System Felder where it self installs each tlme yom Mac is boomd (stanad up.) Ifmyresmn-cesu-ytg installmu-nselvesixxyom Systzm filn a "Beep" und wmiing message will sotmd und yau will he Sorapbooll: Normal Scraphool: Iohpod all

. __ ‘

Ciflzen-Prlnters

3339.00

„Eid?

’

XT Molherboardx

hadlodcedflmMasmDisksbefmmounmgmemfimmconmma.

‘

deslgners.

_c m ut

the more advamedMacusem. Apple suggests thatlhßlmfl‘ back-up allnorn-ixifecmidncumenm, m-iilitinlin mafloppy dixkorhzddisk Indrephnetlm applicatiorls, fimnyDmln-ckndMaslerDisksaIdtho isatirnecommrfingprojcct, onlypractfackgd-updocmnems. ncnlifflmmerhu bemusmgworknlgoopiu-s ofall applicaxionsand

BuL whntis aeumpuwrvirus? How dann i: infect WelLinxpit: ofnllthnprenching by me"cxpcrls"andthc warnings your conqmrer antun? How c m m infccfiun bc Ihataocmxpmynewapplicaximmfewusershuvetakanallmepredctcpwd andcanflaleixafectionbcpreqlemed? How canwemzreflanse cwtions In pmtnct Iheir mfire libruy of Mute Diskx. Thc lack of Virus cmbeprcventedmdl‘ chmMasuDiskhasxi-‚suhcdinmam ownczsmfinfacted systcms. systßms almady infecmd? The or dsfeuad with a 1in1: cm: _md ajfew picces cf valuable Public anacking um’:softwm wixhmaouroa utilities. uying m remov: the vnrious offerldixtgrucmne an:by und. ‘Therasulrxare guncrally lass Domain und Shareware Software. g Acamputflvixmixapimeofcmrqxutamdz Ihalisixilufidto than saüsfactozy und oflen vaxious applicalions am irrcparably b: sclfpxupagafing. spueading infeclious resouxoe codes throughout damagod. System files and pzngrams Ihn:i1armes inclose contm wirh. Files n’ und Ihn: "System"51c. ‘b onlntnirling “xcsourcesT such a5 infecnodand anaHyowMwarDu-kr am: theunwittingcmlersofthcvirhfinlbwomütg shouldbealtketopof t h e n s m c a d m g Inaimplificd

Professional Training in VENTURA PUBLIBHEH Junior d. Senior Levels: Leam the seerets of Desktop Fublishing with professlonal book

LIQUIDATION

s g n e m

ronuer N D D

‘J-lliilfiiIlLlHlllläiäiEii ääEE; ilsllll [iiiiliiifixßfliiiiiiiffifi ‚q saomvbm wmiunmnqfhnhdemfidbyckecbu M: komforthaflucpud alldScrapboolFiha. Ulhlcoullavc chantdfrom du ‘Macnaoonm m. "(Fannie da;

dndpnyqouräflm kühl} wund.

“man thesn vimsds w g ’ : firstidixoovcrod. the mclhod o! dctwüün und remedy was In search and clean your Files nrirh a resomce edimr sush a: Applfs Macintosh Ressource Editor,

ResEdit. ‘ms is acomplicated approach. md onlv apprvvfiate für

prcscntedwiththeoprionofnllowinguupuoocastownmueor sayhig "N0"‚und remmirlg zulhc Finder. Same applicatims an humdad minslall rcsowoes and mustba ldemified und aflowed m install b)’ sclecting 1h: “YES" bulloxl. These filos w-iIl hclp you pmvmt Vital infectinrls w dlelßct the scrious damagc i: done. Every Mac 115er should vims beim-e ' ' ehe-alt thnir sysmmfor infzcximz und shmfld have a “Vlrnl Survival Kit“ samp far (bis s-pecific puxpuse. A5 my danation, In Lhc cffurl. cf L1adicuting thesa viruses, I have pxcparcd a, "V5131 Sm-vival Kir“ disk 311d suggcst Lhal. you acquire a oopy. Copics ca.11 bc ulxuinad. a! nn chacrge, diracfly fxom. myself. Plus

Computers and T hc Law

_„

‚r.

Yacclne

Dm-‚a-qnv-rvmu Euch-n

right Ast in 64yu1-x. 64 Yun mUpgrade ' Thc old Copyright Act h1: not been

Mutant-Obmann:

weilt. Danpuhuthhlflcfloflfldbl

‘

man;

mendedsuhstnfiany her-nun, sachkundixinc: 1924. The Ast "“"°"*"""""'F'IVI""pxonactadvuimns "Harn-y warb" irwludingwritixxnmapsandchanmsimethaxtime. technology hß given us nrhn, TV. copien, colnpcnaa. und 0th: dcvioes undreamed of when du originul copyfightActwu writtcrL The afivem ofwidnly

ComputingotfrommaPDülrlriesofeimcr MainlmdMacintoshUsus‘ Gmupcr Apple:B.C. ("Wrilc Protest" Ehe disk before motmfing und follow the insmxcfiom providod.)

Ifyourexmninariondctumines flmyonnsys-

avlihble

temishfecmdyoumuanukeadecisionastom butwaytotncklcmerumvnlpncus. ‘Phi:

decisionvarillbeynnfly inflmnmdbydxetypeof

sysunnyouareoperairaguxdzhelikafilwodof your Mssux Diskx bdng infiecwd. A floppy only

systcmcaneasilybecleundbyuufimingdrh filesandreplacmg applicuimu fxwnyomMmer Dislcx. Thc infectod disks 1mm b: m-ixfifinlized pricrtousage. Ahmddiskdxive syslcm isnwre

oomplicstndndtimcwmnniragnsmmisofm man: du: involved 1nd m:safcly prooodwes an

farmore enmplicnod. ‘I12: status ofyour Masten" Disbwflldetermhbeifyoushoukiuywclhrfirwtc theviralrßmncu urc-izxilializzyoixhnrddisk. [f you In: opcraling on a nezworked synun I would strongly reconnnuxl umyou obtajn some expen assistmcc. Nctwozked systnns an: d1:

mosxpronetoviralixafocüousarxdareflncmsx

compücalcd t0 clean. 111e possible oombinnüon of determining { m a n 3nd Lhc complications of additional irafecfions chxring the removnl procu:

< 2 : SELL :=:>

was pmled mBill C60. the fim major dringt: t0 Ihr: Copy-

Dumm-m

IMTVLUMacIm-‚alnvwnuni

:.-’-‚.:;._f.‘.

COMPUTER SWAP MEET ä BUY 6 : 3

Software

f’

v-ullnoxxuwvvn ßhnpihllhlu

w—|..

N261Copyright Law Allem Computer Uscrs

Collfll I E 8

Vancouver's First Annual

mkatlzisfnrtpooonxpljcarsdfoxnnstusersox netwomknchxumsxrum. Hncucafewpointsmkeepinmmdlohclpyotx

LChockyumsyswnvIiflnMWinlSmvival

Kiforasittxilardiskofyourownmakhmgana reguln basis: daily ona netwm-korsysluus avail-

abletosevem u m . zünlymePublicbon-nainuudshuewmfiles which hsvebemfihcrcdfu vital infections. 3.In:1.|rcl.hmtheWrim PromctuhonallMns-

terDisksaremmdzcmockecfposiüonpr-iorm '

msemng‘ inmydiskdtives. ttlxnsullvnccineqjlflouxdisgarasp-evmm rivemdeasydetecdonnools. imnotallowmymcloirsatadishwhfich hasnmbecnaheckndforviralixxfecfionginmyom

technologylmbemurCopy-

riglu An‘: l a u t und mostdifiicult chnllmga. Underlhearrxmrmmflmumcomptnuprowillbeprotncwdrcgudkssofthemadimn m5 will be eligihle for fuIJ oopyright prowction Ycrlhelifeoffltcrunmplus 50years. Backups Not Included ‘Ihspomaianoffeed u:soitwaxebyoopyzigizt

ismiquhnlhuithmtwoemcepfionmflufint exceptionwil] allow Ihosc inlxwfxxlpusscssionof aoampurnprogxmntoalteroradsptitmnfitthfir copyzight. The personal meds widmen: sccundexccptionwillallowIhemalchgofabnckupcopyoftlnpxogranmcompnnaprvgmxswfl]

bepomctndbyoopyriglnevenifmeywmmund prior to the June 8. 1988. ' Needless to sxy, Lhcsc chmgcs will provide software developers Wilh mmhneeded ccruixuy. lfCanadfs high nach. nscatd: und developmmt industris axe to flourish, mis ceruimy i: criücal. However. wir}: chcap, hifl:quality copying of all

573mm-

? Parficlpate in this exclflng Computer Show

j Bnnging Consumers und Commercial Deolers 3 together under one roof for moximum benefn‘ Seasoned Users ÜWanttoupg-fldtrlcdadn Ü A n c n d

ÜBenefl frnmalargc udlenee. b

05:11

‚showmgadvnntagcs

ofnbrandxxcwsystem.

Dldondfmtnndmoevtfllbe alrcadyguanfied Osauafygflmdrnnedsandcbse ClYouwllxeallaenalumthh perfectmlxofflrsttirmbtryers. buslncn uscrs. and power

rNew-Users“ Im:

[natura und

lnnewapapermlocaloonnmx- oemlmn on eomputcr und mwswapmeetsorhudz-ms? eoltvranpmgmmxuwflns Ücctrcsultsnowi howtobuy one. Dbexnonstnlcwhntyotxrsy» man: wer 120 tablea o!’ neanoned uscn wmmg to temdoanndadlll. ÜBeneflt {vom a massive demonstraxcthchgooduaed axaortmmtofhtxycnwhooec aynnemn-befomyoubuy your 500d used ayatcm an Cbheckouttrwhnndncw systcrruatthcapproxlmately tmx-"nnrsysnm Sdoctfromuvari- läoemhmvcdulcrboothn

Üsponstaralecttueorsurxl- etyof usedgoodsystxuaas nur um! beneflt from a acc- weil as brand ncw syutcms

tool ond ISO exduEmpprwdnm 31v: dcfler booths avaflablc (l0"by1l0' boothUGJOI

zum;enforw oupyrighwd maxcrials new Copyright Am man: i: also needod. äfibh. pxovidcs that mforeammx. UptoSLOlIILNOhFhcsOrSYearsInJaII ThcpüucyprovisionsofßillC-mspecifyflxu any petzen whn 9:115. distribnatos. exhibiß er impartsforüanyhfihgirxgoopyofaprotectedwoxkisguxflzyoimoffmmaxxdismbjact mfinanphoflßtioßflomdimpismmmtforup

0o fiveyearxThuc uesignificmflyhucuad

penalficsdwizrxednortfleaourwmmlfictcfli-

;

des ofeonunucinl pincy und w give Ihenew legismionteeth. Progmmersundsonnncompanlesllappy

fxomdcaleml

ÜWhec1&dealonyour2'by

rtabkßäolnnxnwnoomplctcryitcnxspertnblel

PROFESSIONAL COMPUTER

CENTRE

.iExciting career opportunities now exist in the Vancouver

sofnmeusczs Chargen. will becmimß a: nohow drin new lnw unter:

E personal Computer industryfor proven, top petformers v

flmmhisfzirtostateflxztmostpersmaloompcxm usasownathastotuifnotmny umxzthoxizad

eopicofnhwumflowdoesfltkmwkjshfion nffoetüan? Bon lt wmAnm Individuum

* Corporate Marketing Consultants

‘Apple Macintosh Marketing Representatlves

akudyüxfocicdumefacxory. Withaliulecueuudprevenxknxyoucmbm du viral heuizs vithout absuining fi-mn yout cnjoymauofPublic Damzinmdshuewm soft-

* Custotner Support Representatives 1

yzmfinnkyounadpleasepmcfleeufemnmnm8-

would like to join Western Canadds largest and fastcst ‘fyougrowing personal Computer dealer, send yom- resume '

in complem confidcnoe to:

Ronliaidctxgaflryaarxdpubliqdmuainaflnw

groupczpa-uncchammdehmarzddnbtgt andmcm

completemu-czrofMacwashpublac danainandsharzwaresojrwarehmprwüncgof’ 3.6. For Mormafion abou: public dornain und Shareware sofiwa-c. far yourxlf or yonr nur gmup, giw konacallaf60ü574-38l3.

T Software.pimes heirate!

Ä 5 4 5 ‘f a‘ mfbiLgltt4 ‘x3 4‘»4_|.‚\ Ü ; ‚ " A \

__ "I, --_-\\ i‘.‘ i ! 01'.‘‘55 w!*‘: 0 g b 0 0 % " ; ow-c |.||

Narr.) Mathcson i: a Jawyar wir}: PIERCE. VAN LOON Radstar: J: Solicitors. 68l 4434 Suite 3220. 650 W Georgia St. Vancouvcr V68 4N7

Personnel Manager, Pmfaional Computer Cenlre Suite 100, 1112 West Pender Street Vancouver, B.C. V6E 2S!

17-64 1mm t0 Spreadtheu J: Data. Base Appllcafions

(3-64 Creslive Compnllng

DESKTOP PUBLISHING TRAINING G E N R E 400-1190 Melviila SL, 681-2535. Cfllfifnr August Schcdulc d‘ 1nd Velllfll, DOPPLER TRAINING CENTRE 5th, Van. 875-0261 1011W. Vatun 15/19

Uliüflfmniglnsdmool mndams.

Aug. 975 I; Pngcnakcr Aug. 5&6 FIALA BONNER. fit. 810-1112 Paudcrfißtfi-IOR Vmtnru 1 Aug. 5 f McKAY ‘TECHNICAL INSHTUTB 315l Bunud St. Vanc. 736-7221 Callfordctfls l Pu raphic Am“ 12 man W 16d: Aue, 22-1010. C111 CFNTRE MICROA E LEA 7 fnr naning dazu. «S175 .3 Pngnnnku" PBSC ‘IRAJNING CEPTFRE 1350-1140W. Pczuier 689-7272 3 S450 Pnganaker 1 Call for dato: 545i) Vulkan 1 Aug 2-4 zl PRECEFT LEARNWG CENTRE 735 cm1: Dr 255-3198 S130 lntm to Desktop Puhflshlng Aug M5 PRIMA TRAINING 207 39C!) E. ffisfirlgs Sl. Burnihy 2944567 5150 DTP uslng Vcnlun Call Iorr einen.‘

PERSONAL OOBIPUTFR TRAINING INSUTUIE

Newvirws Si-numcullfornaxtdam

COLLEGE 875-251!) VANCOUVER CO ACCPAC Fall. 1 & 1 ]for Datei ACCPAC- man nlryilnvcntory ccntrui Bcdfcrd Account!

VANGJUVER SCH L BOARD 736-7241 Vanwuvu Teehnicnl. 25m H. Btudwny ACCPAC-GL 5 snssinm snning Call for Dm: Redford acmunflng 5 scmbm VAN. SOFTWARE CENTER 300-1190 Mclvfllr. 669-9800 Call for anfing dass. Redford Aug. 10.29 . r. ....m..u n s .

687-4255 SIMON FRASER UNIVERSITY DTP Ventura, Alternative Appnmchts G AEOC VAXCOUVER ELECIRONIC PUB s P.O. Box 24776. Vancouvcr, 875 SEYBOLD DESKTOP PUBUSHNG COINTERENTCE S t a u C1111. Calif. SepLIS-IT, VEPA pwchge laut‘ to Scybold rate: {zum S426 C111 ä Gail n Amicn Travcl 683-7727 General Meeting W 6. 7 PM utthe 8C Club in ‘Ihr. Enm-pdu

5275

S150 Frcc

Ccnm. 750 Pacific Blvd S ‚‘ Mac SIG (Nelson Rum) 683-1599 säuum, Pbwcr Pein:

m35 Vi/‚Pcndcr . Aug. mmpm. VANCOUVER oonmunm COILEGE 875-8200 1 lntru m1m-m; 41s VANCOUVER 1325x109 PUBLISHJNG CENTRE Ltd 1150 Homcr S! 531-9151 Slcvc Osbqhe. Rmdy Gman Vcntnrn Junior Level Aug. 9.16 w venum Senior Level Aug. 11 1 j nunop Design cum: Ventun Pnbllsher Call for Datei

390 S90

John Oliver Schoo]. 530 E. 41 Ave F! D11’: Vcntura Call f0!’ dann Irrp-

dlue111+ Sunuryfiunczampmerbnsndnnhfixxg-sflf pnood S140 111101111: (Ivurlge 20 hr5. n0 nun.) BARKEL BUSINESS SCHOOL 211-3030 LincolnAvt-„Coquium 464-8717. cmfoa- night ncbool um: das. 550 DB!!! 111 LEÄRNINÜ CENTRE [ m 5 w.Pnndnr 553-6152. C111im‘ Starting dann. S180 11km in 486e III + S180 dBane I11 + Inzmnadhn COMPUTER FEOPIE IEARNING CENTRE. 302A 1124 lmsdala Aw. N. Vm. 954-4349 5139 dBA5E111+InhvAup308c21 5139 dBASE1l1+1ntu-.Aug.27&28 COMPUTER STATION 2130 Bunud S1, Vnnwmver. Pnt Ausfiu 732-5621 S175 lwunmdißaamficfllfiordues DÜFPLERIS TRAINING CENTRE 10l W. 5th 375-0251 5175 dlae 111+ In!!!) Aug 4 5175 ‘C1111!!! nur dann dBuc H1 + Prugrul Glüü-llllMnlvillescdw-Ww DRAKECUMKHER S175 {Baue III + Intro G11 fix d u : 5175 ahne I'll + Innnr-nd. S175 Symphony Database Au. 10 5175 IIIÜUCIIICHMCDGBISCUIPEAQIZ 5175 lntcrncdlntc dBIst III Ph:Aug. 17 5175 Introducflon In dllee 11'! Ph Aug. H. 8175 InlmdnctiontodBaselIPlmEvL Aug.23 FIALA. BONNER 810-1112 W Pendel‘ 684-1022 3175 Gnu: 111+ 1 Aug. B MIROAGE LEARNING CENTRE 3609 W 15th Avc. 222- 1010 Call for mrfin; dass.

nun: Plus PBSC TRAINING CENTRE

1350-1140 W. Puder 689-7272

dBueHh-Auglhugß 0 8 m In + 2 Aug. 16

dBuc 111dBue 111 + Database Usiug Clipper VANLSOFTWARE CENTRE 300-1190 Nlnlvifle 669-98110 Call for smrüng dann. Intmductlon to dBann III 4-, Aug. 2.18.30 dBase III + Internat-d, Aug‘. 925

Vancouver. 1,; A Iook a: what Desktoplfublshlng I5 all about. MAC versus IBM ‘"9 Ligätodflclasäsfiäe Tenns and ooncepts f" Leam wnat skills ntakgs The equnpment 557.70“ . o who is doing it.neededu; Where the jobs are bang created SUUICL See demonslralions o:Ventura 13.41.4 and PageMaker '

5150 5175

° “fijfiflfiäafi”

n ls

Ridxmond, 272-5739 In a! 2nd Monday 7230-9230 Vnncomar Schar: User's Group Lcs Izbhmnl 275-2329. Meer: In Mm er! In: month. Vnncouver' PC Users Gruup Pllncunimn 438-6039. Sm/yur . 7:30 pm 2nd ‘Thurs Vantnrl 34-3046 ( i m !Meridim. PI. Coqtfililm B.C. Judy Haus 3731941 Ratings Comm. Ctr 30% E Ihflhgl.Au] 1&1; 3:30-10:30 pm XUXE k S!‘ Wang System User Aasudntim 736-8841 ext 2.2’? 1P. Doixcn 99 UsenGrotlpMcctsevuy Thnmday 7-l0p.m.nCuncrmRJcc Ccnuc. Bunlnby. Call Ron u 522-398. In ‘Ihm: Ganzes. 2nd Thurs GmuuIBrdThwsTmmiaIs-‘ithnm Coca-m; Pmj.

TRAINING 100-1111 Mnhrfll: 669-8739 Symptom Dmbase Aug. l0 Symptom Sprendshea Aug. l8 Smart Sprudshut Da: 1 Aug. ä 9 m m Sprudmou Da; 2 Aug. 26 PERSONAL COMPUTER TRAINING INSTITUTE ECU-Z‘? Abo!Sl Vln 682-5443 Call für ndmdnln PBSC TRAJIQING CENTER 1140 W. Felder, 689-7272 Synphony l Aug 9 Symphony 2 Aug. 23 Sylphnny 3 Aug. 26 III-immun II 1 Aug. ll VANOOUVER SCHOOL BOARD 736-7241 101l: 011W!‘ 34711001. 530 E. 41 Avn dBuc 11l + Call fix dann VAN. SOFTWARE CENTRE 300-1190 Melvflle 669-9600 C111for 31min; dann. Intmducfion In Finanzamt-k, Aug. 4,16 Fhmewurl: 1T, Inlcr. Aug. 11,25

545.0"

8175 S175 5175 S175

S175

S175 5175 5175 590

S180 5180

DRAKE COMPUTER "IRADTHHIG 1111-1111 ‚HD1710: 669-3739 S415 Nord! 533mm Manga- Ang. 16 arturzrrtlrr-v

u w .rmm-r»

._.‚...‚._. u.

DOUGLAS COLLEGE Info 520-5479 Ragisur. 520-5472 H12 NcwVievrs Aununting Saminnr Cm fordncs Wen 16th Avc, 3-1010. MICROAGE LEARNIÜNG CENTRE‘ Call for smfing dass.

Aulncad. Cnnnnlzlng Autocad i1

S175

PACIFIC REH COMPUTER ä CQMNIUNICATION SHOW November 12.3.1985, Vnncouvcr Tun: und Curwenliorl Cantm. G11 for

dmfl: 433-9549 er 433-5121. SuIesEE-lelen [nassem VANCOUVER SCIIOOL EOARD H632“

SPOCAD CADICAEJÜM. Cunferexm in Saarflmwaxlfingxcn 111c wenn: Aug. 24-26. Iniounnum. (509) 454-6512:

‘

'I‘rnee{‘RidImondAnflClnb)ThpmpsonCcunn.CmnnLümLmc

DRAKE (3

nkery thal more caräers will be created and oorporale dollars eamed .ia5 a resuit of deeinop publishing. than a olher oontpmer appllcallon o1 the past. Leam how to sl takn advamage o? this dynamic new induslry. g 2nd Floor. 1075 W. Gnorgia St. ‚ Vanoower B.C. VGE 309

ifEfiiifiäilfliEfl?’IDESI‘G-N5%ä’

24 Thc Computnr Papa-r August ‘[988

This seminarwill be given Lanoe Braunen, Pro-Süden: o?the Vamouver EiedmnicPublisrlng Associalion and Desktop Publlshing Systems Manager ior Souroe Data.

S180 S180

S135

DESKTOP PUBLISHING

5150

’

ANlNTFiODUCTlON

S140 S115

InnnIodBncIII-i-Cnnfordnc:

8135

817S S175

Franc-worin II l Aug. 30 Paradox 1 Aug. 8-9 PTTMAN BUS. COLLEGE 1490 W. Bmudway 733-7348 dBIsse 11T + G11 for um:dual VANCOUVER COMMUNHY COLLEGE 375-8200

5115 3175

€813! I11 + 3 Aug. 19

alur

VANSOFTWARE CENTRE 3113-1190 Mclvme a. 6998m Call for 51min; dazu. ,1 Pngddnlur, Vcntura Call for da63 lnlroductlon u:‘(antun Aug. Advuced Vcntun Aug. 12 ‚ Inhalation In Pagntnalmr M522 hdnnced Pagnnukcr Aug. 26 "E Venun Publsher vs. Pagcmakuf AugJIZ-‘vi

5175

dBhfl 11l + Partl & 2 PCI! (PERSONAL {IOMPIJTER TRAEUNG 203-24’? Abbol St Dovmlown 582-5448 l2 hmr coursc: dass. C111für

5159 5159 569

vmoonvm SCHOOL 9 0 m 1 )756-7241

cENnm Laudaic Qny 934-4571

5130

Apple; BC Cnlnputcl‘ Socicty Euc Mcclirag Aug. 3.BBQfPiufiq Aug. 14 s Ritual-Garni: Park. 31132011 10m4: orlonnwnltotn. 467-6062. Apple]! User GruupMccthgHCApphStxialhBnnuhryRngbyChß. K130 Mnsuda 437-9935 Apple III SIG Mmthly Kiyo Masuda 437-9935 B2172!‘ Va l l q Commodore Club M m : fim ‘I'm: every mnnzh a1 Mmtnose School Libmy. Call John Vink 367-6425 11c. Uni: User’: Grwp mccts 4 timus a ymr. C fl ] Georg: Pnjui 925-2555. 2545 Queau Aw. Wut Van 177V 2Y9. Clipper Dcvdnpen Auedamm 1a Man SFU 373-0747 Commodore Club 13111:: Sunsct Comm Ccnur. 738-3311 Ford: Internat Gronp Spcakcr: 5nd Tmorinls un Purlh hardwam. schwul: und nppliuüons. Moctings: 75011m 111m3 0|‘ each mnnth, BCTI‘ nuin bldg. 370c Willingdun Rm. 11-324 Kaypro User Grnvup Vanmmrs Pomblc Computa’ D u b 3rd Mmday anKaypm in Richmond (CPIM) 278-5776 Mac User Group Manning BC atpplc Soclcty, WCB Buildiug. 6951 Westminster Hwy (Kiyo Mnsudn) 437-9935. Mnlnland Mac Au; l0. 7:110 PM Rm 115 Kwnntien Callegn. Sumy. 574-3313. R0! Hlidurgcr. Manie Rjdge Computer User Group 467-2647 MR. Sr. Sccunduy Sdiool 7:30 7M, NEC APC Users Group Bi-monzlfly 1.1:»: 930-5825 Norm Amcfldn ßnstr-nd User's Group. Pur ncwsizucr. mambmlfip applicaüm und S. A. S.13. In: 65-13830 74th Ave. Sumsy V3W7E6 PHONE: 597-0881 R. Seen Nov/d! Nenne User: PuarWhimIaw 669-5789 manhly Port Coqnitlan Conrputu- Users Gruup Commodorc Amis: d: IBM lslund3tdTuasdnyndxmonzh7ßüps-m lbcokcccmr:2100Wi1s0n Ave 942-4286 Tllldy 1000+ Club Mccling Mondny Aug. l5. 7:00 Im a: Kwnmlen C011: c.Ncwtm Campus. Rm209 m 21l. C911 Lm Eosco: 574-5419 The nur Apple Alllance May Gzow 435-76091115: sann-da}: cf munlh in lütnihno Ndghboufilood l-iouac. Tl Computer Club Central Ridqnund. Maus 2nd Wed cf auch monxh. Htonc Kcith u 26l 2'739

Ihre:

5180

ABASEx-mßmwxxg 3.

S150 17l‘? g uslägltgemater L GB. Bm: 1200 Caqflggnr VIN 3.1l 365-7292 SELKIRK Eleclronic Washing, Graphit [E51, Wrltlng. i. ycxr prugrun

3150

0140 S150 sIso S275

um;ACCPAC-Easy Aug 5/12

User Gfisflp Meeting: (PxNorAmA), BCIT. Rm 129A General Macdngslnd Wedeachmomlflßopn Engl-nummern: 4th WL-‚d nach monxh 730 pm

’

ACCPAC qr Redford Accounting CALL PTTMAN BUS. COLLEGE 1490 W. Brondwny 733-7348 Computer Acxxvtnfing C111for statt dann PRECEPT COMPUTER CENTER 735 Gut Dr, 35-3198 Redford Accounting call for dann: PRDVIA ‘TRAIIGNG 207-39130 E 1115111138, Burnaby. 294-4567 Usln-g ACCPAC-Fhsy Aug 5 TK1. MANAGHIENT‘ SYSTEMS Hain! Georgin 376-7117

Intm Programming in “C” 19mg. 84340-11 1mm m Programming in PASCAL Aug. 2.3.4

Bcdford Accounting 580 ACCPAC COMFUTERLkND IEARNIPJG CENTRE 1035 W. Pcndcr683-6l52. Call for Harting dann. S180 ACCPAC GL ' 5130 Redford COMPUIEI ELTIRE TRAINING CIRE 4162 Mnin 872-1668 Ncw ‘Vlcw: Accunatlng Call for chic: S145 CÜEJIPUTTER FLACH 360 Bumrfi S1. 688-2992 3179 flCC-PAC G11. Aug. 9 S179 ACCPAC All’ Aug. 7J DOPPLEPCS TRAINING CENTRE 101 W. 511| 375-0251 Redford Accounting Aug. 16 S175 8175 ACCPAC full day warme, ‚Mut-KAY TECH NSTTTUIE 2151 Buflmd St. Vnnc. 736-7221 Conpnurlnd Booltlueeplng Coune 12 wanks

200-247 AbboISIDcVwnmMrnÖEZ-Sfil-flö lzhotxzwuncs

Apple: Mystuy Wrltlng

580

0-64 Cmnpuur Gnphlc: 8: Aflmntion Programming Appimhbllsh a.Bock

(sccalsothcMndnlushsoaimforhbcbTPß

ACCIBS CENTTRE 2W 145 Chndwid. Nmh Vxm 934-4671 5180 Bcdfofll Aug. 6 &‚ 13 BARKEL. BUS-SCHOOL 211 3030 Unmln Avefioqfitinm 464-

C-GJ Junior Word Procossing (3-64 Knybonrdlng and Word Prpceslng

C454 Computer Awarmm

(3-64 Problem Solvlng Cornputlng (1-64 Wrlßng Uslng Word Pructastng und

‘L 4

‚

DTP

S65 ‘S65

S65 S55

565

ADVANTAGE COMPUTERS Suite 1760 505 Bumrd 3L MACS AM. 8:30 12:00 mm4 PM 1:00 4:30 pm. S80 Intro In Mac, Inta-mcdlm Mac, hin to PageMnker S150 Intuned PagcN-hkcr 500 lntrn to Microsoft Worin. lntm in Mknmun Word S150 Intcncdlatc Mlcrown Word 580 intru t0 Microsoft Eitel, Intro m Hypercard C - L l A N D LEARNWG CHNTRE 1035 W. Fathdcr ÖÜ-ÖISZ C811 10l‘ sumirlg das. M u m m ] : fllgcxnakcr, Exctl Inkl-u, Eitel Intermedlata, '- Pur? T-v-J" 518-0 Skilh, Infm Word, Intel-Insulin: Word FOLKSTONPi DESIGN 115C. B6: 44. Granlhlm‘: Landing. B.C. VON IXC- 93.‘. 55:4) 01’ 336-4502

ÄUCPOSOH Word Call fur dulcs _v'-._!x};_.-5 ’:„".4‚;.-».'.|aka' lntermed. Aug 24

5175

—.

Ä E*'a:"“"i“' j

nur

432-3419, Pan Timc: 43-11510 n (15.11Mann-au) a m ‘ uns: (IBM PC) 1 6 wks Canon-Lau 1, Cobol-Level II a 07h 1-171 um I 6 m Pnscal a COLQUCOILEGE Vlnuuovur 682-6600. Bumnby P11117m

5157

Asnunbler 1, Aasetnblar

S167 513a

5139

435 2401.R1c1unmd273-0373.Cn11foruufingducs.480hounfiu1 1in1: diploma oomses: Computer Prugrmmhg 81Systems Analyst: Mlcrucunputer flodronic Teclmdogy PRIMA ‘IRAIEWING CEP-TTER 207-3900 E Humus, Bumaby. 294-4567 Advfifurbo Paul, P1110; A117. Tube C 4 Wks 7-10 PM S150 VANCOUVER COMLMUMTY COLLEGE 5140 lnrroductlon u:c Aug. 319710711 S140 litt-hellen m Pneu! Aug 2514 S100 Unhrnl mp-ammug Still: (Runen-Bus) -«mv«mm.u1-.-.-.u

m - w w v u m w A w . L - . q ‚ ww -\ YvifuvwvwlsvwivAql

.‚

w v

w «.1

.|5 r -

. . .

VAUAVJ.'.I.|.‘.I.I.

w.-

arNV-NAvAvAMI

u.-

.UJAIA!.IAA.I -.-;

‘

170m5 123 lnrro, Image-mm.Anhand ml/IPITTIER STATION 2130 Bummd S1. Vanouuvw. Put Ansfin 732-0621 Iutmdldlon 1o L001: 123 Arg. 11.12.2324 Aug. 11.11324 1111811186101: Lohn FutTr-cklfilflfitug. 11.11%}! AIIVIICHI Lotu 1B n11für dem]: DOPPLER 10l W. 51h. Vnnwuver 875-0251. Laus 123 11h’: Aug? Laus 123 Advlncd DRAKE COMPUTER TRAINING 100-1111 1111:1731: 669-8789 [ a u s 123 151m Au . 2 Adnnwd um log-J Aug. 12 Illhiducliun In 1401H 1-2-3 ER.Aug. l6 litt-Minding M1401: 1-2-3 Eva. Aug, 17 Inltoductinn m Lohn 1-23 Aug. l8 Munter! L fl t l l 1-2-3 Aug. 22 Introdicflou 1oLaus 1-2-3 Aug. 26 FIALA. BOINENER 810-1112 W PlnduVnvuxvet. 684-1112: Lohn 123 1 Aug. 3

man: 1232

S150 S175

5175

S325 S175 S175 S175 S175 S175

Aug. u

Lama 1-2-3 um 1 Aug. 19

S175

S175 S175 S175

S175

5115

S175 S175

Lunu1-2-3uvu1AugJ9 IPCSYSTEMS, H3 W.71h. 873-5595 S150 147m5 1B Adv. Aug. l6 51.50 13 Lama 173 G CENTER 3609 W 18h Avn. 1-1010. C111 MICROAGE S175 far anfing dass. 1mm 1E PBSC TIIAINWG CENTRE 1350-111!) W. Punkt 689-7272 '

L a m m 1.105123: 1.01115 123 2 Aug. 17

LoIna1z3Mnuu)Au;.25 Iamslflmbctlouflltugl?

Iotufnrhoafivu Sqcu1c1V1Ang3 supuulclvzAnpßd smnrtlAug. u h u m a n ; 16

PmtSONALCOß/IPUTE ‘TRAININGWMTTUFE 2W-247AhbotStVm.6B2-544812hm-uomm

husmuvdmhlnau

PHMANBUS. COLLEGE 1490W. Bruch-q 738-7848 II!

S175 S175

S175 S175 S175 S175 S175

5175 3175 S150

Putntfünild Aug. e Introdncfion m Computtrs Aug. 20 ms 1 a.2 Aug. 24

5175

1 .

S175 5175

IHIICROAGE LEARNHWG CENTER 3609 W lfithguflvn. 721-1010 ‘4 C011 for anfing dann. 1 ms 1m t0 rcsmos. Adnnud Dos ‘ pnsc 1 m m cmmm 1350-1140 w.Peo 689-7272 S175 ; Iuü-nIoPCAngLAugJO 5175 DOS1&.2Aug4.Aug15‚Aug.E 5175 1 Advanmd ms Aug. 1o >

PCIIID-HIALboISIVm 682-5448 Erneuern-s: . tun-n t0 IBM-PC und pw-Iu nahm-e

mm»: 303.001.156»: 1490 w.u m “ ,731-7543

S150

lnuvducfiou

‚ 3 D05 Selig-n Orkutuüon FRECEPT LEAKNING CBITRE 735 C1371: Dr 255-3198 Ptß-DCEJPC-MJDS An; 11/12

In Buben

S140 51.20 ‚ 294-4667. S105 S105

1mm m mmPC-XT a.Cmlpnflblfl Au;

PRIMA ‘TRAINING 207-39“) E. Hastings. V

1mm In NfluvcünpItu-n Aug 7.8

GdflumEuowyonrPCHa-dwnmmxg!

UBC Cum: fm(fanfinuing Eduulicn

Cannes 110111:

Lab.01d

018-1105: A Bqluner‘: Gulde an in: am: d

565 S65

GdflughKnvIrYouI-Pcflamnnmnglf I l l r u l0 Au; 3.7.8 ‘x Iuh-uhIBMPC-IT M5817

S105 S105 S120 S140 3140

S90

Ins-ms: An Advanucd Workshop GDLIEGE 87 VANDOIIVER.

hB-DOSIPC-DCE Geflhg Same Aug. 11/12

m-nmmc-nosmm um

VANCOUVER SGH-i001. BOARD 736-7241

Ich: Oliver. Vmoouva Tudniml 117170 IBM PC C111fordnlcs

S *

VAN. SOFTWARE CENTRE 300-1190 Mdvfll4669-9800 4 Call Im’ 10min; dass. q Dtß Orlumlon, Aug. 9.3 VANUOUVER DESKTOP PUBLISI-IING CENIRE L10 1150 Humus! 681-9161. 5Min: 03171011111, Rndgy ‘ 0mal 1111117006101: MSDOS Cfllfor dann ‚ Tlldq C m n u d d‘ 116008 Tnldng Cuuunud 01161108 v. Sinnflut-ß;1te 0mm PC U n d : Ihn H 0 m 1 1

51H

5119 569

S69 S129 0129

IMSdhrI-c-Lflnslißlflnflhrmndflu

LEARNDIOCEBTTER 735 Cluk Dz. 155-3198 Adnnoullah: FRDM TRAINING CENTERMT-JSDOE HutmgsJN-ßö’!

latlslßfinlflflhhlucflhGnph

VANCOUVERCOMMIINITTCOUEGB 875-8200

ummuuammo

S140

5150

1410051811051

S150

lnmslzäcaflformndam

S90

E‘ . ‚

S167

S179 S179 Lotus123LeveIIIAn517 S179 Harnrd Graphic Aug. 29 COMPUTER PEOPLE LEARPEXG GENRE. 302A1124 Imsdfl: AVB. N. Vm.984-4349 S139 Lohn 123 Adv. Aug. 5.7 S139 [ a u s 123 A111. AugJ-Z} COMFUTTERLAPID [EARNDIG CENTRE 103S W. Panik: 683-6152. C011‘f0: surfing dass.

‘

‚

V UVERSCHOOL BOARD736-72A1 Vmmuvu‘ Tachlnial. 2500s. Bmodway

VAN. SOFTWARE CENTRE 3111-1190 Mdville 609-981!) 0111011121-111; dams. lutruducflon u: man m, Aug. 4,15 Lotuslntumed. Aug.8,2‚4

uns:

Sprudflneh: Lama (wenn:20 m) Duhhaseflau n1 +

‘f

5140

C111{er nighx school um das

S80 e WaIflFa-fa-‚ywmfisur LEARNNG czmma 1035 w.Puder 6836152. ‚ 6115s. Call 101.‘ '

5170 S130

MSWOHI, WOHIPCIOG, Mnlthunle DlsphyW COMPUTER. PEOPLB LEARNDIG CENIRE-‚QJZA 1124 Lmsdule

1mm 1151707 Aug. 2-30

1350-114071. Pmderstfilw-‘VZTE Qgsglk 11:111g g g f das}

5140

A‘

BARKIEI. 3051x1253 scuooL 211-3030 Coquillnn 454-3717

Alm. N. Vm. 934-4349 PBSC TRAINER."- CETIRB

S175

humaner-vom man... MSWIB Aug. 3-31 Ar 115m4Aug. 5.57.11. 2 s

S149 S169 S169

S139 WordPc-Iect A117. Aug. 1-24 COMPUTER. PLACE 860 Run-m! S1. 633-2990 S329 Iltis-neunte MS Word Aug. 24 S179 WordPu-fect Land l Aug, 11.30 S329 WwdPufectIAvel l1 Aug. 18.31 S98 WordPa-fafl-upgrade zu5.0 4 111x Aug. 2 S179 I0 PCTotrlsbgidtwln-t-Aug. S179 Dkplly Wril: 4 Aug. 15 73lCOMPUTEI STATION 2130 Bunud S1, Vmowvar. P11. Austin

AOCESS CENTRE Lamsdale Qtny (N. Van Salm: Fauna)984-4671. Start mytimc. oompum b-sad lnining-sclf paood unorhh S140 Spreuhteets: 1mm 123 (Averqc 21) 11mm) BARKEL BUSINESS SCHOOL 211-3030 lJnwIn Ave. Coqduun 464S80 8717. C111Iur night schod um dalcslamsln BCIT Pull Tuns Regimuum 432-3419. Pan ‘Ihre: 034-1610

Busses Appllaflon: (Laus) 6 wir: CDMPIICOUIGE Vanemwcr 682-6611), Bumaby 435-24124. Rinhmond 273-0373. C511 I'm mrfin| dann. 480 11mm 11:11 um: dgaluna m a n : Nllcncuuupnu-r husinem nppllaüuna COMPUTER PLACE S60 Bumtd. 683-2992 190-5123H“! 1Aug6.16

ACCESS CENTRE londsdnle Quzy 934-1571 Bub:Openthg 510k Sun uryfimc. canmpum‘ pmod mumus (avengclz 111S. no max.) uxwcoln f. BARKEI, BUSINESS SCHOOL 211-3030 8717. Call 101-11115111. 10110-01 sum dams. ‘ MSnosTmu-Iu BCIT F011Tuns Regisuuim 432-8119. P111Tunc: Cumpulcrs in Ruinen 6 wk: Turcsflhm Cumpuur Systems-Intu- 1 6 wks Mmfwed Compute- Systems-Inne II 5 wks S399 miccommpunr Systems II! <3wka M11’ Aug 1 f‘ 5139 ‘ Dill Pronndng 1111H) 1 W11 Aug 22 683-6151. Pundnt 1055 CENTRE LEAKNTLNG CÜMPUTEIHTD Call for anfing um. 5130 111m 130 M1018 DOS COMPUTER PIACE 860 Human! S1. 299-3003 x179 mJPc-Dos Aug. 2s MSJPC-DOS Advanced Au . 3 COMPUTERPEOPLELEARN GCENTEQEMZÄIIZ-filnnsdslc f Avs. N. Vln. 984-4349 S89 MS-DÜB XENTIAIS C111 for dal5: . S89 MS-DOS HAnn DISK. MAN. Aug. 11-25 COMPUTER STATION 2130 Bumud ‘Ifmumvcr 2-8621 S160 v_ 1mm m M1121: a:1x3 ‚ Aug. 11.15.26.31 DRAKE COMPUTER TRAINING 1001111 Amme 669-8789 S125 Intro In DOS Aug. 2 S125 Adnnced DOS Aug. 2 5125 xmaucuou w nos Aug. 5 . S125 lau-winden mDOS Aug 9 5125 l Introducflou m nos Aug 17 S125 1 lntmducflon to Das Aug 31 S125 1 Adnnad DOS Aug. 31 n 009714111 101 w.5th. Vancmvnr 375-0201 x175 I mtnnwcrosamasrznxymm s1. 4022 FIALA. BOMIER 8101112 w Pmdcr01...33: 3175 Incmaucuon 1o compunn Aug. 16 3175 i D05 1 a 2 Aug. s

Mkroooflwmfl Adr. M5572! Aug. 3-29 Wordhrrfect 111m Augß-Sapl. "5 WordPerfect llterm. Au . 5-Sapt. 2

vANcoUvmz 111-31010? puannnuxsu cavraana 1150 Homm- St 681-9161, Stephan Üsbomc. Rum)‘ ‘man = Vcnzura Puhlislner Call for da10:

Nlkxwoft Emel Bade, 1511611900 E108 Internen. SOFISHELL 44502 Qunboc S11E61. Van‘. 876-57W Hypu-Tall: 5:11:15, Excd Tips

—I

3159

5169 n59

Word

Mumm:o: MS-Word, man... 17:47:11.; ur Mannen dly noune. Aug. 10.7.5 3175 4. 1|11|17

TRAINING CENTREIOI w.5111. Vmcuxvar. 875-0161 nun-Zwang D0 S175

WordPcfm 116-0011111101: C111for da0: Man-holt Wird Iulruducfim Mnlflmm Advunuge 11lnln Dkplaywfilt IVlnnflhcflou

Mammut Advuhge l11111m Aug 10

Mulümnte Adunuge 11Advanctll FIAI A, R Ü N N H I 510-1112 W Feucht St. Vmaouvar. 684-1022 Mulhnte Advanuge 1 Aug. 2 Mulflmate Aumnuge 1 Aug, 1o Word 1 Aug. 4 wuchs-rau 1 Aug, 1': WorflPwfed 2 Aug. 9 Dhphywrib: 3 Level l Aug. l5 ywrlte 4 Lcvd 1 Aug. 12 Mammuts Ahnung: 11Level 2 Aug. I8 Word Level 2 Aug. 12 WoMPa-fect Lma 1 Aug. 2s Mulfllnnla Advlmxge II L6‘. 1 Aug. 26 Minimale Anhang: Im.l Aug. 30 Word Level 1 Aug. 31 DRAKB COMPUTER TRAINING 100-1111 1811311011: 669-8789

S175

S175 517S S175

S175 S175

5175 S175

5175

S175

S175 S175 S175 S175 5175 S175 S175 S175

S175 WoMPerfect-Inflvducfiun Aug. 3 S175 hßumedhn WordPa-Iud Aug. 5 5175 lnlroducdon to MultlMnu Aug. s S175 Iutrodldlon t1) Dbplay Wrh: 4 Aug. 8 S175 Adnucud WordPufen Aug. 9 5175 lntroducüoo m WnrdPefled Evaa. Aug. 9 S175 Illtmductlon In Wclflhlfed Eva. Aug. 10 S175 lntruducflon h0 WoIdPtrfecl Aug. II 5175 lnüudnvcflon mWaflPa-fu: Aug. 19 S175 Intumodlate WurdPHfcfl Aug. 23 S175 Iltruhcflon In M i t t a l ’ ! Word Aug Z3 5175 Immun-min 0o WordPefletl Alg 29 5175 Imnncüatc MmuMm Aug 29 S175 I'ma-nein: Mund!Ward Aug. 30 IIICROAGE LEARNING CENTRE 3609 ‘W1&1: Av:222-1010 wenn, WaMPu-Iect 5175 cmfix anfing, nhuLDhphyWI-fie, MSW. PBSC TRAINING (ZENTRE 1350-1140 PendcrSt689-7272 S175 16 Diphywrh 4 Ievel 1.Aug. 7.5 5175 2 4 lud Aug. naphywrue S175 Mlcmlolt Wu-Il 1 Aug. 8175 Wann 18,29 Min-Iran Aug. S175 Mlllhnle A a m m g c n 1 Au; 9 S175 M a n n e n - a u ; n z An; 19 S175 blulthnate A n h a n g II 3 Aug. 31 S175 WordPerfod 1 Aug 4.17.31 5175 Wa-dPafod 2 Aug. 12.24 S175 Wann-lud 3 Aug. 30

TRAINING PERSONAL 2111-247 Abbul. St Van. 682-5448 1211m:antun

Mild-Mute Album:11 M8 Wand 4.0 WnrdPu-Icct 4.2

Tnlng Tutor IV PITMAN BUS. Wild PRECEFI‘

W Uüg

14W W. Bmcdwty 738-7848. k TIUOHB; CEINTIRB 735 (31.011: Dr 175-3198

2 Aug 28 G 201-390.) E Hastings. Bumnhy. 294-4567. WorflPrlbd 2 noch C011 far d u : . Mama!Wlflfufecl 4 ‘II/k! COILEGE 875-8 VANCOUVER 151m I: Wurdlu-faa Aug 4

PRIMA.

SEI)

5150 S150

S75

S140 S150 S150

w a r n e n d II Aug W3 hin-unnütze WMdPIfuct Aug 7

M u m m WunIPrhct Aug 30011 VANCOUVER SCHOOL BOARD 736-7241 Vancouwvcr Tenhninfl. 26W E. Branding Worum-lud C111. fu- dnes LEWHII 101l!Olive. S30 E. 4|. A?!

Wflflfflfed MSWIIII VAN. SOFTWARE CENTER 303-1190 Mdvilh S1 669-9800 Ca!f0:- mnlng dann I l t r o b) Multluun A117. 11, Aug. 19.31 Mammut Advutngcn-Iumcn, Aug. 13,36 Inlrodltflnn hwunflufafl, Aug. 17,29 Wand Patin: l l h z . Aug. 12.24 Inhalation Iu M8770!!! 4. Aug. 3,15 Manual! Word 4. Aug. 22

ForFIIEELhüuccdlflwmnpuhrPapmm-sfiß AUG U31 1 20:15..

S130

814a

S130 S150

S90 S90 39° S90

S100 S180 S180 S180 S180 S100

Your Iocal supplier cf Sider" Hard Drives for the Apple II, Macintosh and IBM computers frorn Fiat Glas: Pariphorais. II’

Mac 40 mag. axternal hard drive S1050 Phono (604) 435-9632

SHARP FAX

1 I

WEARE THE HO.1 SELLER OF SHARP FO-SOOIII

SHARP FO-SOO FAX" S2990 aus REG.

nun-summa

nmopuslm-

53C

36|55|55

Dpu21i|— 0,... 1 u.

cm1,‘

514-9564 43341114

man

nun‘.

939-2001

um: Fmufinr

muss

1561453

M3330 233-4312

Plasma: Früh-d

4:41-50:15

tun-uns

874-9767 einem

333-4459

‘Ihhb

92mm

m n m p

946-338)

Vakuums-q

Neumann man aus

a Accescdes

(604) 943-3331

M u m m :

P50 Vmwuvet Hubert:

. wrm“NOWNG/ ‚ ..‘ . . Off-Softwäfäil

Ü U U O O C I I C I C O C C O U U O I U I U I O O O C

IHEK

" 0

COMPUTERS 8: ELECTFIONICS

(Mensch-aßen RBBCYVR

Schuhmann SpahuyBBS

Sfiflufiumü

Tnnnwnp

111115411’!!!

nam-

nah-d

57-3151 ans-dm

991-3472. ‘ad-USS ü-WGS 591-1514 3154m ist-cum 2704W}

4624-879 11 m m 735-7955

943-2117 590-6605 D14666

256-1531

Systems that don't b i n back! An you ooncernod

that ynur Vonlurn Publlshof and AutoCAD soitwnro wen‘! run propcrly m1 a Local An: Nntwork? IMT mrodueeu Norm Marias‘: most exottlng und rollnbln LAN q m m , LIFENET b1Unlvnrlhn. Sulh G08, 8-37 W. Rating! 3!. Yunoouvar 5 . 6 . V01: 1 5 6 {IBM} 683-5542

lnlu-gralnz-ntl Micxr. Tanhncflogv Inc.

zficTbeComputzrPupaaugustßü

,1H:

'1m3: 124 y 2A

mmwann

IBMWMcu!

sauDnmsnhh

Innen-via

um man:

Ca-yMuyh R n n fi u h p

„u \

‘

‘i24

1* 14 u. u 3.‘ u 1 an 34

P4 g?! .‘ 24 24 24

‘

zu u

‘an

ItnußoIBUTMmDepu-max.

IBMopun

J u l - w g

‘Irrsinn-inne!

Saldm mMDp: mkRaA-nhaamtn

Ccnerlelnssdhnn.

man;

DJlnkhm

zus-a.

IBMPhaaü B q m Basel

31133401:-

n: Spur

IBMFIwJLI lauen-t m4 au.

F H W M Ä L I B S - P fl l fi y m l fl w v fi ü

Ihm

umFuo

opu

hat-hält

1o: Smhh

wwnr

iüküunaünidumhüday

Pa-nmmm m!

cum-ans

Au-onWu: DlqtctTylcr

Nu-L-umhgQuEkHBSmdIHSTDMB.

Cvu-dFflnMms fl a u m i g kann!

THMOpIs

muouicmßs

Jmin K m : Tad Pbwvll [akute-

Tcchnolon-Bnnd B55.

JBMOpI 55401::

Duöclafiuffmfiy 1000p.

IIMOpuI

AIDS]T1111;h fi ä fl n ü s .

EMFHnHv

Ilnflmaa S u u fl ä h ;

i C i fl L m l fl k fl ü fi b

ISMRBH

Secfimfcxvioaxmvcs.

lhünnch

[BMRBBS

kfllndCaug DnuMcDuuld

E1909

Ins-an.

Immun

mnwauux

muopuum ‘raue

XETIXMULTIUE. 333.973.751! V-umv:

S! lhyiuuad-cfwnuflanfmc-

Goafiääfmnufidmin. ‘surTnFüxm.

Immun-PC

.24

arm ‚i “34

Vmnuv-"Imlgihfilßflfiiflflhl Pymununuhnduthnraums.

13140;“

.134

Faun-b Pan-SO. liilikflfllflul

IBM

Laub

111541351.

muiums

mHOps

Dadäcmdlofiml

man

w‘ um ‘

‘r Kurmann.

Kaufland:

935-2390

j 34

John

533.101; 875-978:

. 1M

k a n n

man 3d.

Fänndy kfln‘1 x 5 1 : Cnnnuü—

Cum-Ehe

Dipkäy Gnu!

0 0

man“:

Mai: kann: nimm:

957m

Bigband

namens,- n:

163-3043 9245-5192 931-696

m . “

Duu-ähhnlfiu Qualm an:ARRfiH! C1193!!!)

571mm

man

3-073

5144m 111-1032 591-9633

wenn»

MmA-luelfirlflu cumpunmhm üudvuup ATAII-I—d 9,1m:

I m :Das

nilämumn PUB Nimm!

snrurnTausch’ B85

Yallowhund Shnfly wusch

1M ,M M’ ‘,1 «

OuuunMEflB-BSGJ

Kamin

Gummi].

aus-Nun ä m fl l l fl

cemmmu

Cnmnvbim

(‘h

Genaue:

Sang:

CnnnAABS Cumnmnn

515W?! 81-3530

273-5394

muss m a n 813-3610

2796575

man

u 34 j‘u

commu

M u m m

k h g fl S i q

Ihazücfliuu

2I!

cum

summa. man:

m l i fl i fl ’

zum man

Cuyljak

Jetuoyulul

: zu

TJLLCE.

k a m ;

‚s *J4 m:

Cnunllu

5302m MIME

1314966

mu-amdsycuu

wmsum-

; 24 z:

man

ran-nass ‘rundem;

33-3897

srmnmvd

9394m

Jahn-lau: Gabe’: Guck

man:

Subny

1 11

I. zu

5314m

Pqirhicbcnb 1155531416:

‚

Umland C u m .I I I : TkFmtcIn nun-dennM m m

Einmal-lau:

OTEIR-IIJOIHF1

äummm

g;14 M

ü w fi m ü l ; i fi n x .

IBMHHIJ:

Icvhüiflan DahbiCocpIcr sinkt-h

Bauraum

man-immun

fi - E } .

‘we specialize in "in offloe" training and updating.’

-l24

ßFIyMltMNaHmmh-fllflilpq

225-9705 SN-IMJ

MAC-Baulärm:

Hnc

UPDATE at 688-2727

"M {u 424

EMPCMId

Immun

Wnpzfluü

33-1148

Why waste time and money? Call

mmopus

Bzylalndhd

Mumm-a Llrmhu

rwo uns

i O 0 0 C O C O O C I I O O O I C U U O O C O Ü C Ü O O Q

A1TflEN11ON PC USERS

13s

12l u

ai-

"WHERE COMPUTERS AHE FUN"

New Locarion: 2 Blocks W23: ofBaundary 3524 Kingsway, Vanoouver. B.C.‚ VSR 5L?

‚

‘m

.22:

flandlmsehdmdpnnl!

Vancouverls Bes: Sskcxian an. C-64 & Amiga Sqhvare

435-01 13

uns

1:4

1294m muopunnan mnasnpa-Lnuumm Kavhsmlfi muopu:

5M u

Nun uns 14x61mm}: Mhdhialdlls

muopu

Bonsai

.24

5 m m

e: 585-3122 321-1385

Dnnkais

24 *1 u

zum arm:

man

m m 6

Hand

rm1.".

hbpdüCouwczim

Microcorrxputer Equipmem SALES n SUPPORT n SERVICE

110%

2768MB

Dnflot Dar-ans

‘JAMES MACPHERSON. A.SC.T.

nno-u

521-0356 32mm

:’ * -‘ cunicnßs

mm5:

nunmamans

DSSTelooa

4101-11524 56191 51.. Delta. a c. w». 231

man:

635-7621 430-9441:

neu-um

DELTA COMPUTERS

Hast Type

55'501)

‚in

cum u - a .uns

{Benperfnnunczfiau-vbungnnflumflnrdmmnflsflmchfl Miene: 874-7147 Confinenhl Com lm4? W. Broadway, an,B.(‘.

=i gflrs

SÜß-BIN.

Bau-r! li1yfgnx

aBurnnby aus

S1950

Phon-f}

lau-nun Systems mJwMH-fiil AaInBBS

lnxbGmLhc Mammut.‘

Brand New

Bonn! Name

z; M “1 2A B4

a: 1u „u

„ 1

‘fu ;

zu a u

‚ M

‚l 1

533-2312

1u H u

mmm

M B B

3627i 600-5061

591-456 WY-Mfl

KHIBKM Caen-Laden: Cdn

CaunVHm

Il-Iund Cmuflbaaßd

m a n )

926-7192

‘ladet-Instinkt!

Dr. nun-q

Oammjlnaßi

apvam

G335

Gmfl

AmspnnsPc-m

n- 1mm. uns:

355mm.

Tabu-umtaus-

Dllmianm

1351515“

„ ä “ ß-PbyBüId-Noichnulmfl... PaaaDunncnmionPaI-hi flPhyhamd-läkiyan. NBCUHI

1mm.

AuiUnu

Sinkt:

Pwßch

AIfiIIIS-FC BEIM’

Rad-Ihn dann

PruflLIhhrndDnwAnm

man

Glhndzhum

nahm

;

üfiuhllryl-hus

N 3

hat:

111W 015;.

Immu-

311an»

11m9!!! 3%

Fa-uxlyflßullfivu’

125mm

Hflflflflb

nimmbmuuuammamvmuwuunndgcmmxqaydasymnapmgmrwrmsufwuHsvammbwa-flfl-nflrmfirum-Ilfi-lf plhIIInqdlqnrqühnnnRlbnqÜ'CW}Ufl)hfma7dnhhn-üäflhbr; ' üwllnh 24 muqaictnns um 11 736-7235 I! o-mammu 39-1185 Phlfimfin ‚ Cuylhuyh w... m4 ‚ A n m wunden: n u n : Nutnnufl«

121x005

1324M

Jul-Hub

USE THESE NUMBERS WITH CAUTION: Hanse veflry ihm:numbers manually betone yon put them on your autodhler. Cum has been tanken in Imembllng these nnmbers, but mistakes du knappen. Hnve pity on the paar suul who geb awalmned at 2 AMwlth a arruming modem in the ear.

ELECPRONIC BULLETIN BOARDS (BBS) FANTASY PARADE-E BBS 263-2682. 300! 1 M , Young pcople orinnted. WONDERWORLD 937-7542 300 Baüd. SUNSET BLVD. 298-3530.

CATALYST 872-6968 Polifical acfivist boani nm by Pnblic InformationExdruage Sociezy (FIX) 24 Im. 3x1m4oo Band.

SERVICES '

Cousulfing ä Training

* Database Design

' Custom Programm

* ‘Farming in wmdPufeot RBASF. Assembly Language 8LMSDOS "Hart! DiskBmkupfFile Mahnanmo: Debble Cooper Consultant (604) 738-9440

RENT

PERSONAL COMPUTER

ENJOY THE BENEFITS WITHOUT THE RISK Ü

Puhusuer

A 1117:2129.

+ Handbuch 2nd 5.2 Us g dBIII+ Made a-z ' PUBLISI-IING n rrrop 4131125 (u: Pub Dcahop Dqiig:

DAH-Y

WEEKLY D MONTHLY Ü OHLONGER

1cm:

man

gumulm" MS nos 33 paäunmnsoos Guido M;DOS Users Guido

Wahr6112011 12mm ücVunny

MiGEORGa am 33295 Prunk-Hall 522.95 529.95 Quc

Misming m m 9 mfideAumcnd9 ABC’: „ m m 9

Ohm

Sybsx New Ridar

hfillcx

Sybe:

543.50 353.95 331.95

Ashxon 7m S bei.

Cowm

ÄcQawJ-xm 529.59

3.355 .

M wird cmqmum‘ n»fnrfhc

Cobb Komm

327.95

NqnmUtilities 4.0 SHITEWII‘: Bock. Ptpgmnnfing in Clipper

‘m; 522.50 MoGraw-Hil! 521.95 Aamammmeymtas

Uäng 1-2-3 Special Ed.

Quo Cotp. Campbell CobblCrmm

Qu:

534.95

Beacharm Kelly

Qne Sybex

528.95 523.95

Nfilcs

Publjshar

Aürocm

Ramme:

k5nnen 11Anxnuoaucuon 4th Ed. '

MäWorks far pc

298-5966. TECHNICAL WEITER Im’ Software & hardwlrc uscrmauuals. Yen’: of cxperimc: wixh ccmplem appllcazions 8c ancmmfing systum. 375-9609.

53.420. K a m m Paul 731-7917. EPSONEQUITY n 4o Mag Hm:Dm:a; fixen FX 286 Wide Carringe Primat ü:

uomssofißs. 51.999. 872-3451 was. 8cwoeknds. APPLE Ih-JAGEWRITER II LQ, 15" anfing: nur:und. Wmxnly. 815W. Evenings 733-

8379.

M;wem Made 19.2

m”“WWOUSWM

COMPUTER

HARDWARE

Radio Stuck 64K W120i! (EMPUTER2. will: mngazines. Zjoy sückx. mocssorics. und 1ms of mftjvare. Asking S120 OBO. Phon: 322-5924. Axipuz 405c m m 1 ) DISK AND TAPE BfiCKUPC-wfiuiflMBvzpegh-nonths an Apple Cm wmmzy. suggcswd 56,019. asking

xwäscnsrrosn

ABILITY

681

_ _ 353m3:

{Aim

mm W w m }

1.23 wenn PROCESSING

Qgmcampum U

f]; 7555g: OVE SOMQCE

‘

‚w c‚w‚gp‚| w‘ C M } ,WER

WordPerfectSrdEd.

3 “ “

“"95

MoGnw-Hfll 327.95 Cobb 332.15

Minczbcrg

MJH

829.50

Bcrmm

529.95 828.95

magingyouxumm

I/ARDWARE;

bb Graup

uzexawnm 524.95

Stammt:

man ms:

“ m ”

SOFMARE „E5559“

wmdparecäq Word? an Senats. uucms.

_‚-

—'

Stmley

Made a.z_

äu’

°°°"'“"’ FLSIC‘:

uns

Lagyfjglgfi’

924.95 529.95 332.95

Chronist: New Eides Sybex

111.121) SOFTWARE

PROGRAMMER sadns wart with Database: (dBaso S: Clippar). Lemrc nmsages for Andy

531.95 Que hicGraw-Hill 327.95 Mcüuw-Hill 521.95

Bast

[nahe]X

caimcam

Bracly

Re erence u‘ m H“ 57.95 Microsoft Wolverton Disk M m g m m PROGRAMMING IANGUAGES 019m Moflraw-Hill 535.95 Obmpleze Ref. mm Pascal McGrsw-Hill 53.95 3mm: Pock Rot‘. c. Prenfineaflnll 539.95 2nd Ed. C:Prog'm Lang. B.C.'s umher: Thislist Issponsored b; otcompuirr bo-oks. Iargest lt i5 oomplled monthly by Compullt Dhtribumrs Im. '

RADIO SHACK CÜLOR COMPUTER. Disk Drive. Modem. Aocessmim. Lm: cf orig. Software, S150 0.B.O. 322-5924. 21319111-1 2181Laptop (MS DOS 3.2) 540K ZJÜZDK floppiu, 51.800. NEC P6 Pinwrilet Dot Inatrix '24 Pin 216-65 CPS. 5650. 1mm 731-

7779.

WANTED W m w d ; Ami sharcwme pmgrams. Tom 877-

0885. 5-8 pm.

SOFTWARE

—

Winubasc du: mw IBM PCIXT/AT wine education Software package. Colnrfizl mnps, 100D full Wim: dncxiffinns, culnplclc mal.

swaemus und pricc 0:055 referencing. buillin eßy one auch picmrinl band dncisinm. und man. 5 disk pnokaga. includes frea Urin: norme, hundmmry oflu Smnslfine Sysmns. 548 Bearry St. VmoouVH‘. B.C. V68 1L’: o: phom 662-8593.

3727 W. 10th Avenue Vancomrer. B.C.

Yes!

525-„50

Wecmood Hall:

103 IHM ‘3 Rand, mchmnnd. 8.0. 0und1 VCX 202 fNQZTIrTIBB

46445515

Canada

Portable Computer 3620-244 Süeet

Private: ackamfrmBun-ingssadsucilfi for25 wordsorlessplusfiflwcfdßlfl forboxcdads.

Phone m’ warnte today for

The Computer Paper 3205 W13th Am,Vaneouver VGK 2V6 or Call 733-5596

‘r’

Goquluam

Private Ads! [o

‘

5 Neu. was! Quay: 81o„Fron| 8!. i. Nun. Wntmlnater

2-3000 Loughud Hwy

Langley. B.C. V3.4 4P6 Telephone: 1-800-663-1061 Vancouver A r e a : 534-6441

Mail

(6041222-2221

352°“ WWÜWV Blvd, Vanoouvar 5.0. 228-4741

fiee information fit.

‘T11: Computer Papa: August 19-58 v2?

FORGET THE P OGRAMMERS

When the sdft becomes too hard

Switch to MULTILOG The Bottom Line...

Coxsmucnon corsrmacrons live in a competitive environmenL Ofien when they an: askedtobid 011ajob, thefumm oftheir oompnny can be at stake. An cstimate error in a SQOCLOOO quotaxion can be the last mistake a contractor makes.

estimafing System

implement. 111c)! wem thmugh all the

späcial mquircmems to b: implemcnted right down m what the

display scmens would look likc. Through the power ofMultigen our Fourth Generation dcvelopmcnt language. we wer: able t0

2nd efficicnfly develop the Software System needed for When Dennis McMum-y. presidcnt of Sentrax Mechanical quickly Sentrax exactingly done to their spccifications. Contmcting Ltd. (Smrey, 3c)called Mulfilog. hc already had requested another softwam house develop estiinating sottwam jIn the words of Scntrafs prtsident. Dcnnis McMuruy. "Wo for his company. ‘Theprogram design was started, rhenhc got the a: othcr systcms. Most of thcse wer: more expansive to bad news...fl1e program would cost tens of thousands of dollars looked Off-lhe-shclf man to d0 the cusbom developmcnt Ihat Multibuy t0 mcet the very specific roquirements of Scntrax. did for us. Ease of Operation and scirnplicity combtned with log was the critefia weoutlincd. a_nd Multilog dcIiv100% accuracy “that's when Dennis came t0 Multilog. Sentrax had t0 submit erefi." a 53 million estimate in short Order, and nooded a reliable Software System for both the control and the pmsentafion of the If you er your oompany an: in a similar Situation give us a call estimate summaries. And they needod it now. a: 681-8100 and we will do an analysis of your needs. Ifyou like referenoes c a l ] Dcnnis McMuru-y at (604) 596-4468... wottld Wo put orte of nur Multilog specialists onthc job. He estab- hc und ovcr sixty rhousand othcr satisfied Multilog customers lishcd with Dennis McMunry the exnct specifications of the amund the world an: our best salespeoplc.

North American Operations 505-1231 Wust Georgh 5 m s Vmcouver EG VGB 317 Cauadl (604) 681-8100 Toll Fr“ in USA. I-8m-663-3584 Vidaotax Mullilink (604) 681-0124