1988 12 The Computer Paper by The Computer Paper

4 | N 1 28 P

p n m T E n I EGA PFIINTER PACKAGE PÄC KÄGE

CÖMPUTER CORNER LTD.

Vafu-c: afu-ce “Pgwer, Flexibilily, and Superb V “Eurer, from ‚Hewitt .Hewitt Rand

OORPOHATION

a new starggrpgqaüioxßallence standard In axcallence

H’286 2861H AT COMPUTER}

00x11mm mmmnou sankt: mmmnonsaniert WRJÜSHCOUJMBINS nxjfisnmumswscomrunzx

01400111 GWIPIJTER

. D f l ' E l . I O 2 8 6 l l ]

‚

RAM ................HCCCIIAMIIENI)EYOHBOAJID ................HCOCIIAMIIENI)EYONBOAJID

UDCKSPED GDCKSPED

IUnEI-IIESOFTWARISWUCHABIS IUnEIIIIESOI-‘IWARISWWHABIS

moniwmmrmswemw Wülifllmllfilflfilzlfl-n

RBALHIEWITHDATIEY lila-U? REnL-flIEWTflIBATIuV lMI-U? BXPMGIONHßH...IHIU.lflÜTIISLflISß-IBII‘.6I6Bm EXPAIGIOPÜSIDTS...IHIU.IHÜTIISLHISB-IBW.6I6BFD DHEIFICBPORTS... l-PAlfilLüüiDl-SERIALKIRTS ILNTEIIMCBPORTS... I-Püiuüflml-SERIALKIRTS

5113MB! BAYS .. .. . . MMLP STGIAGE JJLNIP IQGHT HHGHT STOIAOE EVKZE IAYS BAYS FIJIPPY 05K PUMP? 95K DRIVE JULNASDHIILDGROPFYNSK JMNASDHIILDGHOPFYUSK DINF.

‘

W D H ) C A I D ........EGA.COIJIflI.A.P‘I-DC5V|DIOCARD WDEOCAID........EGACOIJIRDIA.PWCTSVIDIOCARD m n o a m . „ . . . . . . . n ' r m u m n . u x m . | o 1 uns IEEIIOAIIIJ.‚........ATSTYLEHHHMIIDJOIKEYS

"2_.'_.'_I_.‘_f'.'5'.':!""“ ‘I_.'_.'_I_."'—_.....'I""" h-‚-‚-‚'o‚'u_'._'.'.

mmnum........nurrsurmlumurwcx m mrrua.......nurrsurm|umurwa

mmax...„.......nmimmoo4-

KIGÜ MEG. HARD D|SKJ H140 D|5K_j

ifiinux..„......fififiänooa‚ammmusx M o o u m m m u s :

snu-nucuaumommnvx SIH-IIJCHAIFIGIGIITDRWE q WwAnT InImA x Q R DwIwF L w IpI uP PxYoD t E KmÜrI I u GwJ nE

COLOR E1QHIIOR MEGÄ ( E G A COLOH L1QHIJOR I| a M | a w m Mam u nnLu-nm5a4amacmosz. nmcoton. IPSCIEEN .3! MIIPITCHALBERTEXTSWTICiLE-DH X 150V nunmalmmcvLAmsamx-rswmsnumxmv _ M" PWNTEHI Ü 24 P|N U PRHHZEEJ Im I nn n t i m : nun Ijlliilsl rm1 r H

’*

. . . .. . . .‚ .„„ ÜWG 1W I1T 1T IIANDHRJUDPINTEI ÄNDHRWÜDÜTH.

5'359

5-3. 3| 13;‘.

F E. AÜ; _‘_

wmm

ONLY

vggitt;

’

pu mu nx uu aw nuw m n „„ mmumrmaanmmnnxynsmn cm r n nmmobmmnncczzmmuu mm mm co ro w m ca m mm m nv nmxaannnn xx m mm p w

M u m m :........ ..x>nu.l.z.csm1amucs INTERFACE „pnuxacamnmacs

I m ‘ ! ! ! . .. ‚HIICIIJTBNALBII-‘FRJEIPANDAIIETDHK mm.............1xmnmuxm.mmnummnx

3 IN 1 386 Rand COMPUTER? compmsnv MONIT.

Hewitt Hewltt

CDMPUTEH'PR|NTERI CDMPUTEWPRINTERI MONIT. aPAcKaGE momr. aPAcKAGE

vom: m:zzzzjz:izii:z‚-‘mm°m”h

44IN1XT IN1 xT

a‘

‚

3 . - . N ‘ -'._ an _ ._

f u g u q ‘H '|| R R‘

-A—----"°C"34'°WT»57Ü’5"LO FIlP-II-k m: mm FIll‘-II-I<I'.\(|\\I»tanooLmmmne ‚M ‚ N Ä M , ****"*"i*' S-DITERNALIIIITS mm: DRAFT.PRESIIJG. mm. PRESTIJE.oxama. 001 mmm 3 0113101. man. HILFT.0

;„

uyomr

c°„„„„„o„ COHPORAI-‘OH

a new standard in excellanoe

“ CCM PA K ÄGGE E

PACKAGE PHICE 51699 "

omnu.van

rrnuocmlvral

9€ wann:

oouonomunu;

In:a u c h an l a u t )

umzunono IHN "IHM-UNI!!! 1J) man:l a u

RElL-HMI ‘H11 REAL-UNI um:BATlilYIACI-Lr DATEI Y IACI-L I‘ - man IIHIT nu Null. wmrm IJENFTH sLoTs SLOTS 41 m. ‘I-I n aBIT.) l6 um (1 a: n n . ) |5 Im .

1 ... “IIALMKS GJIICflJJUAI-u M 4 1 8 3 I'ma WITH “ IKTTB!‘ n u r ucuwr INCDLIJF

l-PAIAIJJLL um nuuuua. 0-1! z-suuL I-SRIAL

DIFAMHIIIHH ... . . . iiGRHJLLLIIÜTII a n H J L L | . n ü n ‘U75 |anu

IIKID

ATMTLI Ü N I K K D KIT‘ . .HllXHVEL 11l arm xunxnownn: I 5 1 “W AHLEN} man mm. ........ Isst"W115 um:

.- IAMAIOMCIOXHDFPY DGKDIJIFH noorvnuunnrmmmcnxnnm DBICIIJUE Y f ü l ß .......„ wImflu fla o l c uIr El m E aA mDn Xm t A mI

" -

UIITII MANUMS

„....

...

. EI In"nHuA aT m ‚ Hm @ Mn (cInJmEmG

..JzammmoELrma-Inuw .IE.lflA'I'HHmELJT3U-|WMEG HIIDISK. u u n n s n g AAm1a2 s r1lT“:M t u l - ILSI! slt

‘i

HAHDEISK-

FACATEMODELSTÜI-{MAILDEISK

‘ T fl m mcß’mi‘mm'm ' J4" 5-’

„A. Emlnm.

'°°""“""""““'*"

nur!mm m“ 0° rancesma 0o " m :Esso;

’

‘W1C H n l IT n u“All! a l nDill m s x( DmNrI RmDmL x L EaI

I n E MCIIELTILH ooanm uoeeoconoul tanzten. IIJPKEIDOIII II" s 5a 3n !n ‘; . lfiflffi.n‘ lflfil 311111151191 HASE

[ g EßEnT S s WwInI C c Huuua jj figfi n f Lmflxi k

OPHÜHLMM

Max-Omasex: unsooum MIJIIOGRAHCZG VIDEOCARD n1m1ztmuucsano: q 1 s - n u z y q a _ u u c s n | o : uns Msnoswxaaououwusoc" usnoswiaaoumuwusvc"

. ..

Ü Üi’

ON1|I'JH..‚..

IMJIIWJM Lwuuuu PUiASm-TC n mmsomc l an flll n FIIJFH" o m ms: (K um muva

. .... .HIALF . 1 . | u : HEIflHT ; H : u J HS rs IrEm HA <E:II

Ü fl i l Q n ‘II ... PAIAUJJ. um sEauL 1cm’: PAIAILEAHDSEIMLKRTS noaamum ...... ml-HAIJILDGIHSTOIAGI a u n n m n fl o u c l u f inuz.

.. ..

‘H.

„m.

..‘IBUITI'[ANDMXELTTß

ncnocnauun M u m m .

|2" „ ‘T flLY 9 E E E W“ , “"4"”IXJIIES,"U SWWH m “ llßl’. “"-

DES KTOP PUBLISHING DESKTOP PUBLISH ING

HEwLErr PACKARDu-unxru PACKßRDuunxtu I HEWLETT I |I EME ÄÄ M C Ä Ü RC IÜI Ü W OX IO M I NM KVÄ W1 S

% Computer

684 0m .. COMPUTER CORNER LTD. 7k 7‘: ‚‚63:;?2„7_;„ 7*‘ 7% „_„„‚„‚_„5„

„„„_,5‚5„ w.Gfl°rgia ‚„„„_‚56„ s,‘ W_G„„‚Q‚„ 3L

Oomputer Aided Design Computers in Education christmas Buyer's Hot List

_ %

. L

FORGET THE PROGRAMMERS

KAYPRO 286 Here's thcNonh Amcficammdc Computer that kicks out all your

old assumptions nbout the cost of adyanccd zcchnologyu

534c,- mcsc {aus abom m;

Co"-

KAYPRO 286. Ar its top speed of 15.51512‘ (h, KAYPRO 286 is fastcr, yct Icss ex pcnsive man most

Standard

’

doesn't mcan rcinvcnting the Whcßl-

C3171 bascd

535mm mmlxmenß board iflCluding lhC out for the ultimatc in built snnp -in non-obsolcsccncc. Don’! Pkw catch p. Kccp up with the bcttcr Power machipcYOI" Amhmwfi Kaypro Dgalcr 1s

— '

T0345)’ 1° EWG

386 „ m m 5 ; And Wim the OS/Z -compatible KAYPRO 235. adapting to the rapidly changing Standards

YO“

all the dctails about the comP10“? 1in9 °f Kamm desktop and

“Flop COWPWCTS-

Micronltworks”

‚a

‚.1..-

Constway Systems Technology 989 Wust 8th Avcrme Vancouver Tel. 736-5039

1,1mm!“ kann um im

R. Canpcll 8: Annoclutes Inc. tt7Sl5-149A Street Surrcy Tel. 597-3! l0

Camhddga Spin-m Gronp HOG-SOGO Kingxwny Bumnhy Tal. 4710.73.55

gnages"

-G. Pantone

I-S-i

‘kann d l t l n l t l . humiNtIIhlJ-IH:

Laut mm,

Switch to MULTILOG “Application dcvelopmcnr und modmcation is quIc/cer wirft Mulrltog than wich a convenrional languagc, programming Muttüog is accomplished a: a much htghcr lcvel than conventional pragrammtng lan-

i: 8110115 MHz

w 0812 conmtim i: 40MBHut! Disk a 1 M8am

When the soft becomes too hard

Richmnnd Tal. 276-2983

2m“flI" ‘Wut-out Cnmputcrat 1915 Lonsdulc Avcnuc Nonh Vaucouvcr Tel. 986-7680

lgrsköldtiö Mkro-Vtslon Computers gzc-‚mo gowm am Nannimo Tel. 756-1933

Delta Computer: #101JMA 56th Sn-nct Delta Tcl. 943-3331

wlnrd (Zomputcr Sytttcma 6032 Fa,“ 5mm Vmcouver Tel. 321-7144

H61 Mdvdlc Strcct Vumuvcr Tcl- 682-6488

(Mamh 1988).

Undrlct Enrerprttes Manching: mGo

Takc-n-hyu Computern MHZ-NSU Bridgepon

Fmfld‘! Tfchmflfl!

..'.Likc 60,000 customcrs and 1000 softwnre houses in Europa. our Vancouvcr cuslomcm havc choscn Multilog and can mly on a pmduct (hat makcs it the unanlmous choicc among thc speciatists slnoe 1982... Alplnc Indnsrrm Ltd. Flashmadla Advcrtising Ltd. Summa Supply Ltd. Sentrax Mecbankal Ltd. Colombian Cultural Center Hallenbad: Digital Cqfc [Iraad Garden Catgary Winter Gamr: 1988 Chaflengc an: Marketing Dnp Saum Data Hlstortcal Socloty ofBriäsh Columbia

Island Mlcro 151 B h s C ‘m

—Weck

ahdi! ‘ "I.

am;

. g

North Amcrican Operations 505-1281 West Gcorgia Strect

Vancouvcr HC V615 317 Canada (604) üßl-Hlm Toll Frcc In USA. 1-800-663-8584 Vidcotcx Multilink (604) 6810124

1l.N.11cember 1988 Laptops

19 A Bayer: Guido zoLaptops

Chxi: Motten revicw: du majur Ihings In oonsider in purchuing a Laptop.

21 Iapwp Smvey -...

uuuuuuuuuu .-

Wohat munbhd l oollectim o! Laptops xvaihble in the 10011 malte: to m i n you in yourlmying

_‚..;_-_-a‚ "w

24 Review: The Maximiaer

The Computer Papersiafl undfamilywish you tho Saum’:Bast. (L 1o H) Sarab sangen Slngh. John Oliver. Llz Grant, Sa: Slri Singh. Guru Sangat Kaur, Hai Atma Kaur. Kimm singh and Ward Slirral

Woinchnde this revicw in nur Iapflop section heenuu i: i: nach u graut oanpnnion produe: In mmy llpiopt. Ideal fatale: uns!l0 kcep F0 otgmiud winh lnge mnnbm of

.-:;.::E2 nother busy month in the computerindustry. The whirlwind of Comdex

is ovetjusl in time noget ready for Christians. This month w: look a:laptops. The desire t0 have easily acoessible a powerfuicomputer is driving dcsigners to push ever increasing resources into developing portable tcchnology. New screens, new power sources. larger storage capacity. faster and more powerful chips an: evolving the laptop into the Computers of the future. Now if the prices would just evolve down. many more could afford this style of computing. I was in a computer store ieoently and lismned to a sale going on. The customcr had gonen a price on the Same systcm fmm a large discounl elecn-onics store. He wantcd t0 know why he should have t0 pay 52.00 more fo: the same hmüwarc from the smaller retailer. He acknowiedged the differences bctwocn die style ofsale. Virmafly nosuppmoompamdno amore knowledgeable sales staff, the reality of lower volume and higher overhead attalched to givingafuller Service. Hesüllwanned abenadeal. Aftersome timeandoonsidembiecalculaziontheprioedidoomedown-butonlypanway. The customer was reasonable. He wanted t0 buy fmm the smaller retailer becausc he had had two previous oomputus, and he rcalized the difference a good deala- can malte. He srayed tohear why he should buy. Many don't. lt is always a uade off. No one likes l0 spend more money. but in the lpng run a good retailer can easily pay for a minor differenoe in initial piicing. With

mingsfikesofidrecommendafionsforsoftwuepmchasesmcoessmshamwam libraries,setting upharddrives or nfter hours uouble shooting for loose cables orincompntible drivers. Sothink about it before you buy. Wim: xeally i: the bes: deal? In our ongoing effon 1o live up t0 our mandate m be B.C.’s Computer Infomiation Source. this monthwoarc welcoming over 2,000 school Computer zesouroe people ‘undschool librarians tluoughout the provinoe 1o our disu-ibution. Wo havealsobegnn nnew sectioncalledCounpuvus &Educa|ion in which wohope t0 nach: some of the activities and events oocuning in the field ofeducation. Compuners an: having a Iarge impactoneducatiotujustas diey what's M . " affcct almost everything else we da.

hatleßfllfflmflksmthoseofywwho oonracted n: on Mindlinlc, die Bulletin Boaxd System (533-2312: Ijrpe: Compuner Papa" when asked '

foryourname.) Worcally the feedback ithelpsus stayin touch with the thlngs you would like to see

mmeofinthempufllhesunisamfing upandtheprinteriscalling. Untilnext issue. Seasonfls Greetings from all of

usmTheComputci-Paper.

Kimn Singh Khalsa

contacu.

Computer Alded Design 3S ‘fhe Architect 8LThc Computer Computers m: fmallyuudng w nmke imoods im lhk pmfsdmi. A ncw

prognmfonheMacisnmndsenuin converfing profmiunal mhiueu.

36 AutoCAD Tips

[Atcters Toffhe Editor New mucß: im:R0

Mgmjrgfifimfi’ 0a„a; M m a n ;wugmy, April 19 JIIII: DOS/HIHKDHVH

‚_°‚;f'*“°“""‘”"“"“"" cma ‚u Dndlhe: Püday. 3ms 1s

L: was

28 OPUS]

Dmhueinlcpawsgnpmamaflmce du mm5:-

9““

MAC SOFTWARE

27 ConvertUruts 0mm! Profi-c:- w» oonversacn qu Vfguvu

B‘;3““

CUIqdCX ‘Thuhuleolddealettcoxweumonln Las Vegns hll tvnlved in!»THE Compmer

u n d “m , “

BVCIOÜÜU

YI.’

Ehe Pacific 121C? Shoxgm*

mwmgm..w

0.....

33 The C0101’ of Black

Vumouvu Mannie Pubiishing Associnion haldadenipioompnflfim Vmcouver. ü!Golf Willi ‘Die runlu. die h a t duhop pubiiflns

11 “ a m ”

q: 3 T

‚rmmäwn6:. FAX 7““

COMPUTERS 8: EDUCATION ........

1° 19'“

‚ u

prmgnm.

COMPUTER EVENTS

g wir‘F“m

27 DeskPaint 2-0

.- mh rnaswmwoimnam. -3 Bookscller’s Bestseller List „ÜEVTES 7 7

plnlmge puls Ingo eolleonon o! gnllp-m ‘F’Ü 7 ° ““'18”?

+' ° ' : 3 Classifieds Aas

wbü

und 110W S ü ä !rtfillh.

userja. Friendly mneunnewstpplicswvnegfimd:

1‘ m“

Call for Advertising Rates: ' 733'559‘ ‘

Pregteuation srtphia an marred

g C5410” ß G a g e ;

Copy M Dendline: Fiidly. Fehnmy April‘ Srmflüfiß‘!

E.;.Ä.;,I.:.Z.I,‘.:...

acta?! Todmology nCompuner Calendar

F"""""""{ä°M Mxßfi? a n

24 Pi

mavuinnonbigger

‘;'5.‚','‚'‚‘1'„'T”n„m'°"-' ilTnÜ"°'"°'u.Ax' “W7 "n"? ‘ V W ’ ‚

___

PC SOFTWARE °

Th Masth ad

E _ R W ‘f

‚.

Buyodywbalyounudwilhlflais I n : expcnsive raue in CAD dnwma.

REGULAR FEATURES

3&1‘iworry b: happy

42 Review: Generic CAD

.‘

wAutoCAD

lny mm’:

hV gEtioIhowme1rsmfi’.

42 The SharewareShc-‚lf:

Gen: Simmonch keegi u: up wdm

"Cmmvmdmmmmm

41 ‘Iwwsl-lypucaflcmp

717cc»: 1988 o 3

ribbons! . - _.

. v ..-„ ‘anhält: lIIl-Elnl‘; I00 r n x l - H 0 0 i n ! ” I17“! 1 t

m a n nun» m a n : m a n ! ! ! a u : um m: um. D00.

ranuv wenn

;

«H

"" m" im

ein

LET US KEEP YOU IN THE

ontoßlindüaet’: 88575312312) M: prwcd lo b: a very nurcujldnuthod ofconwwnicalion. A: aanotlw’ BBS owner Steve Bare? of Cililinkpoüncdour. EbctrorüL-Mailismeasy an dnalwüh. Saneminuapunhecaaqrqalyfiq I0 a Euter aup 1085.00 whunyou counznanpa, envclopenszaxionary, younime wwrnc ü‚prü|l ü, andmail ü. Will: zhcfronic n-lail.manman’!can b: ‚an: MJDJu-afixor lest. Nofiax. nonunJlnd ywcmcanmmicatc wüknenymorepnmletflaan woaldordüwilybepoaslbßmmyrarzow prucncc an Mindlüik cmainly go: u: more m i t . Her: an vom: oflhe Mangas w: 3d.

XERO ‘n’ H1 3:". f

z‘,

r'f’

Okidata Laser Printer Supplies Drum Kits 5289.00 Tone: Cartridgcs 539.99

BLACK

Der Computer hpcr

Hcreüyomfimeonuibuldonvinwlind Linkfhn logonmeesageloolafim-Ihopeitleadsiom naive pmicipaticn by lhc loeal oomputing com-

Okidata Printcr Products und HPLaserJet Supplies

mmilyhhmhfarüacuficloyoudfidlmmodb onCaulynBBSSn: miclc ilselfwnsmunnple ohne o! die uns ofCeulyst. Thenory w: typed inm aflleon lhcCualystßßsbylhewi-ituinlm

also aveilable.

ßfi-gu

WFTH HIBHONS FÜR

Hard Drives

MAKES: MD I00 I I : ‚Uni U I I I I

rr. im’...

ä u n u IHN-III 1 1 t h “ : II 4 0 1 1 D1!!! 1. 3 . 9 u m : u m : a m “ 101.100 IHM-III: I n : n n l a n : H u m a n ? Iw-I I M H JJHLE.“ nnu I I M I I B I I T I I llrlflllli IDU m-n l c. u m : nnean c m m l c : Inl-ln, n0 c n u l u nun anno Irrrll l Incl: u m : runtn nwm n u n ? ! van u: JOHLIJ III e i n nun nun-nun: 1 M “ 1000 n: uns

Central Business Nachlass Ltd. n- 1035 Richard: s1. V‘"°°“"'I 5' 13.0.0.0ein

MOCOOI:

buernenLThc odiMoldneCoamute-a-Papcxwu lbcnnbleto 'downle:d'intl:Cou1puIetPepc oflicc. edit i: am! am: i: im: Ihe pege laymn puogxun. Eisewhere in nhi: inne you will see ilstmctim for makim yow own oonmturlm.

Special Installation Price

20 MB S449 30 MB S499 40 MBS649

placingnnaorwrilixunleaanotheedimrdl wilhout luving your inne!" Peter Millcx Cnnlyal BBS

872-6968

Dur Computer Plpcl’

A5e computixig pofcsional. und belng nur In thisere: l wouldlikclo find informefion nboullob "egencie: in Ihi: neu. I! would be helpful in mmy peeple if your p t p u ’ listed some omucu ooca-

95(>iV.8/h.Är€.

Iionally.

itHzr«u1vcv'l}("

Unxipied

756-893!

"' Gomputerlond 'ell:ie0 '“7‘?5'“3 394431511‘ : 939533341353913»:

HARDWARE SERVICE

-Manufacturcr Trained and Authorized

-Largest Microcomputer Service: in Canada

-— National Coverage Over 45 Locations

-Over 300 Service Professionals

Dear Sir: l nglfllfly rud Cnmpuln Pnpcr und usually final iuobeinfenmlivcmdazzcumte. Howevei-‚Inoted Iomefnncclnlcic: inlhe news itemGntilledwl/cni. Vidi. Amlu” cmpage 9 of die November 1988

Cenunodwe proCompaq PepenFirsL duca in fast Werk! of Commodore..." implia Ihn! Ihete lmvebeen no prcviou: World ofCem-

modern shew: when. in Incl. Ihete heve been many bare in Cmadnflbe micle. Ihm. uhould mm:“mxmnl Commodore prominent i: fmtWorld cf Commodore in Ihn United Suw:..."Seoond. “Anis: im sold approxlmmly 600,000 mit: in just. imfim year" i: just w-rong. The Amigu h»: been evailnble cemmercinlly sincc November, 1985. end will hnve eold m csünuted 1.119.000 Lmiß by me erodof l988.Third‚ "mcommodorc i: still suuggling m recuvcr Eton: eerlier fimnciul mbecb..." i: Ihc damaging type of inaccuxwy umAmign ownus nw in 1985, wlwn Conuno-

dorewan. imleedfstruulfiigfdwir siockdxopped

SERVICE

Wahn-I 6cm 34Min; ra a nun-ihn cfcmipwa profmioruljob agmciasabouzadiacrlixingJlls onlyamancrdfimbafmarhcytakcusuponü.

PUBUSHER/EDTTOR Kimn Slngh Kluls: CONTIUBUTWG EDITORS Wendy W000i. Km Main. Dm:Blmkmhlrn. KmTnknhshi. Naoyuki Ynuwganm Buckle. Slne Gold md Peter Vekinis. CONTRIBUTING WRITERS: Garden Shummds. Wand Stirru. um: Meilen. Kelly Hcin. Seen Blukley. ART DIRECTOR: Raenury Andexs TYPESETITING: Glucia Press COVER DESIGN & ARTWORK: Lury Defekt. Anbau: ADVERTISING MANAGER: Kimm Singh Klub: EDITORIAL ASSISTANT: John Oliver ADPRODUCTION: Wird Süml. DISTRIBUTION: Tim's Enterpdsu Wcb Gruphics PRINTER: V SUBSCRIPU S: ‘Ph: Computer Ptpcr i: pubüahed nmnlhly. Il‘ mallod diyou would lila: 1h: Compulexiägan nclwquefer recllyunyourholmplease 813.99 l0 JIM Wut 13th AVCIIH. Vncouva B.C. VGK 2V6 Telefione (604) 733-6596. ‘m: (will eove: mniling Inrlhmdlingfer l2 iuuc: in Camd:Amcricm subscription: plcuc scnd S25. ‘Phi: i: Volume l. No.1! Decanbu 1988 The COIIIIIJIEI Papa. Britilh Columbin’: Colupulct Infonnetian Saum: i: published by: CanadaCompulet Peperlneoulzighu re-

servecLR

doninwholeahpunwixhout

toalowoffl lflpcrxhmontheNew vmswck Exehmguu ol‘ lhi: yeur. hemmen Cummodoxe hnpenedmsunighlqummefpuufiuandflxeir und i: wxrcmly selling u xronmd S10 U2 per ahnte. Iocl Muney

You e r : rlglu an many ofthnepoim, I will peu thefeedbactalong lothc-Newsbymeditor wllo wrdclhcflor}. Iritmn-„Canunodorcdaesgn nuligrwd oocasionallg; davpüzhavbq unsaubere] bes! xiliag prodws.

W: also 3a a [m k a n n } :oldfashiond way... b) FAX (73242220)

Dar Cotnputer Papcr, ‘mmkyouagninfonhemostrecmtcdifimofflie Compuahpcrwhidl isreadlvizhirxlueszlweu Bomell IIKLOIOOUKSG. ymruticlemTosWell". Howcver.I would like in cluify Ihn:developmexu meommercinl viebility i: fimlm uhead Ihm your final punp-nph snggened. im samt m a n :Limcyou saw “Boewcll” merewuonlymywlflodanonstnu iundnhnull Ioould n u: dm: neues: was e limitedprototype prognm.‘Ph:nuin nmhilecnue i: buicnlly ready In b: fillnd with the neeesslry voubnllery n! min; aulhaeisva-yliulewod: lehxommh" u: schien : markeuble pmducL 11ml: neu. oi’ ouurse. lo say Ihn: toftwlx: dcvelopmalt Ilop: lhcn: i: will be man-geizig pzooesa. Boswell‘: buntem: In: hed Ilmon m: ycu: of teeling 1nd kvelopnmt und (h:dannach! model wlll b: rendy {er opcram Mining in Januuy. Boswcll Industrien Im. and iu pucnlcompeny Rocupm Industrie: would 11:0 b: deliglued u: havcyotuaumdananthzunveilingofflnu cquipment eerly in m: ncw yeur and will b: catmdixig a 10mm inviutim when the du:i: scl. Wetlunkyou fmyum intetest amyou: mntinued service u: 1h: indusuy. Sincaely. Peter Junger Dirccwr

the permission o!’ Ihc Publishu i: nu-ictly ptrohibiled. Umoliciled mein-m i: pelefully wuepled. lau: wenn‘: henapona-iblcfotieanmng hunlu: i! i: Icmmplnied tvy a tnlnped Iclf-addressed cnvclope. Submission: m: preferred on 5 Saudi" Diskette: in ASCII (mit) formaler Mac dislß. Ü: youcmuploedyewhfwmaüonmhncnmpum Papst necdon an Mindlink B85. CIRCULATION: 40,000 2nd Clum Puma: Registration Number 771l Prinzen In Canada. Canxh Computer Papa lnc. 3305 wen: 13th Anal: Vanonuvcr B.C. V614 2V6 Phon: Nummer: (604) 733-5596 FAX 732-4280 Boswcil Imitlslrie: BBS Number: hflndllnk 533-2312 Type ‘Cuupuw Papst’ imleed o! your mme when signins an. l look fonvard 1o anfing your nov equqanun: und wüh you Incl: in m.vauure. '

Eonnafionwlichccndnmbcpuandündrfit

fomnafintcliuunppuovflfronnovcflsmüfllfine: on ‘manch’ fihnflajor subjoct calegofics includ: Administration. Opmcnau. Enginnlrhg.

ndsduonkhchnbgnviflnnvninflyof nopicadnhslnmmuuncdsvelopnennprucuonnd pnodnncu man oomplm mmuah. Fw man in. folmaflofl. Neptun: Mr. Ifik Buuzy 11604) 321-583.

EpsiProduces Their First HypercardProduct

151.31g _ .3.

Inwhilnbackinntlnacpagavcmmfinoda ounqnmyalladfipfihthncommtolmnfichon

—

ROLANDAnnonLneu New Pflnter

VANCOIJVER. 8.6. Roland DGCmndllnn. humnonmoednduhopmmixprinuwlrhm nnyofoparfluremvenianou: IluRnvdn PR-

ufljnlhawondsoflolndflüomnlhfln-

qerüngfleckflhelllvm Fit-MIN: Ihcflm mnrix prima whooe pqnlr handling md fiomnuv fing puwcr nqual in 2A-pin p-hnt haad." Hndwu: fülfltß inchndc cxunsive sann! lnsnlnfion. nfino-pluafdcfim. Indamw 100millionchanncnuznkpflnprinuhendflu uncnorean

benemompnnhawpcnopnmatypcinmuqnnick

adjnnmuntjqaahnndlhgcunbodcucfiuufenfl.

boaom {und und nach {und On du: comrol pmel. 5mm: includo: Memo 1.001.101quickpinndngotsüuleflmu without mnovhngoonfinnnn fampapc (man du n u r feedwcrfcuntondvnncaomuümufincmpnpa foc euy zur-oft’. Ihm muten i: to mp-of-fiorm: MiuoLiMFud.forpupendvmcoinüny inmmam In puiflon Ihn min: hol! {o1 pb-pinmd forma: und Ihreauacroscuinnp forinsummnll ofprimu actup.

Tha Rnven PR-2417 holst: fivc built-ln Inne: quxlisy fausCourimBoJdPS.SaipI.SauScry; In‘! Prcrflge. In 16656011. Du}? in avnflnblc fm

quickprixnürngmusuggcstcdrcmlpiceoß74fln9s meinden n Iwo-year pms und mvice wmlnly.

QMS Offers Postscript Controller Ior LaserJet & Compatibles

PCPublhhcisnflfllsizebonfiwithuMowr-

oIAGBOW x112 MB Rfillhllfllgiwuny

CmonCXbucdumHPSednnCmonLBPM full PostScript compnlbiliiy. Will: Ihe Idditionof

PCPublhmnusmwillbublomfinflyscdlund

xouznvlflablefonu: uflpnducchiglnqnnllty.

fpllpqeßflüdpigxnpbainqxptnxfinflclylßflne mm.

11m PCPublishar Kitoounu oomplm withUlwasaiptdnagencorgfxhnsafintcounpofifle lnngmgenndEpnon. DinbhQuu. NnlBM Gnphics und HP Lust kt. Alm includnd in Inugexül DDLIbcutnuntDescdptionIanguqe uns an du-n-nudve noUhnscrtpt. I!» 35 undnd (HP74?0A‚

punindnutnoednomdninndusumncidmnwldn

jfisflvfiuz im kann mnmtaginng Iho

AkßcocneoptandinneakitngCmadinn quickdancnuyundmufilynmdnsnooddhplay. SH maddlhcirworksnoüncahuwnlflnry. nnhinnglnmhngunduufnnandoosteflcdvu. CnvmcBobClIppnNn Mnplcstuvfihw uctfzomthcahundunocofflnckwmflvm P.O. 8015251. Squunilh. B.C.. VONSGO. 892drang]: puhüc domnln chnmnll by «Hinz i: 5551. 1118305854326 “Hypmon”. ‘n... popnm in ugcmd u Ing: Games Masten-s

Tang, Japanese oupuuimwihhuadnou-dunjob Rel 11m PC Garne uucidnnu.

5in1! Thaaccldnmkccoudingsyuunmprumnflnc Tailo twmhh:.. tlncvlupuncsa onln ancouv: dann um winnun ‘Accidou wunden’ (um.The- hadqqanexcd ncanfly infintüflcfuIlnlBMPCflhNonh u n l ü n ü o q h ä a w u i n g fl u d a n n m

ulndmookurwxmxztoeaehdnncficldaflom

euynldngofthcnddunxdnmemdfinnmm Tailo

. DDL Laumann: HP7475A. HPColmpn und

annhüau).

AsecondinnnodnnctlonhthnofdnePCPublinhu Sysum. Thin wache: nochwas du PC Publishawithngannficcnunsxhnuptinnta.

Thi: will givo Ihn nur:Deslcnp Publiflningsoluüonwhenoombined wImMS/Pfibmlofiwuo.

live widn loweroost Pblfiefipt davioea. PC Pdneduiöfliinshmldbeuuflndymflm-

Lishc: KittCmonCx man)52995. PCPubluhat Kit Scdu l1 S3295. PCPublislner Synzm 56995

suhaidilryoffimmfllionhpla-haud

_' Jodayunnmnnnodflncirmltedimavfih-

minauntnoflnncklinbuflmlohathcucm biliw Arkauold. UmilnowTniIo Software hu in populi und: aus oohly [a und o! wiun . Entnahmen: Symmn und Com-

dncflhncidnnlündlifflnownhnuncnnppcfighn octnaotnlnhpcgdl-lactbcucrdesmwlhe necidmtby ‘mouse-clinking‘ onlhsuppuoprim check-boxhflunnwarmfluvughodnureaxdsü nannfiülnadbydickbgonneandzhednclcnos dflimomuünebonnomofrlnefmmtfldsngflne

modon’ compunamflnenlecseofnarknnawmrh Tu n ‘ : entry imo Ihn hroodu BM-PC-oompntHe sofiwncnuäcndllnefiuofnaflifl

hiuTainophmnnbs-hngwdnePcfmuuz. wu repeatodly ahnend by RePhy

uaatocionuüncprcvlousornexnrecordintha Ar

dntabua/Ihacmssbnnlnmflnownatthchamm magnzqnnnonoofflncwpxiamostpopnnln ohheulncddmünectlisrunfltuhcsflncua 3mm}

bnckwflnVAocidmIhnfmmmonWcreenLThe Mngnnifyixngßlmbnnmnnnnom Ilneopmnorto mosdspaontic‘ acudmz‘ condnnom" nnclnulhc ducriptiovzmcuuncfivaaxfiaunflmaom-

Fnengdly Technology Branqhes Out Frfly T

mandnionsnoelimhnmfimmaoeidmnofnfls xion

QMS Computer Rubel: Lid. Innnuncß lhc immadim nvnilnbüky of langen Cmponlion’: PC Publixhu ommulln und f0! MSIPC DOS bnsedbcxkwppwablitlnmg Ippllaatlons.

PostSaipt

offemd a lind: Sumey Iocuion. und Hypuunddlvebpnsnwclulmcunpmyhn anhand in umHypaunl man: “n: hat Slln-Qocnnmnnbuflniph umbenannt! ich: nur

rypeoounrhngagmflnerumingfiguuume und

In: G e l d n m! diviRlbbou Exoten, mformen whnl i! mbc n powlng dumm! for cnmpuzet

CSA DOC.APPROVED

CANADIAN MODELS P0420 I 170-700 UX-SO IUX-ISO IUX-IGO 130-311)!

From 81250.00 “Vancouver’: Exclusive Fall LitzeAgent” COPYPRO BUSINESS SYSTEMS 222 W.Bmndway _

876-4141 “Buy with Confidcnce-Buy From Aulhorizzd Dealm”

anppliss. 111a oompany ofius trau

bommofflnfoflmmnblefllcmaflofmdspedfic

pummoruecidunnnaoadudinndncdnnbneflh priuüydfliveryonduwnnwnadmova-SZS u Conucl: pimubnnmulllomyoutopintninestmdtd wdllnülivsrywiflzinllbnumesshown 682-6488 inm. Bryoe npormandgivuyannhanbilinynocnnsmmiu

slnpdrquundudndzAndymwDie.

Word"

AnalymbyDepuunmkAnalysbbyEuployee numbenzAnnlysisbyNuna. Anflyslsbyoocupa-

PageMaker“

Sntmnuy man; wich 1h: smndard man. dann am b: unily umsfeued In oflm nppliwim. auch a: Microsoft 530d“. fnr cnaom chnu und du: mahnt Call Bpoi u.96-4194 0o: an ins-hause Gamma-dm o! Ihis nur Tlnn Epsi Aocidun Rneoadin; Symm i: prioed u.S3700.

FreeHandf”

dmAnnlyflIbyTunmTuBLomMnsIahflfl.

Redford Workbook Helps Small

Hart! Drives From Riclnmond Flyhng BodmdhßflIhdAowunfinghImustfoxIhe IIADAM t

Businesses With Accounting

hautnah u! fllflßfllfllfl und nmll bushnmu inClludawholncdnqflckundpncticnl gnide t0

‘I'M;

Paiphuflsmflilqnfn

wirhllnauluacddaMACFLYPuls schuf mamnl dxivet. nvailable in upnciües orzo müngmncolfineconunuyäbestscfiingmkwm mbno! mhThaMACFLYPluslsasnmiu ptoducu. Nov n nnv wotkbook i: availablo w ofdrivu Ihm lhei: previous offcring. guideflncmunyucznunvughfineelfecfiveuuof Iooking f n hält-in powe: man!um wich "nncy mit u n g u t . I! i9wund Laub:3 4 m Incund apilu protacüon. Font manninahe m30. Werkbank grared Appücaions by nlled swixchca nnountod onum {man of du Purbhoo Incl Borol.

ooneapmnd m (au: an:und rnoise EhvcnBauhaus-ranging fromTivoliThenzn lunrddrlva anders 0 | : du: auch. Thc drin: u: In Plan: (Forum). Valhy Park-parkt: nwlicdion: In: M" “undcontro! Duln drivcmanhmisnns. man Bodford’: Ieconnndngsyslun: 51mm bdger. both lcno for Daten: Offen-s Service For Manuals aoconmun Thc Mncfly smics i: nllabiliny. acoounzs receivnhle. paymll. paynble, Daten: Scwioes may luve n mlution t0 du: und jobnunu. Complece kcyilrokns an nvailnblc n numbct of locd Apple dulets. innvunnmy informatim overlond man mm125c «grün» Adam nbouunouncedrhetckuc oITRANSIT. poviied und rudcn cm pooeed üirectly mm ubl:cuuidge hud dn-nvc syxwn for dotnsnfacingwlnnncomfionmdhy dncmadfou uannncfimu nlnady dcvdoped m uns n45 rnb und stomd manunls. ‘flncy offen- a cotnplenc mtvicc involving Apple computcmTlnc Tnmit cm be Maqinnouh disk. informzdm galhctinngmfgmfizaüun. mdjznpara- wcompmying Exercinu mpresenzod inorderotoonnplcxiny und eidm} asa pwimury on- bnclmp sumgc devnca. üonacootding tocfficialmadnods Iflslmdzds. hoch Iren uns eannpua und uanning poim of A: nprinnüy davicc. lhl: M: cm"boo|"dire=uy Pnodnncxionisvinnpawufnlsynwnvhschpno- viarw. Applicnxiotns are all focused an muking fiomnhefiannsit andopcransu nhigh-spoedhnd duccs pannnalized oopies winh a vnicty cf. Badford disk. A: n finnckup devioc. Lhc 131115km a5 cuy In Aownmdng u aoocssible u possible: useas femmcsfifhc smicc involvcn plnnning. fmmltnfloppydisk. onIy muny Limes fasurmdfi sprudshnels. dann D1805, und ward pcocassing tlng. t u t muy. production. umhin. bimkß. dmeslugaADAM Periphuuhconuznunoedshipuns. mcmbly. dnsmwüux m: all nhe deufl: applicuiomucinummamüwtformmdeto manch nur’: enu-y of rmnuction infor- ping Ehe] unit in 1h: first wcck of signod du: chnllsnge man inn-house auanpu n: pre- mnüon; und Im: ofdala files und um abbrevin- November uggamd List pme im- zhs Transil i: mnwd ann fixer! pricc. um: fnciliune movemcm uuoughout the Ipplion- 52295.00 anadim) Will-n each additional 45 mb Daten: cm dnw an a dannhue o! “gen-nuic" in- man. ca-n-idga nailnblc (o:S275.

W i

Advanced

Instruction

Vancouver Locations 886-4502 FoIkstm-gxgggägn Inc. TheCunnpnnnn-Pnper vboccmbclüal -5

.‚ .

Information isonaofmemostvaluabl: cum-

modilicsinthcbtxsinesswald-hnufimet. III:

rightirlfonnnfimcanbehudtofiniflnesitnm Frau:Unciversily Bntupris: Cents-c uffm n Iolu-

tionuomupsoblflnwifllncunpnzrfizgdixifommIiul Service für buxineases. "W: u m : m informalion dambnse pluvided bylheFcdu-alßusinessDcvelopunantßunkfuyß 01.3511Wodlcy. amember ofthebushmndmiaiisuntion fnculty und dincmr cf m: Enurpris: ' Ccnuc. ‘Ehe datnblse inoludes infotmmon an fadcnL

pmwincial und mmücipal govermnetn assisunc: for Business: key busincu regulafions: scrvioes avaflablo Etom Camdinn und: uneindem: infommtion concunhg Claudia: und: rcpncmutives ahrond m! fmcigx: und:rcpmmuflmn in Cuudx: govcnnruu-fmdrad invtims avdllhlc im‘ eammcrcialinüon; new U.S. produczl with Cuudim mznkct polmlial; und 0615115 dmonwpuluümt. incomc und eznployment. I1i; bywoeklyand availableaunomind am. Contm: Simon Fmer Enurpriu Cctun u 29l-

„g

Frantek Opens argerFacility

was aoquired by Micro DInc. last Mach. disuibuns 60 loctl Ihm Mut: morethmdßflomlaoccmputzrsoftwu’: und Wmoouvu.Nov.3.1988}— dcalers and pmdtnct wenden joincd thc slafl‘ of hrdwar:pmdncu 1o rcnllm 1 m m Cmldn. Frmuk Comput: Producl: Inc. inoelcbralhtz Ihe Conun: D. Peter Vmdube. Fnnlck Compulcr upcnixigof Lhcdishibunnäncw ‘Lofloaquare-foot Producß Inc.. 1-800-2673700.

Tbc ncw Framek Inc.-auch. locmd in Richmond neu: Vmoouvefs inwmuiorlnl nirpon. lncludes 5.000sq. h. o! wmhotusc space. amuoffic: und zhc fustoffoixrdenlummingcmnu Frmvzk will nur.xi: months. opon across Cannda mmugh dcalcr trainA uniqti: fcamr: 06th: flcilily i: ing ccnu: which will dlow Prunwk und product vcndoß uvptovide in-depm ßchnical und 311::

uainingtoresellm mdthcir mit‘.Primat.which

104111 Avcnu: offcr oompula nining und m10:ing on man popull‘ buainus loftwm’: packagcs. PJ.C.S. Ihn does conrplmrizcd nccuuxxlins. (msinmproynnming. wmdyuouaixig. nndfiask-tup publishingCllsscs m: nvdluble bolh onsire qm n:PJ.C.S.‘s offiocsßonlam: 589-2215 ext. 17.

nlnänativ: mtworkiixg syswm. 3Com Coupon» Lionofsuu:Claxa.Califomiahasrecenzly opaned n Ymoouver offic: u Suite 1500 70l Wut.

Geprgi: Suez in m: IBM Towcr. 3cm: i: a ncryvork q m m : compmy which i: lcmwn for its

Financial Statement Analysis Program For Professionals

fal hlrdwu: producls ‘chacl Ticmay. aooount exccuxive for 3Com in nncouva sulcd [hat “3 Com has realized for somclimctlneneod forlocalreprcscnuzimmhclp suppon und mutet its extensive nezworl: product 1in5." Wirh the Bridg: menge. 3Com nnw Im n wid: vuicxy ofwid: nreanctwork productmcludinj SNA. TLFibcx Opüc. TCPIIP und UNIX

Mr.Herbert A Hoyles. Resident. Hoylcs Asmclms Inc.. NE Softwm Group. Vanoouver. r:cmtly mmounced In: man 1nd shipping cf All! Finnncial Plasma. a powcrfiil du:Ins: fmmcill Stau-nun! umlysis progmm designed for uchitec

New Business Information

fÜetworks in Harmony " redefining "performance

o t h A B ine

L i

lutio

Fron: [an Frazetofsofmk Systems Inc.

Ü"

‚n . '

ä .im’

Computu- Technology changes dnily. Your LAN must andcipano ydur furum neods w ensun: your sucoess. Your company anno! aflord to rely on a company (hat rast: on it's aooomplialimenta { m m years gonc by. Ask u: about 08/2 LAN Servers. S.Q.L.. SNA. TCPIP, disldess wotksutions. FAX cnrds. etc. anfrom your DOS m 08/2 workstadons.

Der Softrak.

Ask us how many ditfcxent typcs of compuncrs w: can gar l0 commuxiicaw with euch other including cquipmcxit from vendom likc Macintosh. IBM.Hewlett Packard und DEC u: natnc a few TODAY.

Th: compnnson o Ü C o m and Noveu pcrfonnanoe comes Eton: Ncal Nelsotfs Business Benchmarks. which indicatc thaz npplicnfims 11m up to 448% fester (the copy mnction runs up to 452% harter), on 3Com ovcr Novall on identical hardwm. Statistics that cannot be ignored (call u: for a copy).

— --

Nehmrk Specilliill

ACCPAC ACCESS Spadnlu Cnnullum 2:315: Spechlty Comahm Aulhorbcd Service C u m Aunhurhcd Training Ccnm -3Co|l&Nov:Il

diflixuhrlenic: G.»

fi f m ‚”

"Whese did you get thosc numbers showing 3Com

pcrformaltcc up to 448% fasten" than NovelVs Netwas: 2.1l?" A:

"Ü?

nnILImm

Questign gf thle Month

PJ.C.S.CDMPUTERSERVICES hnpc: tnhclp solverhc shormgeforcompuwmmingirxsmrey. 1110i: new offioes locnwd a:Sinn: l17H-149l4

imtfllaämuinflicvmoouva arcaundprovidca

Wmcoast facility.

New Training Oriented Centre for Surrey

JGOM lncreases Local Support [nmoffontoqmll 1h: 6d: ofNovcllnctwork

’-«..v-\..-

Computer 933e: Deoember 1988

Woamoontinuing t0 providc nur customers with 2 networking solutions to ennble a choicc.

The right choice: 3+0pen fmm Microsoft G; 3Com. th: bes: solution for todaymth: ONLY soludon for mmmrow.

the Number ONE SOFTWare Company l-SIHI-ONE-SOFT 222-50177‘ 222-2FAX

poductsnllowingmnnapuhnppingfmmlworks. Xzylnxmnßpnodimnuszegyisflnrelunof 3+0pmLANMma3un3+Opmiincouponm the Mai-nach 0512 LAN Manager. which was codoveloped by 3Com und Miaosoft. I: puovides muntere: networks. supportixig DOS. OSIZ und Maoirmshltisüxofampxodlwtonfltcmuketlhn suppotu anfing DOS applicnimu, whilc simultmeously Iuppartislg 1h:ncwjcncrafion of pow— crful. 05/2 band disuibuxiun applicafions.

4412.

„. ‚

1-800-669-7638 222-7638 222-2329

ATARI

—emmmmcmsmmotmsrrmumm Atari Conflnns ST Plus SLOUGH. BERKSHIRB (N8)

Atari UKIn:

Ium. Ofinhmy‘: job will b: In mutig: Ths Mulmlmincanrlgüclfniaafismuundoflw woddmatkch. Finanzen founder und forma pesidml Don

Pellingwillxzmmadieaudfinfluvesofivm in unweit‘:NEWSBYTES UK.Inaddition. 1.1:: InnmdchiefcxecuflvaofizspumtcompnngufiIIEIIII Softwure Camdn Lid. A: Redford. cumpuryhnsmvcnladmuamb-ilüflflcaßoh oTlnhmyiswplnoedhyAlaxmotunavaum (nSTnilllkeybuIdhrmbcükpedindIUK cf Borlmd lnlunufimnl Im. in Saum Valley. carlynutysar. Calill. utepmwdculiu-MNEWSBYTES. AcaxdinpnnnflwluulCOMPlflERTRADE

WEEKLYmIv-IplptglhcflflmuürsmcSfhlsbemofficinflynlmflwfllbeshippedh limlted quanrizin n: UKdevelapm nowmh Ihe

mutmflmmonmeßthanuwwwflngpom-

Pricingmdavuilnhillxyofflwncw machlna havcnntbcumvcalcdmNBWSBfiESUKhx lt Issnid I0 baplmhed fnnly auhe Unix wahnlionmlrhßLwhichlttcAmiflmülhlsbxexhnd

“The Operative Solution"

WeFeature Teleplan II Medical Billing Packagcs. >ZJ‘‚'-1 - . ; > '

..___ A

„%A-wl‘_*_ 1

Exchange Strugpes With

Automated Trading Problems

Vancouvu. BdtishColunbü 1988Nov 4 (NR)

auofülsmmnlLNEWSBYlI-LS UlUsUSunu ——Thc Vnnouvct Slnck Eichung: lud noble Im»: abo cnnfinned du: th: ST Plus in band withhssix-tnmfln-old nutomaxed unling system wund Ihc Motorola 680.20 microprooesm und 1N: wagt. forclng t1: nchmge a1 an: point |0 nouhefimiochmaswupwhßlyüoufii. On du: 5'!‘ aonsolc Iran: mamwhile. Bub rmvcnanennfivostnuhbackmmnmalradixyg methuda. Warm: Funl.muugerofmdmgdevolGundowALu-iUlCsmmufimdh-moanhquotzd opmmkuidmnxeotthcaxdumeäwmpcw uprafarrixxgmtnosaymmnhoadueauola‘: uaxninnhnnlddisplzyhggubngcdauhnsdny spacificatiomforfeuofumnnng apre- Chin- momüu. Funflxonünmhndaynlwcxclwlan mucunplipmlbnüKliming Iopnuhlheold mondlhemofilcfivfllyuldudofßflßmmcks VCS utdXßgunu manch syslflns. unhnnuuaduxligsynanhckunmml Atari 68030 Mnchine Soon undiag. Shcelhmfiusaidrlnexdnmsohu SIDUGH. BERKSHIRE (N3) ——- Wilh Comdex baut rmninnrh; Ihn simultan. Turmbau von FlllthclohelnldhLnVegulnidlblmfih mlnbalnvingthughnlhewsthnpohlns close uhmd.fim deuils ofAut-i‘: Bill89plamfu- womflmcucnougnoprwuuuseoruacmtugghunid. |6&030—bnsed:ctiesofmndxincambeghulhzlo Fmanidlhaccnedlhapobhnwumeaxfin. I: NEWSBYTES UK‘: «nagt. Mont-Ihn; warnen. a GBOSO-buod wotbmion will h0 un- bulndndowimmehondmtotinfiomathnm mpiaunflnalo. Heuldncordundingvolnnm vuiloclntCmndox. Thc mithin; will tun Inder n Unix minu- onthcaulomnflmeupohflalyeuuflhndno col. II will um. howava. npomdly mn T08 {läamiolopauing Symm) GSOOO-hud Aun wühlhecxltlhc ynouglfible lscnu.

GOMPl-IEQ GIJNIC

‘v. Ä

x: m q. 1:5,:

I“

.‚

‚_.„

1;‘;

n...

_‘

Im.

.-‚

_.‚.‚..|p

SA cnmTEx

‚.-

k“

DRIVE AUGNMENTS -HARD DRNE DATA RECOVERY

Ä SERVICE

RENTALS

mTilpnm * 2 - s e n t i m e l4

uinn

hnuuoacusprnuau

bemüht; CompmI-Ancchuscasdnßvmma.

‘

‚i‘

W71."

v’

62:3.“

Samntyawu- TOSI-IIBA

Brlflmüohnhianidilwillshbvafiouilof

„in... FAX LINE -732-4427

in AOCPAC Plus Symm Manage/I manch; aottwmfwOsfzhxlhcfirxtqucmoflm. Thc sottwnwlllahipwühlmhkvmfinnil. ‘l1: nvwvuionwlnrmhOs/zprcmaubdmoflnonn JCouuCmM-Opannetwuk.

TECH 88S "

NEC 1375 w, 3th,A“ vancouvgg

adaclowetmd.

H-P Hits S10 Billion In Ordern

BC BYTES

Bedford Offen-s Tech Support

QLIJORNMJMSNOVISDGÜD-lhwleu Pnchnlnys ‘u1nd n 22 purem: k a n n In um memuadaflpuoanlhamcinncteunhngs

140ß)—Begiu:hgDnImbul.BedfufiSon-

uninp per shn rosa 34 puum. und «du:

BURNABYEBRITISH OOUJMBIA 1988 EDV

DECEMBER

brinlmfinulyuxendfiqoaobaämflu

SrmAL

wmlmwilloflcdüdxynfreetedmicxlmpptm w buym of im aceoumrhg 50mm: pnduges. qeeedetßmbilllonfonlafimünelncmuu hsuy.

Floppy Disk lhllors 3.5- Disk au»: ca: o:zscu-n-u-«a-szw ssr ouanw d am

‘nrfxuslayflnwsawmvfllamwhm aus: "RudflngslolaillimlnordaaianujotmilccusnmernuilshmoToo-xafottcnfmxisrsion muforolnooaupnnyuufiannonulmsaohlcvolncludedhneachpackzgc. ' o! in mmlfiroupeoplefh-nggedlohnYoungl-{P Bedient! alle umarmen I! preaiduznndchielcxowflvc. Farm Blhrmudfee. long-mmsupponpackaga

535- Disk u

m: cm o! aeo --------s:w

cummmwinrcoeivnanawdialzwhflmulhnk Lotus Target For Takeover? nccomxhg summa i: wüued. Bedfonl publisba lmegnned Account; EorlBM nummpnliblcPCaandsinnplyAncotmtingforlhgMncinnah.

Lmk From ACCPAC T0 1-2-3

VANCOUVER. BRIHSH COLUMBIA. 1988

NOV l6(NB)—-Synex8ynnnnCap.hnmveilud schwul: Ihn will nllow Develop-

mcmcarpfis 1-2-3 sprurhheuuptoduu financinl luporls fmm neaounfing

au.

An-

oLinkwill bringdunfromConrplawänodules lncfsAncpnc PhumdEnyBIxsimaumnm-lg man: im 1-2-3. ‘lbnheduanhcnudo hmusomdrcpom. kaum;gruphica. David Rlchnrds. AoclJnk pmduct managen nid m: n i m m will b: nvnilnhh in Pdmuty darin: eompmblemtlnnofnsizuglelficchcmodtxle. H: nddcdthntlwcnmnpmyplumnoprodtumsion: ‘ thnwurkwifizolhc:

pndugu.

Syncxhudcvelopedmnscsmmlofpummnfl ootnpulzr nofrware. man nf whjchia mal-und by aber aanpmiu. h: hat kann: cnuiuu an SWJPlu mdhacunhidgcsprudshnuhw Iyst. bolhmldbysymanmccorp.

Bedfnrd Cofounder Taten Helm

A: Pinetree Sonware

VANCOUVER. BRIHSH COLUMBIA 1988 Novd (N3) —'I'nn1O'Fhlu:ny‚ a anhand: d’

BnflIHAGÜMlMmCorpvhiChmqhca Uasdonlewngedbuyoulorhoslilemkeovu. hlndopoednn-calledfllflrnlnldflfishuplm"

dsigndtovudofiuhwvaxünflunnpln. shnelnoldasofneadonllovmbeßwfllrcoeivendlvidaldofunfightaonddifiotullnm

pmfimulmdbtuchshndcaflnalsmd ownedfifhnrlghucmbecxaciaedlodsysafha thcumomnunmtmtnpcrwnoupuupofhvuan In: nnqniml n: laut 20pu=nm o! Laus cunmmmckwlodqsnfiusuflanpuxpbegfiu amduoflcnlamnysixhuwxofmplmby Iuosuwtrytoukcovamcuurpuly. monlhly nubishtNEoCundPujimwfll ' wfour pluductlonhfivcufilüonuxürsuxd mfllimmlubyMuch.

CANADIAN NEWS Anothcr Cmadhn Terminal Maker Has Money Troubles MONTREAL 1988 NOV l8 (NB)

—

Conncnn

Ins.will 08er in cndinon IJJWPOIIJ fort restruc-

|EW5IYTE8 by Wondy Wand: (Wemm USA).Kon Main (Eastorn USA).Oma Blankenhorn (South 8LMidmst USA). Mauyukl

Myazawu und Wahn Ynmmumto (Japlfl). Gram Buddor Oanada), Stwo Gold (UK) und Peter Vakin (Eutopo) Copyright o 198B NEWSBWES. NEWSBYTES canadian bu-

Badfotd Schwur. hat ruiped a: viu-presidau ofmxkatlng a1 m:acooamlixxz wllwn vaultr. H! will hauen: puideu cf Finnen Soflvac mauchbflcGratl Buddnr.Saum IDIPZOOB. Im. in Riirvlznnnd, B.C.. l Vmnnuvu’ mbuxb. P0 canada ID PC1178. (415) 285-0644. Plasma lmmchnd in {im ptodtrl. zpodncdvlry 3203-859 Konnody OnScmborvügh. {In ullnd MS-DOS The Muimizr. ‘m wio MIK 2E3. pwbge

0und5): >

‚ n y w l fi f

DM’ >.Ü"|‘‚'??l«1lf

lI-l

anfing in dobt. The Manual oonnpnny in u: noowd Cnnndlm tu-minnl mnmitncnxc In als: oxmordinnry nciim nnnrosult offlnnncinl Imublc

Comnnn in Ihr:cuiy 1980s.lhcoanpnnw hticfly

mukciedflxeHypericILnnexlyIBM-oompnflble luggnblo onmpumt Ihn:gol oonsidurnblo maritim withinnmonui. OnOctoberIiLLnnpnxToclu-nlo- ufintbut fotmdareddi: In impenfectoompnnibilgics Im. of Mnthmi. Dnwio. u n d l0 lmve iry und othar mixfmnnn. untätig in iunhnrcshnltedmfhcTotvrm Stock Toronto Show Attendance Down, Exchnngn whilc thocompmy nagoünlod nimm unnnmad ihäd pmy. Lmpc in bclicvod In b: Bookings For Next Yenr Booming dänisch; a ponsible rnkaovnr. Cotnlum nlso in ‘DORONTO. 1988 NOV l7 OG)—0rgnninrx holding diacusaiom will: nouljnnte min’. snid oILkCmndimCompuuShowsnyIhnInlmmxgh Rnpi Mikhnil of Richter & Anlociltu. I Mon- nncndnnoa nt umyenr‘: show was off slighlly Irenl [im thll in; anfing im- Connlam. fiomlnsxynnnbookinpfor nur ymmgoing Cmmann will File n proposal t0 in credimn fnstar {hin ever bcforc. lndunrinl Thd: und imdor m.Fcdenl Company Crodimn Armagn- Conmmmfihowshldrwlyuralunodfmalattmmonm hat. n linlc-hnown insolvmcy lnw undct dmcefigin-uwhonflwsbytawuutomsxbm whichthcoanpnnyüopdaurflnfinopmifaedi- thccanpmynidfllntncgflüavuubalößhafl nnrcjoct in proposnl. Th: popounl isonpomd oauoflherlnw‘: cnhihitnpooe for 1989 W8 nbcworhdombynommbamhfiikhfilsnfl. nlradybookcd. Utßamilnnodlbehuvybooknndncrodiwtfmeothlghubunnclwdulodmn- hybnincxenscillhenicngmantodnrbs Itnw. Iivcly forJnnunry 31. T11: Mumm: also nrmomcod Ihninoxt yonr‘: hmghComtaml-lnsbemntamhinlmmufncnunrfounoatofirshiswryuomemoyrenmmbu nhnw willboholdnonriynaxonüiwliemfxom iuIn-ieffownyinm PCs. Undnthennmoßywc Ociobußmfluobetlo. "flalschnngeindnx:

man: «hinaus. maßen:

will incknbiodly

mmmanabyeummmueonmaxwimoou und: nhows.” lndnnuinl Tndo 1nd Connor: Shown snid in npttprod summa“.‘Phinycnn’: xllaw ooimidcd wilh Comdox in Lnn Vcgns. Nexx year's Comdax i: schwuler! fmNovanbar

13-17.

In Iheyonrmdedlmouy 31. l988.l..nnpnr hol Cflß ruillion onrevonues oICSMJ milllon. h: Ihn: pcvious final ycnr, i1 lost C535

miIIimonrcvminsoICSdIJmiIIiu-‚vn. Kirklmd md umwith auch fuuncinl pmblcms. Lanpnr “in ulümnlcly going m und up in I Sinai-im whcrc i1will cither hnvo n finnndnl aisis o!

n rcfinmcirxg o: b0 tnhn nur."

Ianpar Stock Ceases Trading,

MARKHALLONTARJO l988Nov4mB)— nomckofLnnpuTcdunlogiuhnccnod trndingonTotonlo Stock Exchmge0caobu31

atmocompryäroquost. Norcuonnfmlhohall

hmrnbemgivczi. OrlFridlynndingnüllhndnot fßllllflfll, nur hnd the oompmy runde an anmuncununl.

lqnrofficinlsdidmtnunlelepinmcnllz

from NEWSBYTES. Caen: Kitklnnd. n in-

duntxynnnlysurmrdcqaiulcorp. inTomm

niddmwhüehohndnooffidnlhfomnrlomhc mpoclodüiclzadiiug hnlzilrclntodiooontiiming lonnonby Lmpar‘: computcr Icrminnl mnnufncKarin; opmmm.

CD-ROM

Simulation Of CCINFODISK

——

HAMILTON.ONTARIO1988 NOV 7 (N3) Tho Cnnndim Cmuo Im’ Oocupndmul Honlth und Snfety mw offen I nimuintion of im CDROM rundum CClNI-‘Odisc amfiloppy diskn. m dann vanioo walnlns m: flappy dish o!’ nrrlpl: man in hat}: Franc): n! English. CClNKldincoumnimdnubnsasoiocnrpntioi-inl hanhh nnd nnfcly Mammon.

Microsoft Shlps CD-ROM Business Consultant

REDMOND. WASHINGTON 1988 NOV 8 (NB)—Mi:moftümw shiming nuzw CDROM-hnnod d a n n lihnry ullnd Minuten Smnll Ruinen Connulan, nndvufion 4.010!‘ MS-DOS. T!» Conmlmn in n oollecdon o! rofumoemnminlgfloinnltofinvnutloflxo 5mal] Malus: owncr. ‘Phi: '15 die Iltird CDROM producl the oompmy im nhippnd: proviounly inhnn nhipped Microsoft Programm": Uhu-y nnd Microsoh Boolcnhnlf an CD-ROM.

Sony First To Ship Ernsable Optlcal Drives

SANFRANCISCOWM-Despinfluhubbwlb smomidlng m:ucw Cuon rewritnhl: opdcal disk dxivn cum-am; an Steve Jobs‘ NeXT werkstntioxi. motha 62m. Sony. 1sncmnlly shipping glifiziJlfd

‚

rimilnr dxivcs 1o orlgiml aquipmau und commnrmfacnlrors. Sony. of Pnrk Ridge. Now guln uxyJIysiBSMO-SSOI mIIyntCnHJIdSMOD501 drivesmm ofiomegnbytes ofdnuon

ühmnnnnnuakhu

‚„2.’: i1 9 m

rowmabis erringen

;

um uniform m einem.

hilunnfinnnl nmlhrdn. They should. Ihaefore. bcunnbleonopticnl dxivcs fimnothumnruzflowas which hnve uluplodtho ANSI (Amuicm Nnticmnl Stnnduds Barium und Imnnationnl Sinndnrds Orgnniznfiom) speclficnfimu. Opticnl drivcn oonfotming to diese srnxidnnln an nomisodfrmnmnnonshup, Hiuchi.nndolympu. n11of whidi pmmia: drin optical drivet will bc nvnilnblenextyenr. ThcCmoudrivcunedinlhe NcXT verbinden. however. in not apoctod |0

oonfmn l0 ANSI Standards. Sony says whilolthns Igmamenßurithmurm-

facnuersmonecm hecurrmtly nnnotmced. Tho

dtive i5priced n:54.650 in OEMs. '-

I30.

COMMODORE

Commodore Pushes DOS, UNIX Solutions

——

LAS VEGAS. NEVADA. 1988 NOV I9 (N3) Whüe man dlcnüon a! Ihe Cmmodore

boothwnnfomnodmnewnpplicnfionnforiu

Amigncolnr ooulputcr. inoluding duklopvideo qnplicniicnnguncounpmynlsomndnnuncmom n: 3a. bnckiuo Ihn DOS-Unix warum-mm. Po: Ihm: who roquin MS-[Xß Ihc onmpony h8 hnuughLbocktoAnwicnnfnll lincofPC-oompniiblcs. Porthosowholovn Unixflmnmodon offaod a votsion o! Unix Syntax-n Vcnllod Amix runningonrho Amlgn ISOOUX. nworlcnudon

‘I

--.'

u‘?

‚A_‘.' I

€_

"-1,

.-...:

From business t0 personal applications, the Superset lamlly is tha ideal cholce. Why? Because quallly. rellablllty, plus high performanoe are standard features. and Computer Canada Corp. includas exoellent documentation, technlcal service and marketing Support. The Superset lamlly equais a super value. Dlsoover thase systems. Call one of thesa Authorized Dealers today. Sankor 5 Assodiiü 12.59 Dydr au. North Vanoouvor. 3.6. (am) 9660236 Una Systems Houn St. East

377 Haätlgqa .. mmuvor. (e04) 255-6939

Exoanuo’ compuws 156633-91A m Surroy. 8.0 (so-s) Sao-seien Motor-Soli Computers 56th Avo

. (au)530-577? ‚

Icon Enlorptiaos 16-10271 Stwuaon Flichrnond. 3.0.

(e04) 2716632 Computern in Educaiion R6.

äIagombs (e04) 273.511:

o. T‘ 1a‘;

‚f‘

"f 1

‚m mmmwgxmmn Wfiä‘ """""""‘ '

‚Q:

„f,

bosodonüieAmipmooffliczfiooJlltichh bnsadonthzMomoln GSOQOohip. nlnonnu AMignDOS.

Toronto World O! Commodore: First Weekend In December

TORONTI) 1988 NOV 7 (Nßy-Conmodore Business Mnchinea Ltd. wiJl hold in nmmnl

worldofCommodoreshowatflieTmumohurrational Ccnlcx Deoember 1-4. M011: ihm 100 uhililan um oxpocwd an b: an band will: Comnodarozalnnul podncu. nnd Couunodon cxpoasipwnrdsofloflmlvinimu. Theo will also b: fies sanimn nnd nnexhibi! oommemorating Conarnodorc‘: 301l: müvemnry.

Commodore Offers New 286. Shows Streng Profils WEST CHESTER. Pn. (N3)

—— Conunodue

Buninnsldmünaisfllimingnllnnegflaflu

80286 ATClone. The PC4041! 1ms a mcgubyt: of

mahnt)’. VGA 311116641525 inchfloppysnda

couldn'tlffo‘rdnooomiltucatlltatrllc..l.so

thcywecturhciroverheod.” ComputcrLmd. Print 111m1: und Olivetti continue distributhg ‘Ph:0f-

mmugubyt: hnrd disk. Tho bare 111cc 1s82.395. und n papcr-whit: moniwr adds S200. fioePubliahu-inCsrudgsltesaid. Lasafiirmdly‘: Conumdos: h1; also providod evidenoc 11min forme: U.S. subsidilry in Rulwood. Cnlif. now rentmtofinmcinlhulthomttinuesJhccompmy 1111indepmdnntoompanynmnodlha Oflice Pubsuy: 110111: clirnbed 52 percont in I11: company's Iislwr Inc. also sells du schwor-o. When existing firstquixurr. und a 15putzen: inorusc in revmuc. inventorics o1’ 1h: sofrwaru am "thcn eathnuswd. Conumdwe canuad 59.6 million (30 onnts per lnserFriestdly willprobnblyhiresomepeople und slwrrüonsmünulliminrzvenulfrrrdtoqnurtcr. mnlco some more.” Tha: oompares to poliu o1’ S63 rnillion (20 ccms asharqmsales ofsfltinullionfurtlicfustquutu

GENERAL

cf las: year.

—

MUNICH. ‘FEST GERMANY (N13) CH]? magazino. in its monthly brcnlulown o1’ bes: sollmfmallyputllteConxmndorePCmatmmber am position for November 1988. The PC20 i5 followed by tlre Compaq Dcsltpro 286. Tmdon PCA (‘Tarndon is experieming grell succers in Einfälle). md by 111e Schneider PC2640 (Ihn: m rumours Ihn: Schnaida will d0 bclter now thar it h1: rpli: up Fmm Amstrad und iIs producl: u: dcligned in Germsrxy). Cunrinuin; 1h: list. th: Amlga 2000 (sann to Ire

followedbyureaznigniifloütoboiruroducod a: Comdeat) i: folluwed by I11: Commodore P040. IheTandon PAC.thcIBM PS1’)!mndel60(In: IBM model has Iaken a E1111 in aller). the Amstrul PC1640. und finally Ihn IBM PSIZ model30. You will noticc tha: Ihe impuct of 111c PSIZ model 286 hu bean very llmitedatpresent inWcstGumxny. Inthchomgoompuwrlistconumdorchcad: witlulw 64and thaArnigsäfifi. witlmmstrsd G128 und 464 following Clou. A: fifth piano i: 111e Schneider EURO-PC. follawed by die Commodore 128D. die Atari 104081‘. Atari i20-STM. Amis: 1000andthemnstradloycc Wordprocessing system.

DATABASE

—

Computer Unmasks Drug Runner

German Chip Magazine Puts Commodore PC211A: Number 1

WASHINGTON. 1988 NOV H (N3) Using n sophisticmd cnmpurnr malching systcm. dcputy U.S. mmhnl: hav: disoovered Ihn: Paul MutIhows.lprospcruus Inclchic-milder! South Florida busincsman, i: Nichols HunIor-Reay. an allegcd dm; dcslcr. Hurra-Ren): dmpped out of sightufler nfodcrulindicunenttiedhlm IoCoIombis‘: Medllin cocain: cmal. l-lunwr-Raay was man; 218 dm:fugitivcs pickod up in I IO-weak comptatizzd mnnhunt. Acumiing 1o Sunley Morris. director of die U.S.Mmlnls Servioc. 111a

oncc Cllled "Farnily Compufing."T11: ncw enujg "Horn Office Camping." 1s u cross bcmreer:

"V61 G." "Sawy." und "PC with n smlll dcction on gutes schwarze In pmvmt old ' adv frorn pulling ouI Ioo soon. A 1o: o1‘ ‘monejhubomthrownatthencwbook. witlu clcan ‘w layout. a new lis: ol’ editors. und fiecl i _ druwn moatly fiom 111e business pscss ratlter thc oomputer press. T110 ovembex issuc fcaunu an snicle on gatlnga maguidctofaxmnchinesnstoryxbou: online ‘versities. und a 2111m piece on game softw give mlertairuneru odilnr Jim Phelm he cmuse und you cun win somcthing

——

äenrnffim

Coln nies ignorant Of Repro-

.ofMASSACHUSEITS The (N3) — Ihe ltazards Ihn!oommoh chemicals

1h: Mnssachusens govmunmt und 1.111:

dann Univ

1ty o! Musachusefls Medien] Cemer. T11:

compmrimdseuchtlsoresultodinseizmof

Ihm U.S.S1.26 in crisnirlnlly-obtuinad IDEE,includtng crsh und real estato. The key 1o 1h: compuurmd manlumt was n mm1:

pmgrcm cullod

“Sconclrfi.” wrlum by Ron Wuthriclt. who wurlu in the Marshals Service cnfamammrdivisimfiivayoneleuvu apnperor nmnbcr trail sorneplncc." Howlrd Safir of the Marshals Scrvice told United Prcss International.

"Wiunh:Sooncmleompmerdoesisuackumse 11111135."

2!.

Virus Grand Jury 1s SiIIing

Syraauc,NEW YORK. 1988 NOV 22 (NB)-—A fedaal grmd jury is meeting Io eonsider charges tlmt nConwll University grnduate smdem created

Mor 111m hxlfof 1h:oompanies said they used c ol’ lour known repmducdvc haurds: s. lcud orgmic mercury. und radiaglycol Iion. 40 pcroent seid they wer: nur:of die ponznri’ dmgers. Only 20 purem: n i d they restricted er: from production 1in1:bocause of "v:rislcs. Some restrictod only prcgnm: wcmm. m: sll warnen. Nocompany Iranslcnod nwn 1' productiort 111165. although. L110 study suid. 31 l ethers posc n grauer risk to man's rcproduftivc systam thsn Io women's. ‘s dcfiniuly n lack of awarmess abou: ‘ve hazards among Ihm: fnms." Dr.

01'160!

aoomputerviru: thatclimrpradoomputersystems nationwidc. Assistnm U.S. Auomey Andrew. Huta- refused Io Iell the Associitcd Prcss whcn‘ Dbase IV Finally Ships T TORRANCE. Ca. (Nm-Ashton-Tmhas deliv. 1h: pmsl begnn huring evidenoe o: whcmcr wir; nuloftlteUMassMedicalCcntt-rtoldthc _ ered on iIs promise Iu ship Ihc latcat version of its ncsses hnve been subpozned to tcstify. Comcll Robert Morris i1: suspeaed ofsending Ihr: populardatabaseprogrunbythcamolthcmonth. student Virus through a geriet-max: oomputa netwosln. dBASEIVIVHIIoInIhn ' Tlrefirstoopciunftlnfnfi docr bcgirtnirxg Octobt: 24. Ashwn-Tut: i: 11:0 dumtpnn’g openuons‘1116.000univcrsity und milig _ shipping dBASE IV 1V Dovaloper’: Edition In “ fl a u m i g fl ß d fi w m w m ‘ lagrfwflpaccntfortlwfintnimmutfluof (SIJSPShnddBASEIVLANPMk. Thcfirmalso canplqfiiiguwsJwmdmgtothcsofiwmPuhfishmhnVirus Assocmion in Santa Call!’ Clara. Indunry w hnva oIdBASEIV anOSßversion promises nleshit 50.52.3 billion.arm. oos pro"feiginum _‘ ' duringthoformhqunterofliiflßandwflloffe: s esdmsusflutmsvirusdidulemU.S;S97n1il1iog‚ for SU.8.2.2 Billion of thut. "zum: _ in John McAfae die Virus caused says darnnga. votsion Ihn! oommunicanes with minfiunes und Mocin soltwarewasthclutcstgrowingslwwworin. an8 peu-cum salesjump. Io SU.S.302mil1ion. mnmmmpum.whichltir oeslgning with Micro- monthmamillionhomsofmmccussary "W: lud 1h:equivnlartolmenonnous maruzfaco- ing soft md Syhasc Inc. ‘ry sofrware Mies wand 54 percant. T111: new dBASE bis man! ncw funken. in- uxriitgplmttstamlitxgidlcirxcuringallitsovqw, wltils md urility softwm jumpad 32 ginge 1’ und band: but tmublc t0 wage oosts. produoc cludixtg cmbedded SQL lngusge. mm: security 1:13:26 perocrtt. mdeducapccmtgguntesrosc . featmes. o oonvarimt utility. a mw forma mm- umhin; becameithadmboevacuatod asurcsul: l of n bornb McAfoc. Mut." ssys ager. und suppons various locnl nrca mtworlrs. Upgradostotltemwdßhsßbyowrwsofiu Einstein Was Wrong Says CornglI Student Was are at a incamaticns avnilable low cost. Virus'MaI:er‚ pravious Says School UK Electronics ‘ne ITHAC N.Y. (NB)—Comc11Univcrsity says i: Ashton-Tate Sues Foxbase Maker LONDON. 1988NOV l9 (NB)—TheDecembor beliova that scicnoc Student gruduutc computn TORRANCECAUWRNIA. 1988NOV 1904B) issue of Elecuonics und Wueless World cmries a Robert T. Morris In. B. crcated Ihe virus 111a: Ashton-Tau im: sued the malte!’ of tho oontmtiom lfticll on rncasuring die man! of infectod ‚DollcomputcrsnationwidefrheuniverFoxBASE+ dambase producr. claiminz i: eopics light.Tha urtlcle.puntödby Professor PT Pappas i: su‘ found mmuthoriaed codes und passsiIy Ihn look und feel of four Version: of dBASE. its und Alexis Obolmslry of New York. posrulms words Morris’: in oomputor Glas. T111: smdem‘: own daubm sein/m. F011 Software und Santa thatobjacucmclvelflstcthfltliglmflüs isin fatharisr henMorrisSr..56.chiafsc1ends:atme Cruz Operation lnc.. anorlwr sellcr ol’ a modified dies: conflict witl: Eiluuin‘: ‘Hmory of Relntiv- Nun _Compuner Securiry Cent: in Bethcsdn. PoxBASEpro-dtict.werubothslnmed withthcnttlt rty. Md. scctnity cerua i: pur: of the Nntioml T110 two acadcmie mthoss ltavo dcsignod und in U3. Diario! Court in Los Angola. Mhmnin chlrgc ol polccfing mpscSucurity Agmcy. built an alnotronio circuit which mcasures Ihr: Tatu 1111):: L11: pmgrum stcals notcrtly Ihr: 100k und crct govgrmmt wmpulcrs from patentiert.T116 lccl but Iltc undurlylng oumcpt. prognrnming spoed o1’ light 1o accurncy 1.151113 a 1115111)" cldurM rrishu writlcniridclyonsectlrityollltc lnnguagc. und uscr interfnoc of its own highly- sansitiva oscillosoopa. 111e rasulIs of their tests Unix o nting System. sucocssful databasc prognun. 111c suit sechs un- i m :oonclnded tha: tho speed o1’ light varies wir): erMorris took advmtngc of 11known 111c): specifted damages and an injunotion agnim: fur- the directiom Iima o! day and polarity ol’ currenl problcm|in Unix to plant thc vims in Arpunct. Ihr. uses. Thc experiments also showed 111a: many ther salos of FoxBASE. miclmssified networlt Ihn: Fox und SCO wuld notbereachcd for comment pulus nvclatnvoormoretimcs thespeedofllgh: DefensdDepanmenfs rasanten camrs. und links tmivorsities. y through m:circuiz. Most Luonishingly of all. Mama ullstiorm. Acoording :o sources who by Newsbyms‘ dcadlim. 05min pulse: trlvel virtunlly instmlaneously discus 111e issue with Thc Nur York "Firma. thrcugh th: cirvcuil. Morrisirilcndedlocremabcrugn virus tlutwould Theexpairnerureponsurebomrdmcreatcquilel siI mideincted in intime! compumrs. spreading ' Laser Friendly In oonlrovufiyinthcacldmficworldllcsnrcct. noilriy. " HüirumLmemucutoldünTin-tcs. tben Ihr.inrplicntions for cumputcrs an: very lmwuver. Animation’ wuto ‘Suspended ightsecttrinrproblemsinUrfixnctLaser trcmmdotis. Givm Ihr: righ:oonditions. Computer worin. ut I oodlng crrvr stlrtod 1.111: puogrlrn TORONTO. 1988 NOV 18 (N3) calculationsoouldbespeodedunfarbeyondourFricndly 111c...malte:of111cOffioe Publislmdual:- ran: itselfrapidlyfflte ouI-of- comrol virus pooessing speeds. soon fill disk drives with spuriousdal8. causing toppublishim sofiwuedtnslaid oft’all itsentployees und closod its Omen. The company's presst-u “Home Olfice Computing” systems cveztmally grind Io a halt. um oould b: described Is suspanded mimafiml. Replaces “Family Computing” So far tha younger Morris im no: appured in wwrding Io LyrmBarren. vice-presidentofcom- LAS VEGAS. NEVADA. 1988NOV l9 (NB)—— public. _ rding In theTimes. 11c i: expected 1o Jnunicztinn: for Print Throne Inc.. which owru Scholulic Ihr: Inc.. bei: known u I. publislwr of rlvclmhinhontencir Wuhingtomtodiscius Laser Friendly. childrat‘: magazinos. 1ms absndunod L116 lumily oase wi lawyers. Mcanwhile. the FBI says i: 1s Barren said sules offlieoffico Publisher lurvo investig 111g whethet federal laws wer: Brokat in no: mc: expecutioru und Laser Frimdly "just markatwithacompletem-dooftbemagnzimit mespmldormcvixus.

—

coroaIllUl-Iaofwcrl 1

732-5313 ERGONOMIC ALERT! Ar: you a victim of(wie: auzomation?

Dom your compusr give yoa hcadachu‘. zyexirain. ar backarrllas?

Wo provide producls und information [hat will help you reduce or eliminate job-related aches and pains before Ihey become chronic problems. Your health and productivity have every Ihing 1o gain.

DTP & GRAPHICS

—

‚

E] dagäfläiäms (604) 986-0270 Commcrcial ‚xccounts Only

OFFICE AUTOMATION Accessories 81 Supplies Seating 81 Furniture

„'‚..‘-'1.._m'nv.

nacoatpsmhpsr. -Doceunbcr19ii8 -9

besann.

miwuxkandwuruppondmbcmlafivelyhumlau. bul n h1; crep: in whkh mtde i1

cmbcmhlamoiximmyncnscofoompnmu

Full Speck-um Lighting A1LANTAGQB)—Aeompmctvinu‚whicäsats Cure For VDT Blues? IhoCPUx itizifocis u:mnking huge. mufinzless SANTA BARBARA. Ca. (NB)— A: you sit n: m93. clnnd down imiversity und military oom- your in-miml squiruing a: m:lauen. m: your 2-3. banaulaogcningsohyomuzihgeifingmvities. puigr antun: ummd Ihn U.S. an Nuvambu Acallcz loflmNcwYmtTfinemclaiminglobcn dnuyomheadhmdoyoufedmflesahrfiable. fricndofthoaufliot. ayaduausmdmx. saidthc evuuhpressod? Itmaybethelighl. Rescarchis vixus was finlpnomobcARfANEfmcnch Ihowing Ihm"aulühnnhlnfiaifur nfificinl light viulcnt. NEWSBYTES hu thus desigmtad this Ihn: Frankenstein virun. becmsc it's gotun out of

man. Entenncweompuiummsory-mflzesearch specmm lightizig an dicmnd by lighl. piomcxDrJoImOtt.

hmdmdwinlikniyduuoydizcneaofiumaku. Dnümnplnnobiologin whnhucxplwedthc InAtlanta. GeumilTochoffichlsuidüuviru: Iübicctofliflllmdmflüfflüwycumhn uppearod in m:nahm)‘: main oompuun Imund hclpoddasignaomuxpleieoflioeliflifirxgsyswm nfidlügm amNovember 3.1l was viflbly xlnwing Clown apcmium by oatly mnmuming. "lt e i n e im!)Inlnml. Ihrough IhnO-mlil Iynun." Richard ulilmc, insocintn profaunr u Tuch‘: Schon! of Campus: Scienos. hold NEWSBYTES. ndding ihn il died oncc the schon)‘: mlin oomputu was ulrnzd OH. “I! ncodod a.live CPU in Eva,” h0 uplainod.

TRON uchilocwhich i: bang ndoptad anthe educnximml mra. U.S..asfnruCopwuI1officialscmndl.nlflimIgh ((3)haue in Japan. meUnivmityofMiuIühnnnmsinmi-Jmolog ontnpn: upontirl; sysumThczcyosenufiveoi dggmethrwghißumficachnol. “Eigiuypercan rcpunedDenplnewlplpu. ihn Ußqovermnuttnidinhixkflctmmehfiinofnuixiterestwe'ngenin5(fromraauiunm existry of Inwmfionnl Thd: und Industrie um Kundin: Ilusic Iltis in i5 program." driviss) docision u: Idopl Mmushiu Elacnic phinoisayingheexpmndanmidformzmw Jnpnn‘: Indusuial n8 thc mnin Ingaliu’ of Ihn educnion ooußeofslndylobehiflx OS mduly uppresscs Anmicm fixmx‘ flwrowlllhcmflxxugeothmwuemnug- oernpnmr m: m a n In 119mm:edncnfim comptmr nurman meory. Cuin im doamod 50.830.000 T11: kmmddsoirmhtgesmiimmzfimzalmles. im Ami und worth of synmesiwx simplen. U.S. i5doeply ooanunul umlhi: aidmsemexix of givmtixeschoolncnlmflcmwnmnfi-muhu Ihn TRON architectm will chzllmga im am dunnbdtvroE-macsmrplflxubdsofrwlrehn namcly MS-DOS. Unix.IhnMacinmsh bemgivenbyPassputDuigißofl-Inlfidoul sumlnds. OS andOSß. BqnCa. flmwhoofudvisctyboardonmenew Memwhilo. Amuican mmpuicx mmufncurrmmicptopmnimhidusmnwodmprcsidenlof fimu am splitm 01!: 15mg. IBM nndolher ing E-muSynmLDavcKmmpraidemofPuspm hurdwm mnhm luve m counplaixits; howcvu. Desigmmdßominichfllmlmedfiwoflfiayboxd 5 0 m m mnkm.includingMicrosoft.relucunxly nmguinc. mninuirl Japan‘: onmpuin pmjccts must b: in: Microsoft Cofounder Gives own. viiham nomidcrllim tot w e n n ; compu-

man: ihc I

Thhislhefirutdepoopogunofiukiiadhthe

Frankenstein Virus Infiltrates Nationwide Computer Network

light npocmmi pru: out hy die tlmdzrpliaw sun. hicoompmnlight, whichhmg: lhaven wmiml. il SUS37995 allhmgh Eher: an also

floor-nmdinglndubloaiodelsofünconuflus.

Wluimtminfmnmfim? YOIIGIJIIFHIGDLÜIJ.

aIPOBox-tmomcrcscuußoaclusuuomlilor- SEATTLE (N3) idn. 34342. Includo a solf-tddruned. nu-npod

—

SUSJO Million To University

niet

Microsoft oofomdn Paul

—

Computers In Deep Space

AllanhugiveummcntonoymmoUnivmityuf TOKYO (NB)

Mitsubishi Elocuic Cum-p. hu

OryoucmlorduflicOuüghhmdgot Washingmniiuixaxyuniniuhkmgnpuviding umounced i: im suowssfully davaloped n highUtovinxswuallofoud ulmndzodsofcnllcgu lilcmurconflmnlbjoafrmnülüghxsysmm uaUnivmity Wilh SU.S.l0millim. ‘Ibmcmoy relinlility cunputcr which cnnbeusadcuuiflc the nmionwids. including Hlflltü. M11‘. m:univq- 306 Eul Coca Sinai. Smu Buben. Ca. 9310| ücxpoctedtohausedumhmocuflmninminiu unh. ‘Phi: oomptzm mmmuiully dumm und libnty oolloction und jxogmm und t0 hßlp fi- cxcludcs cum: cansedbyradioncfive particlesin slty of Mu-yhud. Ihn University of Califomia in (805) 564-3467. nmooanewadditionbflnlibruycomphx. ihn mfivase. which t: humfiil l0 oomputing Bank;- und Sa:Diegoflovamnmimtitutions First College To Givcnonbehnlfofidslnmfamenliumnths. opcnfions. md i1. will b: nppliod on artificinl infectcdincludodflxoNnvdRneuchCmxcnNavd Cogswell Allnoncemmocimdireaorofmcünivmüy sualliuuoardingnoflwcanpany. Themnchirw Occan Symms Conunmd. NASN: Amen Re» Offer Music Technology Degree auch Center in Moumnin View. Calif.. und die CUPERTNQCL (Nm-Whareehebutin ofwuhingtonhhflyuiugiftwamndemonlhs Opern: nnwinppinzzüflowmfllifln instruieLnwmna Livumm: Lnboranoriu. Siliconhfloywouldmmbcnooflagethnoflm qobyPIulAIJenUnmly/rcveflodunkegmß üom per neoond. Mitsubishi in fmthcz smdyisig TbaFi-mkaisteinvirus homain In „ m a n : ndepeehmusictecimolog? CopwdlPolyteoh- mulingonocmobczß. Anmiscsfinmnedwbc wmtobeetupthodanprooeuingnpeedtoloo undmfivmily comput- nica] Collogc. n 1mal]. privuo, Iouz-yur irsdm- worduomesusooomilliondofln In disconnecl MIPS eu fxomoaohothemmdi: lilnely in innuboonlixio tiom. i: oficring a mmic tochnology stumme. Uwomchlsuyflnegifialsormksmiongthn businessgeumnflybBlmmmmnARPANEI‘ comisfingofnserizaofcightoomsexflfls fall und lagen ever givcn In my instinnion of hab: Maliers Hand-In-Hand . T0 Produce AXPCS i: aloullyopennetwothmdrcfiu for securityon willoffa nBachelorofScieIicedogruhMudc leuningmywhucmümwofld. of som its School that rcvcalnd h1: been I! Swinging, TUKYO (N3) munwrinaicodomong thctlwusandsofsystun Tedimlogy thmugh administrativ: nngllnbusiamu who nin i: um. suning in 1h: fnll ot 1989. AXpemonaloonIpumnJIpInesevmioßofIBM thuywmrtdo somslhing likcfliis. Lemma: adds ‘nucenificm eounscoonsimolmbl. xymhnsis PCIAT-oompatible mnchinn. n: bcing suppliod ‘Ihm technolU.S. Disapproves he's imcmain wlmhn nur hws wen braten by und nmpling, und nppiicuions of music tooflmmqnbersofümAXmupmnnOEMor die vims‘ author. however. sincc no dnu was cu. “everything there i: In lmow nboul MIDI. A3Education Computer origiml equiplnmt mmufacturing huis. dcsuoyod. mflycrenmWmIhc-rflmoode ofuust inzarfacing onmpunn, und900ml design." Dr.T:d TOKYO. 1988 22NOV (NB) —The U.S. ComAooixdinglohdmtrialsomcamShn-phu begun envelnpc.

——

JAPAN

which keeps Arpmet und othn im-socured nuwowks alive carn sunrivc Ihis latest m: remnixu In

Knstelic. Cogxwell‘: Diroctor o1’ Sclsncc 1nd Engineering mld NEWSBYTES.

merce Depumnau has empauud n oomplnint

mnkcfing AXhptop PC: ariginnlly mado by IC

von n:m:Inne: NEC

AST

Model H801

Mode] 140x

80286 Processor 10MHz, 0 Wait State 2 MB, 100 NS RAM 40 MB, 28 MS Hard Drive ATEnhanced Keyboard

80386 SX Processor 16 MHz, OWait State 2 MB, 80 NS RAM 42 MB, 28 MS Hard Drive ATEnhanced Keyboard

Manufacturers Suggested Retail

Manuiacturers Suggested Retail

36495.00

36895.00 Introducing the NEC PowerMate SX 386 power without the 386 price.

11v: PowerMac SXjoins Ihc mosl compcrehensive linc of high quality, imlusuy Standard personal compuxers in the world. And cvcry onc of them is backod by NEC. a S17 billion oompany. So if youfic Iooking for a little motc oomph 0m of life. find 0m. more about thc ncw Powerman: SX. 386 power with a pricc ihm won't hun a biL l-‘or More Information Call Cooper 8cAssociates. . 1 ” . . . [S61

äBiäT-‘ifi-SRL-‘ääfiulfiäiä.

vom: NEC monucr camm

i305

' |0 tThfiCumputcrPaper "Dflaemhu i988

‚ M ?

-92[ONSDAIEAVBWUE. NORTH VANCOUVER. B.C.

NEC

Inrolmnou 31:51:56 mc.

DEALER

(604) 986-6275

(604) 631-6275

cerunic manufaorurer Kyooera. und Cuiu will cntuthoAxmnrketwirh AX PCs madcbyMitsubialiClnonnowpoduccsandmarke-ßitsown AX PC: bul cxpecu irlcrnxing demand drein. Consequmitly Carwnisprcpuixig lomceive OEM supplics of lhcsc oompulcn fmm Taiwan-hasst! PC uralter. Amt. Tho AXPCs havc bcun priood nbout 11211000 yen o: SU.S.800 man: Ihm olhar PCs. auch I3 NEC‘: or Fujitsu‘: wiginll PCs. But thaa AX groupisaimixig loctlldcvalopmmlmd poducüoncostswithmmsupplia mdlmpe: lnglln over 10% of Ihr: PC marlwt will: competilive pricing by next yur. Meanwhilc. Canon has launshed a plun to increueiupeuntlhlnyfltpple agentsmmrchmidrod withinlwoycm mdusethnepeoplcfornlesof AXPCS. Fmlbu’.HcwlcltPachndnyzilwilljoiit in the AXmarkcl. will: il: 16-Bit HP Vocln AX next April. '

LAPTOPS Laptops And The Sucoess Of Traveling Software

New Compaq Laptop Already Bettered?

wenn! mdlmve "parfonned reliably." NASA hns ordcred sevenl GRiDCase model 1530 Iapwps which an powered by die lnral 80386 micropro'

—

MACINTOSH

—

"Tank Tqugh" Printers Go Tlie Distance

—

NEQSmyo mdshupwmjustafewoftlwfrm few notioed how rolling nur new lap modcls Epplcy‘: LapLink file anrufen’ progmn lud booomc ndn-fnclo nmdrd in lhi: mutet. LIpLirlk i: arclalivcly simple ulility for movirlg filn ovcr serial coblcs with 118-232 oomocwn belwun laptopmddcsktop PCs. Butifyom compunyhu bothkindsofooanptitctahpülkorsomcflfln; like it bacomes a neoeosily. This adds Io Ihn significaumoe o1’ two dealt Eppley umotmoed. First. Toshiba agroed to alle: a private-lobe] versiert of hpLink for its SecondNEC npeud Iobimdlc LapLii-lLii-IROM. o1 read only memory, with ils fmix-poimd Ulla-d.iu: lnprop. "Hanse das]: made it easy for Eppleyk folks Inupdazeupunkhdnc. which isaversim for 1h:Mlciitnosh. u weil anDasltLink. avetsion of thc puozram which crcatcs I. dc-fncm natwork

Q-pinIPrinterS I82

for Utlllty and Economy

180 cps dran. und 30 cps near lencr quality. An 80 column 9-pin cnIry-level printer, wilh easy to use front pancl fcattire selection. For smnll and home use. illmsiness

I I

for smnll officxes.

o320/3l2l 300 cps draft, and 63 cps near lctlcr qualilx’. Available in either 80 or 136 columns. with easy lu usc from panel feature selection and paper bark. Ihcse arc Ihc fastest Utility 9-pin printcrs in their class. Real u-rarkhorses!

Travelizig Sofiwnrc also rclcuodnncw werden of in Barmy Wawh utiliry. which replaoes Ihc “idiot light" anmost Iaptops with upop-up gaugc showing how mich powcr yom batteries huve. und olIcrcd a ncw vmion o! its analog. which fcanues bolh im own producl: und man of other finnsfillofwhiohmcnns Epplcy cmmakcmoney both eoming und gering fmm die laplop rcvolulion.

Toshiba Introduces More Powerful T3100 Laptop

and SU.S2800respectivcly. Allhough

Iheyhzvdyutobeconfinncttthaflsaboutlwlflhc

pricc of Ihn recuuly mnotmeed altnrmtivo {mm HASBROUCK HEIGHTS. Nj (NB) Protons Texas. cusor. NASA will usc Lhl: man powufiilmodol: is saicl to of in Tochmlogy benearing oomplefion Il’ all fthe abovc waren‘: that's an Io “explore thc oorrxpuln‘: fcuibility u: aupport anough Erst ‘286 laplnp. Thenew entry. t0 b0 assembled in the U.S.. will offer cnpabllllias similar lo thc evon biggcr surprisc in dcvelopnlcxlt. A future future rrlissiotls bcgmnmg" in mid-l989." will offer doclcing in a new Compaq und Shlrp um's recemly repomed in version if plunned maxmer itc diflercru und mm: corwenient Ihm Power to Spare Newsbym. Thc EVER-READY bnttery oompany hn do‘Ihm: an: also sonne differances. lts 640-by- thatof Compaq. ‘llicduktoptmitwillbemuch velopedalithiimi bInu-ycall Ihll im uvicemclife morelik astnndardPCJiromthedeuiladda480 VGA display ina gas-plunu unitmha Ihm allmlirlc 0611s. ofequivalem phlm lo Thccompmy ‘I've beta given. I would ny du: 1h: an LCDmdmay um: oither4or lüshndeltot’ suiption a mies ol’ disposublc bflllflrlc! for laptop launch mm willbethculliznnereoligrey. (‘Hut zspect ol’ Ihr: dcsign i: notyct final.) znion aLaxIngmmoa oomputcr 115m in lhc sownd quanctr of n c x l ycar. Sundml mial. parallel und VGA poru m: also ofllhist strntegy. Pficingonmenswbauericsiscxpoctedtobe Grids Space plmned. compinblc wllh existing alknlinc Imils... Theunirshuddiskwill oonleineitl|=r20or40 FREMO Ca. (NB) GRiD Systems says ils MBcupu-itic: but mI-‚nsures A wen: 2 1:2 inches. laptops will b4: nbonrd 1h: xpace shutflo Atlantis Smullc: drivc dimcruims will raduce Ihe weiglit Iltis .Astrurla‚u.lswillusethctrltomcklhe of the machine In approximmly im or cleven shuttlds urse und hclp phomgraph m: eanh. Abaton Ships Integraled FAX! pomds. The drive’: low powcl’ requirementa will says GRilTs Prcsidezlt und Chicf Exocutiv: Snm Data Modem also raduoo theenoru cvonsmnption mcl nllow H16 Wiogandl The ride into spooc for lht: lwo laptops FREMONT. CALJFORNLÄ. 1988 NOV 9 (NB) unjtro opamcupto l'on: hour: on nchnrge. One will b: _ ' new forGRiD. whusc lxptnpo luve Abnon i: shippirlg tho lnIerFax 11'418. a faxl moredlmmsionwillbcrodmcüflummddfl been tbo somezüslmnle missiom sinne i983. MB Imits will be pricod II. Ippoximmly A! this i'll. howcver, thcy hnvc n povcn incl: modern for IhnMacintoshII. 5E. Plusand SIZKE. The lnterFu combinca m:semling m:receiving

LAS VEGAS. NEVADA. was NOV I9 (NB)— Prcsidcm Mark Eppley of ‘Prüfling Software. Bothell. W931i,. was um: roluod.lmppy camper n . the Fall Comdex show. Whilc evczym: wu remarking on Ihn wide breadth ol‘ lnptop wmpulzr offering: Epson. Toshlhn. Zmith. Compaq.

—

SU.S

— .

IRVINE. CALIFORNIA 1988 NOV 11 (N3) Toshiba America's Information System Division hat mweiled mupgmde mits 13100/20portable oompuuar. lhß TSIOOe (e for “cnhmcedfi. 11a: new lxptnp fcanxres nbener sei-cm. liahwr weight.

‘

24-pi Printers for Hlghest Quality Text Performance

qnd

und n lowcr prioß. ‘Die mochlm ls wo pounds ugixiammmemioqweigbangmuizspoums. 111e scrocn fcaturca bcucrconnnt. mdtheprlcels SU.S.400 lass. Dualen expect tbc T3100 In b: discondnued in favor of Ihis ncw modcl, which

0390/39} 270 cps draft, and 90 cps letter quality. Availalile in either 80 nr I36 columns, with easy In usc front panel featurc sclectiam und paper purlc. Llwse are. perfect all round printcrs for high prmluctivily officcs.

will ship llfis month.

Laptop Workstation lntroduced Frorn Toshiba

‘IUKYO.JAPAN 1988 NOV l5 (NB)—Toshiba

‘ 3 9 3 - 450 cps draft. and D0 cps lencr quality. A I36 column 24-pin workhorse for Ihe busy officc. Easg/ Io usc front pancl fcature selection and

Corp. has released a new lnpuop potsonal win-

putantheßlüllnlapulosovmionoflheToshiba T3100. Dubbcd Eupen J-3IÜJSL 02l Modal. lhc lövbil luplnp oompulcr h2: I. blcklit liquid ctystal plasmn display will: n rcnolulim o1‘ 640 x 400 pixels. 11m displny also uns brighmcs: or contrattmnirxgandstrpptansareversemodo. Tim maohine has Intel‘: iSOCSG nt itsoore, und n20 megahyu hard dlsl: drive mit. 11m Bnhnnoed version of hpmeae MS-DOS is btmdled with the mnchine. und m:otiginal (English) MS-DOS is also avnilabl: u m oplrion. Thc systnn i: mnuured |1 311111111 wldth x 330mm depth a 83mm heighl. und weighs 59kg. The pries in448.000 yan m GUS 3.600. Toshiba Im: aet Ihr: mtchine‘: nlu Llrget lt 10.000units by Mach of ncxt y c l r.

papor park.

Laser gPrlnter ‘laserfine 6- 6 pages per minutc -

laser qpality prinling at a budgct price. |

CDI

COMPUTER

DISTRIBUTION

00mm: u: a ringsum: rmmmarn o!

‘lllncnuvu ü

B. G. colgary l. Promax oronto I Ontario ontrnl i Ilnrltlmoo

(604) 984-0641 (403) 250-5706 (416) 479-7500 (514)

333-8200

um Amnng. m;

‘l-EllJ0—öli3-63fi 7

l 800-26333?!)

1-500-661-8546

u l 3006614555

_ ÜmcnttlnitqPspgr, gpgcombar„l9ss_

„s.

adtlresnble memary. “Lotus bellen:

Sculley Computer Chainnnn altere: of bis Apple malt et ebom SU.S.43.00 per shnre. acoatding mdie Seeurities und Ext-lange Coinmissian. ‘nie nie wauld luva grauer! SU52.150.000 far the Apple clrief. who still hold: 109.357sltares. Apple willuatomnmattan

3005454043. Panne purthuets of (h: DOS versianafAgmcla will Fmd mAgHIdaIOIOSB requestctrdln enchprodractboxflltccastfattlte 0512 Version upgrnde in einher case is SU.S.25.

Whenaperathrgasafaxrttodumlhelnnerliu impamnt toextcndthebenefits ofAgmdatn 08/ IdhHcsIDCCHTGIOupSJIOndIrds. Fuescan 2. xiverttlte sipxlfiennce af Iltis openting system beaenlalßilobilspctsecottd. Hiemadernis n wematte imo 1989 und beyond." slid Michael Knlcy. directar o1’ personal informrrian mlrrngeHrrycs-cornpatibleatllflübwd. sditwnre tot Loms. ment Sculley Sells 1/3 Of His Stock f0: OSTZ i5 avnilnble immedillely 1o Agmfln SANFRANCISCO. 1988140‘!l5(NB)—Apple Itsertsviearoll-fieemrmbcr: currmttAgcnddDOS im rald50.000 John

“The

Sharp

Advent”

OMNI

„qn,

et us help you mastcr lht: computer skills necessary m makc it in today's fast-paced business worid. Gut slarled today b)" enrolling in any uf thu fulluwing courses now offcred anOmni

Professionell Computer Collage. I Pagcmuker I Lotus 1-2-3 I Bcdfurd I dBasc l i l + I WordPerfect 5.0 I Microsoft

Sharp 4500 Serie: Laptop Computers The Porlect Aldel OPTIONS ‘PCDCI’ Competlhle *1200 Band

FEATURES ‘Cotnplclcly Portable ‘Racltnrgeshla Modern Bauer)! ‘Expmdnble ‘High-Spead Memory Procensing AI our speciel low. low pries

3839.00

Wnrd

I DOS I Disk

I Desktop Puhlishing

Management I ACCPAC All courses are taught in our new lab utilizing Harddisk cnmputers. Hurry! Enroll nnw whilc spccial pricing is in effecr!

-‘1603‘:.‘.°“°

FAX PLUS 0106-950 W. Braaclwey Vmwer- B-C- V521" Phon: 736-2752 m: 736-2735

S300

lnr more Information

Cull

While Qumtities Lut

OMNI

PROFFSSIONAL COM PUTER COI .| JTGE Rcuincrcd n» a: Private Training Institute

umler Ihe Apprentice ACI.

thastocksehsayhgifsfltebufinenofindividunleuecutives. ThenIemakpheearIAugmxB

apowufill Computer‘ SBwhichwillr-ival thepowerofitsatrrerlmeclnmllllnflmuoltfinglofllo Snnl-‘rmrcieao Bruminer. Tlta report slys tlte 5E. will tue Manuals‘: 68030 mictaproeusar. will suppart betwam füllt.‘

anfleightmegnaymafruxdantneeeasmanwry. und will luve InopüomHO 0|’ 80111991813 Mrd

disltdrive. ‘llrexruchine willluverwo cxpeneian slou und nbuilt-inbleck undwhinescreen. er welL llrenewshitsomeindusuyobscrven by nun-ist: sinoeiteppears antarget enew sEumesme merke! sogrnent targened far Ehe U und lDC. Even

willmtbeoutin l988eshadbeenhopüandnrill

umameenrrewreleasedmvlitltinefewweeh.

Douglnßdwudsoflrlfatntixseystltedeleyisdtre taitxrpleznenmioaoftltellypeßaiptlpplicuüon devclopatemlenguageandthnthaenehsignificmt lechnicel obltlaclel” in the wey.

Mac SE Hattest-Swing Micro curatrrmtxcrun-‘onmntmnov ll (NB)

-— Tlre Mleintmh SE

was

Ihn fasten-senkt;

uricraeourputuinluhnaooordingnolnfocmp. n rnlrketreseatchfinn. Tltesßhelrflpercentofell miaoseles followed cloeelyby AST Resenelr‘: Pmlniurn286wiricltheld6pnomlofsflsales. Epsonäßquity l wuinthirdplnoowithipercem ol' salee. In donn- ahnen. lrowcver. Compaq‘: Desltpraäötooktltetaphonormraldngin 13 pccent a1’ all rnoney sperrt an micraeamptrrer-r.

llteMncintmhsElteldseooudplecewimflper-

EasyBill Medical B i l l i n g

Restaurant Management

u O

InfoSpec Systems Inc.

Fan

MORE INFORMATION

CALL

75-69% Sinai. Bunaby. B.C. V30 3M4

FREE DEMO

522-1122 an 522-9711

Computer Papi: v Dcocmbcr 1988

menlplopclflaePCindusuyhesevuseetr."

amardingtoMicraaoftCheimtmBill Gutes. Presmtationhlmagcrglves lBMcomptrlenminlctfaeewitlt Icons utdptrll-dawnmemts. midal papttllrlzad an the Apple Computer Macintosh. The pmjecl look 18 mantlts. hundreds of ÜWII-

smdsafrnm-haurs. andconsists ofsomedmflm

line: a1’ softwuc code. OSIE with Presenutian Manager provide: full o1 Intel fiar pratected mode B0286 und 80386-12531 personal Computers. allowingusen lollpttplo lömegubyttesofreel

—

the Apple Macintosh. lnforrnirt says die pmdaet

Canadian Payroll Video Management Retail Point of Sales

opcningrystetn. Ihr: "lernst sohwnra develap-

discussions abom Wim‘: going t0 utmdardgxephicalusa Tskey fcalures, such es multitasklng. simple und bis source repom. rm1." huppen . intuitive to use. Apple omcials wouldnotoommenton thertary. Eether Dyson. Of Ihe on-titne ermounaement. SouraasdsonldmpepcthnApple will malyst 1nd Inventar af die um “vaporintrodtxoeeponebie. lzpountlMeeintarlulowr- indusay wm” for schwere whlch dann ummaterialize pricadMecinvochllsyttermurdehigh-crflhdacin- ootnrnatted. “It's nie: ta see samethin; ihn:ships 10th II in 1939. antlme. lt shouldrftbenewr. laut itis.” Unfartuhlformix Software hat einsamen! yet umher

General Ledger

Microsoft und IBM hevc

Gunsten!

LENAXA. KANSAS 1988 NOV l1 (NB)

The Profite}: Systems

NEW YORK (N3)

repanerPsulFriebergernotodthathissunesourees repon praduct phns havc becn clnnged repar- mernaryafatregigzbyleotvimtalmenaozytltratrgh edly du: ta interne! squabbiing erApple. “Thema interfiwe ummit:OS/

Wingz Delays Slripping

Software with Quality, Power G’ F l e x i b i l i t y :

—

Presentation Manager Ships

madezaodantheireamtnitmmttashiphesmmund amounnad l0 Almost e tltirrlof Scullcy’: mal tianManegetnthegrapltlealuserinufnc-eforIBM Stock haldings in Anale. und aornpetible mlclthtas. an tirne. Ort Hellowconfererweto enmarwafirntsheldejaimnew: In New Mac SE Due January Prerertutian Mmlger" was acmplete nnnounced SANFRANCISCO. 1988NOV l8 (NB)—Apple andoutthedaar. Thelutpmoflileosü ncw Macintosh will tmveil

ddtyinlherelelseofwmgzißsxxcadshaatfar

umit's

aepebilitie: urirh unodem anrlcous 8153.495.

oenturdtltcMnciunshllwscloecbehindw-iflr? pereentohlldollarsspat. Amonganfimtssellingnficros. Applehaldsute

laldirtunilmathatshflmwfilutirlg l9pucantof MMamdpIaeehIBMwimI-‘i

Compaqisrhirdwimllpereumerfi Epson. AST. Hyundli, Kenia. IndNEC all lnil thaleadss. in Ihnatder.

percent.

OS/2-PS/2

—

MCA & CD-ROM Connected"

TOKYO. 1988 2:2 NOV (N3) Sanyo Elccu-ic Co.. Ltd. will toll au: inlerfaoo band; whleh

comeamMüMicrodurutalAmhileamrflMCA) m] aamputen wilh oampect disc reed-anlymemoty (CD-ROM). To statt. Sanyo will release 198.000yat (SU.S.800) interfeee band far IBM lnpatfsmacltines. imltzdin55550-T‚SS5O-S.5570— T. and 5570-8.

Lotus Ships Agenda Fot- OS/Z

nur: samt. Borlmd mnaunned Sideltlcl: an PrescrtlsliortMmagetwfllbeaveilahleby theend a1’ tltis yettr. Other companlea. Aldus. AshtonTata. Computer Associatet. Digital Raoeuvh. Lotus. rndbs. Miaagnfx. Mieter-im. Schwere Publlshhxg. 3Carn. und Versand. all armotmoed rlteir strppon far OS]: md Prucntation Manager wirlt farfltcarnin; p-aducls. lvfiuusufthtendshomflnrtmeOS/Z 1.1operating systam will: Microsoft Excel for PressuntiortMannger. Buttheaatnpenrynrillnatseywhm i: will be tvellahle.

PC NEWS Worlters Challenge IBM Soutlr Africa Policy

MANASSAS.VIRGINIA. 1988NOV22CNB)— In m Irrtums! man. 61 International Business Maschine: emplayees luve signed a raqaast far

fliMshneholderstavamenextApriltosnapell meines: with Saum Africa. Ahorn half the employeeswhasigttedthepetitianwarkittflwweshlngnan D.C. au.IBM physicist James L a s 101d thewuhingtarPostflfoel tlrarscllirrgoonrpat» e r ! t0 nlmostertclusively wlrile carstomers in Soulh

Africngivnmppantatiteapartlteldsynemufi malte: IBMcomplicit with aparrlteld." Leu seid. IBM workats m lmownfor rhelr carnpmy layalty

und seldam cdticize Ich: oampmy irtptiblic. IBM memgemem hu rrude | aarnrnitrnent w Inka no Nation 1515m!the cutployees.

PC-WRITE 3.0 Shlps

SEATTLE.WASHINGTON. 1988NOV l9 (N3) —Quicltnaftis rhipping LiwlatestupdateafmWrite Sßandclnirnsithu ovcr 5Wnew fenures. Tlu: popular slurrewue progrumbrealut Ihe forme: öilkllobyteftlclimit. Users cannow e r n t e filess lnrge es the D05 memory af their oamputer. ‘Theta nrenew fatumting andprinting capabilitles

including eine: wlrich 8110W! Users l0 formatiert: in multiple oalurnns. odited an screen. und stand u column: in Lire file. 111m: ue 219 new print: bringingthetotal ofsupponed printers to

—

CAMBRIDGE. MASSACHUSEITS (N3) Laut: Developrnent Carp. hns begtm shipping in Agentin personal information mmegemeru saftwuc far theOSR operating systern. Lotus says tha fahre: und fmctianality o! IhnOSI2 versiert u; identicnl lo Ilre DOS versian of Agentin. the new productisebletouseupra lömegabytes of r

nnely. Ilrere an still few ptagrnrns tha alte advmtage o1’ 05!! und Presenmion Manager. althaugh mm1 eampnies lutva expressad plane u:

was.

PHC-Write und Fricntls i: du: zusme of a, new cmlog of32 other shntewaretitlers EromQuicksoft. I! is available by Calling the eamplny.

111e suocou of PC-Writc. sind: in inlroductim in 1983. 11a: propcllcd Quicksoft Erom n SUS.l7‚000 u ycu: oompmy to onc nnw umhin: ova- SU.S.2‚000.000 umually insnlcs. The producu i: disuibuu-d a9 shurcwurc; users oan copy i1 undshum i1. und thcy nunrcgistcr for 5U.S.89 und receiv: cm-rent mftwazc, u pintod manuul. telephme uupport. und u nowslctxor. T0 enmuruge copyürg Incl": 5:1 u S U S Ä wmmission euch dm: somaone regislms frmn um of lhcir oopics.

Tandy PCS Resold Under Panasonic Name In U.S.

—

TOKYO. 1983 Z2NOV (N3) Whon you so: u Panasonic IBM ohne in you: locul muil uhnp, don't tllink it's runde in Japun. lt will be u U.S.mudu muchim1mm Tumdy Corparninn cf Tun. Matsushita Elencuic Indxmriul, 1h: oompuny

hus 111e Emotion: o1’ die mlier 05/2 prodnct, Displuywrilu 4/2. IBM hus also ummmced Llnkwuy. u uoftwurre product thut lets educumrs develop their own spec-iulimd ugplicutionu. The unftwu: includcs 111e exumplu of u lassen plun. 5nd: book. cluuu-

Q5111) SOFTWA "n;

roomreuowcemuuugunmdm-doliugcremad; M111 LinkWuy. T11: softwure rquiru 333 kilobytus of manmy. u moute. und u uingle floppy dfive. A. uinglu pucluge in 5U.S.1l0‚ while u school licuue for llcapiu i: SUSA9S.Qualifmd educutmnul" irludmtionu und horpiulu Ire cnntlod" 1.0 u 20 pcrccnl. diuoounl.

InfmflwIBMns-‚ws. Ihcoompmyhasmnomlcod u devicc (hat hnlps poople With speech und huuring problemu leam mupeuk man cleurly. Speechviewer useu picm-res on u P512 uynum m dßpluy mach uuribnms auch u pirch, Ioudnus. nmking Panasonic productn. will receive Ihre: und fiming. I1 givau 1h: upeech und hcufing immies und aight Moduls of personal compulzi: on puimd inutunt fmdhuck u: they pructice. IBM uuyu an Original oquipment munufucnlring busiu Emm theproductresulredfinm udecude ofruaurch u: Tundy Corp. und will conueqxiently reucll thcrn a: 1h: IBM Frunce Science Cent: in Paris. Thc lBM-cnmpnihlcs in 1.11: U.S. murkcl. SpuchVicwu 1:11. o! uoftwauc. docummlu. und Mmushituhuu uloppod cupurting i1: PCs l0 111e cquijznml. cm1: 31.13.1200. n01. inclmling 1h: U.S. bucuuue oflhc 100% Izuiflimposedon 16-011 cusl ol’ a oomputa. Lust Jmuury. IBM innoduoed mushixrcu in Aufl cf last yeur. Sorcai Render, which lets blind usurs heur m7.! Thc oompuny hus been murketirxg prinrets und displayad on their scrams. floppy disk drives in the U.S. matter. Wizh this Fights Keyboard Phobia agounam. i: will h: ublu In 1:11complele m: cf Wang Conccmed thuu topMuss. (NB) LOWELI... syswms. lncludingPCI.und:1h:Puruuonic brund level executivcu ure tmcontfonublc with typenumc. wrilzrkeybourdu. Wung hbcrutorics hns ttnveilod H-P: One Milllonth Laserjet u xyutcm cullcd Frccslylc. Thc combinalion of Pulo Alm. CALIFORNIA 1983NOV l1 (N3)- hudwur: md Software ulluws cxocutivcs 1ouse u Hewlen Puckurd uuyu i1.huu Sold its m: nfillioullh speciulpmtommkelccuwlicdocummtsonu Laserletprimcx. mm: thmull other vendors. HP sonnen lying flat onthe dosk. An optional davioe intxodwod Ihc first desktop lusu prinm. die HP ullows Lhe user to diente messugeu 11m cun b: LaserJet. inMny 1984. “Solling the milliontl: HP machst! 1o thedocument. Frwityle 1sdcslgned for LaserJet is more man just u nie: miluslona." personal oompums using 1h: ATbuu. Thc buuic boasted John Ymmg. HPprcuidem und chic! ex- symm will um ubout 80.8.2000. whilc x11 111c ecutive officer. "It uluo mxdmoores HP‘: history Option: will bringIhc price 1.0umundSU.S20.000. of offering cusmmeru n g w bcmfiu by dclivcring Wmg uid. high quulily. reliuble products Lhut udvancc meh- The New Word From Microsoft nology." -—Microsoft has anThc Lascrletseries oonsists o! 111e HP lAlefJCl. REDMOND. Wo. (NB) Version 5.0 for IBMs und comnouncul Word 14931::Plu und LuuerJet S00 PLUS prlntzm. punblc: running MS-DOS or OSQ operating sysWordperfect Wildly Suocemful lnln. T111: pochwt‘: ncw fcumres include suppon OREM. UTA}! 1988 NOV 9 (N8) —The ward for 05:7. antun: undcnpundcd mcmtry,built- In proccssor o1‘ WordPcrIocl Coupmtion. usurping network suppon. gruphics intcgxulion. Prinz PreWordsta a5 1h: most populur ward pmccssing vluw. urmomimxs. enhunced documcnt manage:upplicuricn. 1m lnought home rooord-bueahng mnu. und rculcvul. multiple colurnns on screeuz. of und usimplificudon o1‘ common 1331:5. Micmsofi revunneufortheoanlpmy. Inthuhird lhiu yuur. WmdPurfect huu sold 505.50 million cluimuupeedhusnolbemsucdfioeduxxdthatm wcnhoflhepmdiuclu. unduuluu fdrtheyeurmeSZ sonne cuscu vminn 5.0 i: fauler man vmlon 4.0. paccnlluigharlhmluulycurä. Tllummpmy uuys Mlmy o! lhc inrpruvanmlu um duigned for thc some 650.000 oopics o!" WoudPafoct huw: bcan desktop publishcr who noed: 1o rcuizc gruphiu. seu u documanrs luyout und preview die finishixl shipped. ran-sann betone i: goes to (h:prinlcr. puodiact Lotus Add-ons New Catalogue There i: also more on-scrom help, with 90 Grund Jumüon. Colorudo 1988 Nov 11 (N19) ‘Ph: flrsl comprehulsivu guideto ull theudd-ons. fcumrcs azlineconrpured anIhc 30 in vursion 4.0. Thc poduct i: expected 1o nhip on Dezember die udd-im, und cnhmounau products avuilablo und h5 u suggeulud mal] pries of 31,1988 for user: of Lomu 1-2-3 und Symphony 1ms beim 508.450. Uscn who buy Word liefenOcnoba 1 Lotus publiuhadbyVexioonrp Publiulüng. "Muldng cm upgmlc for 8113.75. Thoue who bouglu it work huxdufor you-Adireclor ofmhurmement alle: get u froe upgndc. Microsoft Word 5.0 npmgxums for Luxus 1-2-3 und Syrmphnny" i5 quires SU.S.19.95 und uvailublc dirccfly Erom Verionmp 312K alwodrivelßMoroomputible uyulnn with mirximmn memouy. Publishixig. Tlte book oonlaim irxfonnutiun an 1,1m tn- TELECOMMUNICATIONS huncauneznt products fiom 476 wunder: und huu feumro-oriorlted producl descriptiom, wurde: FAX purticularxproductpricirlg. und informutionubout Computing Canada 111c product‘; oompalibiliqv wirh the vuious veruions o1‘ 1-2-3 und Symphony. 111e bool: also On-Line Expanding includzs u posr-pnld posrcard which allows txscrs ‘ronom-o 190a NOV 8_(N3) Compulirlg u:nqucst informurion m:poducu in the book. Canada. 111c national computing newspupa. hu Order: muy b: pluced by muil In POBox 55238, Immun-und expunsion of 11s onlinn Service. ComGnmd Iurlction, Colorudo 81505; b3! Calling 8W- puüng Cunulu On-line. Sturrlng next month. 234-1140 inEhe U.S.o: 303- 241-5800 clscwhcre; puyingsubscribuutocüünrillgetmorenews und by FAX 303-24287321 b)’ MCI Mail u! 3325- 0111er feutmcs. FICC ucocuu will b: mduoad 1o 12 mimutas per duy for all Conupilting Canada sub2479: Compuserve u: 7601013466 or by modom 1o scribem. Anunnuul subscriplim fec ofCS49 will Vericomp’; B135 u:30'3- 242-8741. lruytwminutcs’ uoccssperduy. WlxilcullCumputing Canada suhscribers will rctuin free was: IBM Upgrades Displaywrite, rod e m servlous. o1’ the new scrviccs will b: Offers New Educational Software uvuiluhlu only uomuny puying subscribers. RYE BROOK. 11.1’. ( N l l l - lmumutional Busi- Expansion 1m ulnudy bcgun. A now Munugoness Muchines Corp.h8! rolledoutnvo nnw prod- rncnl Forum. üvoled In truiruing. wuu addod last ucu in 1h: DispluyWril: Word procenor fumlly. nxonth. boouting CCO‘: cn-line oonferemirlg m DispluyWrito 519. i: u high-crld ward poccuuor live munuguncm fomms und 11 spociul inlcrcut aimed für Ihn 03.32 opezufing syswm. Displuy- group mossuge basos. More umplumiod. This Write 5/2 Composar is u puge luyout und docu- monuh polling, u vchicle 1o uolicit uscr responses mcnt compusition program also dcuigncd for 0S] 1o current irldusuy issucs. automalicnlly Lally 2. Additionully. IBM 11m mnuunocd Display- thosu responses und distribute rcsults on- Iinc will Write 4 Version 2.0. fut DOS-based systmls. I1. be implummuud. Next momh. CCO will odd man:

—

5% voflama

Gel your best hardwcre decls C11 Vancouver Online Svslems

soflwurc und irmovutiom: oompulur

buaod answeriixg muchines. spoech reobgnition boards. baroode Maden. auch druwaru, OCR scannen. CD's. FAX band: und upeedlll ü’ PclsELL. m; Polnt of Sule um lceeps invunlory. customur r rds. ordern. sulas. und suleu by cumgory: mitodto wlfiuleuule und mm1 operuuonu. ‘r CClM-LAW. A bwys‘: plagt-um forilim: und billing, nun uccoumu und ' m h morc. ‘i’ IN URE. Aninsunnccprogmnfor a1und moto: vehicle use. Tracks g

Speclals

e 299-3340 ‘

nllno

1.:,”

ävelamo

Alllance

‚

;

min!!!

Ltd. Box 80969. Bumaby. an. V5H 3Y1

644-8557 in umLower Mainlmd

mdnoomvor

your neods.

|i Computer Systems

From S1400 Phone usfor lols of x-mos

u:und allem informution.

Bluslness

mmcompculblc Systems

MONITOR. ‘I'M: Sroclrwuncher uuilcx duily flow of 1 m m und 511a und will pick 1h: biggeut nimm-x. G‘ others... Audi muny uvuilable for 55-820. Quotes DEMOS

_ . fl

nimm

.Or even networldng. Wo exisr 1o malt: your job um:with au:

e don't cxisl u:just soll 11m bcst I performirlg hnrdwme o1graut ' '

—

‚

Y0 BU INESS' NE s? I

A 88S Subscrlptlon would make c I Chrislmas g grau?

Lcrgesf Collecflon o1 Onlhe IBM Soflvtare Full Müll-uns Stpporl

um:

Mossaglng 8: Confarerwclng

u».-

uns: 524-2440

‘l

or 573-4675 i’!

;

BIG BYTE® LOTTO W|N! WIN! W|N! Software program runs on I.B.M. PC/XT/ATor clone

—

128K, 1—360KB. Stores over 100 previous winners user updates. Wheeling system based onproven betting methods. Any pick type o1Iotto, (i.e. 6/49, 7/50 etc. t0 l.’

(Add 32.50 shipping and handling) (B.C. residents

add 6% P.S.T.)

Send cash, cheque ormoney or

BLAIR HOUSE INNOVATIONS P.O. Box 7, Port Moody, B.C.‚ Canada V3H 3E1 Computer Pupcr v Deccmba 1988713%

"P6114:nur:iznpwtanl. Minilel plms loofier utilitywilloonvathomTlFPformtforuunuis- iunuviouhuawiihoulusim-Ilpmarldngivc siomConversiorßforerponnemppondfmDr. awny Minimal letmilml emulnlion sofcware n: PC HHIDCITIITIFlÄPCXJIflOCR 838mm‘: Rand- ownax. In a prcpared smtunenr. MSC fiuidml JcuephMuzzcosaid rhisfinnknsitposslble forme Righr. ADTeach claims In b: du fint fu-board manu- {nur million PC owners in North Americu wlm facmmrrooffermail-rmgeforfuuumniuimis. hlvcmodanstonccessAlrleric-an. Frenchxnd Tho sofzwm’: exclusive Muslim (TM) Clnlrliln infoxmatiom. enmnnixunmt. shopping, feamm combinu lhls rnnil-mugc Iucility. bmkingamdolhezservicesvirmallybypiddngup for personalizing dal1. with broudcast llmphonemdprovidingacreditcxdnumberffle capabiliües; Muslim: allows easy cus- nddcdffillllhousadoesiscall MSCmbuinfir: tornizing for llxgc numbcrs of nutomared Minitcl emulauon softwm. Incl all servtruumissions. Signaturc und lenarhead icos on the system m irrurm-limly nvailnblc.” graphics can nulornnlicnlly b: morgen! u wcll. ‘Ihr: mny prove difficuli. however. NEWSBYContact: (818) 578-1339. 578-1264 T35 was Inkl by direcmry usislmcc opStax am all supporwd. In addldon. n wplrne

phmz längs und olhu feanxres.

supportlorTcleoomCmndtrbntnpncpackct-

swirchednntworl: und iNeI galcwly savice will

providolowarlong-dinmcemufmcullmncross Cmada. Editnrillcopy Erum Ihn: biwockly lxinwd odifionofcomputingcmadawillbcmflixrcscnm than bafore. thc puhlislung fu-m laid.

Board Offers Exclusive Option:

PASADmACnWBHAnuicmDmTndubgy (ADTach) will nrmmmoe lwo mw [an boards n: thir F111‘: COMDEJC. Thc SMARTFAXplus will replace Ihr: Original SMARTFÄX a: Ihn

oompmy‘: lop-uf-flw-lixlc unit. Thn boarrtl adds scvcrul new optional feanlres anSMARTFAX‘:9600-1399 {u modern. Thurzcmdproduct will alle: 4800-bps petfoumancepricedmo low m lcnlc. Hardware optiom for rhe SMARTFAXplu: include a 1200:2400 b ] : Hlycs- mrupuiiblc modam. an on-bonrd scannen" iruczfm: which suppom aithar 1h: Shnpucm m Cum scannt: (an HP lautem modal i: in dcvclopncnt). DES encrypfiüfl. hnrdwm implunmlaxiou of CCITI‘ grcup-Ihree du: vorlaut-säen (fior up l0 sixly limu i m : cumprcssion tlmn typical schwarz mmpession}. nulomatic uralte up (wimm uclusivo ins-tml-on feanm). und n ilnrul-alom-[u intufiroe(forusing alocal fu n: nscannczo: pfinlzr). Wim 11l oprion: imullcd. Ihr: bourd oocupiu bur. a singlc sloL

First FAX T0 Feature Mail Merge Rolls

...

ADTcch 11:0 reeently developed nur xofxware which operaras across rheproduct linc. SMARTFAX soflware nun be inrplenmrlcd n: cilhc: mzmoxy mridenl (wilh pop-up Icnd und background receive) or an dcmand. It providcs scroen cupnlre und simple ediling cupubilifics t0 add tcxt or mm: imngas. 11:4: schwarz also includes the abiliry u:aummnlicully ounven files from man! surndnd formal: u: liax-tnrumlssion formal. ASCII man. PC Paintlarush. Dr. Hain, und Word-

eruors Ihm i: no lisling [m lhc Minitel Services Co. in Whiu: Pluim or my-

lax.

MCI Enters The FAX Business

WASHINGTON. DC(NB) -—— MCI is crearing n separate mtwurk to handle facsimile trafiic. The MCI Fax netwcrk will 1e: oomparfiar monimr In use. get consolirlated In: bills. und m: m».- stornmd-forward capabilities aommon Io MCI Mail. MCI ätimued Ihn SUSB billion i: mw spcnt sondlng In munge: euch ycur. und Ihut the figm‘: will grow In SU.S.9 billim by 199l. Urin; MCI Fax. you oould broadcasr a in: mcssuge whmdredsofmachines u onoe will: an: cull. adding n lisl of reciplmu. (Righl now. in man: have Io Call auch fu mnchine w which they're brondcaning seplnlcly.) PC: und lclcx machincs will 11.10 b: Iblc u: acnd mcssages w MCI Fax und hnvc man translatod imo fax mesngcs imtanlly. Ordcrs arc now being ralren for mvioc Io 51m in lau: November.

wbereelseinlhn9l4urnmdaflwreisn prc-remrdadmmagcinlhc2l2ureawde. however.

TRENDS 8c

TECHNOLOGY

Intel Creates 80386 Chip Glut

Slnta Clura. CALIFORNIA. 1988 NOV l9 (NR) —'l"IIc industry is awash in 80386 chipc. 2.4 mil-

llonoflhcmtnbeexncgmrdmdcrsmslowing down. Thir comu fmm Inlel itscll. nmkc: cf die 80386 micropmcusar, which admils (hat i: runde

toomuchofugoodlhingundwlll sufferasarnsulz. Intel says lhis quma": revenues. duc out in Deoanbcr. will {all abou: lOparccnr frorn figtrres reponed in lts Ihird quaner of SU.S.785 million. lmol denies n repon thu mm: cusloma: u: Minitel To Connect lts French rotuming lhe 80386 Chips. bul Idmits mm: cusAnd American Online Networks torrm m going lhrough m “invcmoxy verrec-a MITTE PLAINS. NY (N8) Minitzl Services rion." 1mal Chief Exocuüvc Andy Grovc said in Co.. formed October 4 ro_ sprend a U.S. Version of prepared slalcmcnl lhul h: cxpccls lhc slowdown Ihr: scoond qumer of 1989. Lhe French Minilal online wwice. will offcr u will und by lwo counllics. In betwun 1h: Frmcc. New Chips Reaching The Market galewsy Miniml has 4 rnillicm nur:und 1,500 online serv- SAN FRANCISCO 1988 NOV 7 (NB) New ices ranging fnom the cluxy L0 lhc munchy. sanioondmwrs have bcen announced which cm

—

—-

rmmorymRAMfirxlsnmlletWaf-‘vßlndplnlll syslmi-lcvclfmwlionsofuflopw dfiveinlshalß Chip.

Intel 1ms mnounced lhc izndustry’; i'm: floppy clisk oonlrulla’ (FDC) t0 integrale all systarn-lzvcl finmlimrsunnsinglu Chip. Thc82ll77 FDCJVh-lflh npporu bolh.5.25 andSJ-inchfloppy disk drive:

ofuplofouzmcgabytmhasaperpmdiculu rccording modc which Supports Ihn einer-ging vertical recmdirxg fomia. Siemens. Santa Claxa. Co.. has introdrmed n onc mngahit DRAM chip moasufing 47mm2. Thc HYBSIIOIJOA has In man: um: nf 70 nanoseoonds. Full producüon i5 wider-wagt n Sicmsns’ facnmy in Ragensbmg. WesiGu-mmy. Simons is among Ihn faw compmio: prumlly mmufacMing one megabil mcmmy devioes und has sanrpluz of four magsbil DRAMS Ivailnblc. wilh producüon qumliliu achnduled im 1989. ü Technologien, San lose. Cm, has annolmcod nchip ümlcm b: und intho croafion of IBM PS1‘: Modul 30clcmcs. butclorles cnpnble of higha’ pafomumcc und tastet spe-ad ihm IBM‘: Original. Thecompmy says rhe 82C230. buod 0m rhe Intel 80236microprocuror‚ willcnablßhlodel «

—-

Melone: lonmlltwicclhclpoudofaModellifl Horn 8 In 20 meguhcnz. NEC’: Brukthrough On Robot Conxrol TOKYO,JAPAN 1988NOV l5 (NB) —-Nippon Elcclric Corp. hns suocessfillly dovelopad npromtypc conlrol system which allows a spnce mbot w judgc ils own band movemmrs by itself. Thn mached supervfast du: proceasing chip runs a: 13.4 mega Betting point opernimu pur sooond. Acoording w NEC‘a spokeamur. Ihr: Chip will

pmcusdalanluluuhigh rpcedirlaulammr um rnirnics (h:opetnlion o1" rcllcx ncrvous rissues of human beings. Thc prulotypc syslcm will contml minulc nmvancxlls by ißelf.even ifmereir a Iinlc Iimc lag fur iu opcralion. NEC i: [Luther nimm: lo develop anunmanncd robot which rerlizcs precis: opcutions with the

FREE MONITOR:

B40

AMSTRAD PIJRTABLE PPG

ol’ IBM P312 Modcl 30 eompuuu. rruk: cl smreonemagllylccfdynnnüclmdom Icons:

Will: the purchars ofan)Aarutrad

PPC Computer S‚ysremwlrh M0 drivgvr. AMSmAlTs cxciung new Computer portable, 111c PPC 640. has launched a new cra of a it has ‘mafs because 2400/ rmvelers. for buaineas convcnience and conrrol, parficularly 1200/300 band. Hayes oonxpaliblc modcm builbin Ihm las you sray pluggcd inxo your ofiice from just aboul anywbcrc. Willi n PPC 640. you can do lhings lilcc check ‘urvemoriesfrom acustonner-‘s ofliomlookalthedayflvlsalesfigurcs from afar-nway l . ( h sun-ru l homlmormorissueinsuticüonsroyoursraflfiomarenlooeconwuction alle. In Pnp p bupcrlwial r onlrasr (lumml l-dlllllllhl.’ im: llaud. facLwilh aPPC640arIdaphonc, youcan dojustaboutanyrhing you cando Ihr: agcmpzulhlc nuIdc-nn huiflm Huhn“ ' it in your office except go 1o thc Christina partyl Although wcighs just Gmfirlbauonftov’. Vulumc (innrml clever: easy-to-carry pounds. thePPcötloisnolightweighn. llfcalurca (apcmn-s umS ihm mmauurcca ailpaauvr a 640K memory. a full-sized. Enlnnced "A1" kcyboalfl. an 8086

—

(atSMHz) rorunyoursofiwareatopfimum Icvelannd achoiocoforleor two720K. Sfdislrdrives. When ooupledm a Standard PC oolor moniur lt. displays CGA. lexl und graphics in up to l6 colors. Ifusod wizh a monocluomc monitolzitdisplays highquallty wart. Aswell. with Ihr: ability lorun onany of5 differcntpowersomoesnhe PPC 640 is ready 1o work absoluten: anywhere prtlcessor

(Hub.Alcmnry

_- . ‚

„_.

„acm-‚un-m... „ u - m ‚_..‚v|.„_J’.

„1-9

nt-I

.. I

H: tnmpanhility’

‘ ’ ""'

‘

you wantto war-k. Olhufcannes lnclude built-

irlparallelandscrialcxpunsimportgand MSDOS V3.3.PCOrgnmizuandMirror l1Communication Software. With so muchcapahility andamodem built inlo it, it's n0 wendet why lhe PPC 640 has becomc such a

ImgluMc-Ighl

rml}. lH-llhx.

lnclmln Kir-i In lh ‚i. 5. H: Urgunwxr und i-lirnar II

Lnmmunicuuuna nouwarl:

Full-uimd Ilnhunccd "AT" Kt-rlmunl

‘Notmulyuillurund.

popularclniceforsomany oompuznr users.

. .

i?!

FOR THE BEST IN SALES, SERVICE AND SUPPORT AT N0 EXTRA CHARGE

‚w: i

‚"1

fix.

all._._. fig/(„mqw l4 v 111e Compurnr Papa o Deczmbu 1988

4&3 y m z A p n CQNWIUTER

SYSTEMS

COMPUTER SYSTEMS

l -7

CHRISTMAS: HOURS Denn 8S Dccfiaa <

Fn. IlJIOII. — 9:00 am. - 9.00 p‚m.

Sat. S. Sun. 10:00 a m , 6:00 p‚m.

Your Aurhnnzed Amslrad Wurrumy Sr-ruhtn Cenlre

6082 FRASER STREET (at 45th AUE). VANCOUVEH, BC.

nmlicatim nf mificinl inwlligence.

AI To Fix Your Hand Drawing

TOKYO (NB) ——TnkmakaCorp.‚ am oflusfivag ocmmnctiun counpmie: in Japuuus davelopod a mwin; sysum with anificinl incltiguwc. The symm alluwn hand dnwings wiihnui compuxu ormlcn: becauseAI willdisplny mladlincs um irxluereuuy lmdastmd nie dmwa": immtioxi.The company luu Ipplied [er a panem in Jnpln. U.S.‚ UK. Wut Gamma. Kam: und China. Th: man: mquiru hardwue whidl will be ptiwd hemmen 1.5 andimilliozlymoriUßJlüJüand SUS.l6.000. ad whwm: which will b: priocd aromnd 1 milliun yen o: SU.S.8.000 early man yeur.

Judgement On Chip Copyright Issue Between Intel And NEC TDKYOmB)—hIelPtcIid:mAnmwGrovc huzoldrepmmzinTokyomatthcsnloae huxchohhaCnlifumia Districtcmmwmmm a final dnclsion an 1mal’: lnwmii ovet NEC‘; V wieschipa mnllcgedly hfihpmlneläoopyxight. Mcmwhlll. ncoording I0 NECH: spekumm. this i5neun: mNEC. whlch hn: umreoeivcd my nomlmmicaflan on ü’: man: [ m m lud. NEC 1nd Intel i m :been fighiing ove: üu‘: mpyright izsua simc Decmnba 1984.

——

NEC Aggressive With Chips

TOKYO (N1!)

NEC Cum. 1b: world's bunt sanioondiaanrmnku. hn nununced lhllilpllfll u:invcst nbout 2Dbillion ym(SU.S.160 mfllion)

Iobuildnnewchipmmifmmfixgfxilixyin Sngmxilwu. Ihn mburb of Tokyo. 111i: monlh. NEC will bcgin im pruduction ol’ l6 megabit dynnmi: rmdom wen: memurychips, N0erbt: Jnpnnue unter:luva yetdiscloadplmu formen: production Ihre for 16mgabit DRAM: in Iapm. NECis cnpacmdm nmnmplcnhipunuuofuxe hrga-capacity chip mm m1 und hopu to bcgin opcruionoflhefxility ulhobqimcingof 1990. Memwhile. NEC hu ban ounducting Menibiliny smdy an u»manufncmn o! four megahiz DRAM Chip: in IM Uniwd Status. Aocordiixg l0 wmpnny spukcsmm HisaxhiSaite. NEC willruch ndecisionon thepmjectmmetimc IrouxuIApu-ilor

UNIX

—

TUKYO. 1988 22 NOV (NB) Japan's unmpimgimLNEChnfimIly expmadixsposiüon an m:sundardiznfiun oflhe Unix opanüng sysmn und is gering wiih ATtT. Aocordimmawsmnuz. NECmceived a p m a i mion trom ona cf Ihc member: of A131": allimcgudlhgcompmywfllbemgisundun mcmbez of Unix hmemmimnl. du: ATEI‘ fold vhich willbcutlbllshcd wilhlnamonfllhiTo-

—

investment...

„by toking Profenimtal fl-uining. ‘Pakt admnuige ofyour oomputcr 330km’ man:

valuableaaucnyourmfi’.

Ouoounnlnningcmtruoltsnamllnpoctrum OfDTP wbrkflhopn:

Major Jnpancic oompmiu. such u Fujitsu. Toshibl. nndOU. hnvc drcndy sided will! ATäT. ‘bin! only Hiuchi h l l alten I. sich Wifll Eh: rlVll Open Software Fumdatim.

DnünBmieafirHia-mompufira-aun-day wurluhop axplorlng ihn wurld cf Graphic

Duhnmdmoncpociflunylmitapphum Microcomputers. O lnnuduaion in Page Layout-an two-duy intwdlaction to ihn pagn lnynut pmpam ofynm choice: Aldus PagvaMnkor or X010: Ventun Pubhlhar.

LoM-End Sun Workstations In Early ‘89

-—

MOLNTAII! VIEWLCALIPORNIA. 1988NOV I9 (N3) Stm Miauystann. in hinaus [mm a bunt cf nur producn inuodticümu mlic: Iltis

ycIl‘.Will|ickupthcb||llgaiJIinenfly'89by inttoducing n 1in1oflow-end Unix wmksmions.

aouysMacVv/eckmaguianhicwccflypibfica-

tion q m m indusuy aourcc: u nying Sun will innoduce xaveul low-encl UNI/DOS WortsuümlooompetewhhmosefmmApplenndNeXf. Im. "A jfllflll puxpou 68030- bued Warbuiionshouldunngeinlh:flm qumzx, followedby additicms to Sm‘;386i I'ma o!’ UNIX/DOS cumpulcn." says mm0: Will McClatchy. The repon suucm ihn5m i: saekiu disuibmiun Chanel: pionumd by Applc for in oomlng producm und qmm a Sun axecufive. Bmy Folnom. u nying bis fim i: pobably uiking wifli ComplllcrLlnd und BusincuLmd i: renil ouzlcu.

Ourmnfliodsholpprodptsrmimuchsmdant’: noodn; thoao. in tum. In addrnaod in auch trfining aouion. ‘Ihsk-orianted tnitiingwm location in Vnncouwr: Oucounsx. Call for dann an nur m11nagt ofMicmmmputar Connor.

Another Graphic Unix Interface

PALOALTQCALIPORNIA. i988 NOV 17(N3)

—HewleuPnckzdandMiuosofihnvemwmncd u ncw. graphics-bnsod Unix um imgrfaoe ihn man: a prognm nmnins in Unix look Hkc it's I31

MS-DOS machinl mtning Window: und 03B. Cullod Common X.lhe soflwnrc consists ofxpccificntioru for dzvelopcrs. A Mkmwft spoknmm. n the pwdua inuoducxion in Lu vagen, aid Mayfbnsedonrhßmxühssmdy. NECinhcfint um ofauxrcm Mlcrosofl und IBM pcoducts will clectfonics Iirmto mrvcnl pllns fo: produclng four nuodonly tninim" iouscUnixtoftvme in Ihn U5. nxqnbil Chips wrinm Wilh Commtm X. N0 Need For Stenographem? Obamers ungut Ihis new product. howaver. m m 0 (NB)— Hilachi 1m devcluped avoice willonlyaddiouuamunmnhxsianovun mmgnition Iystam band an the toclmology of sumdud Urüx opcming syslcm. Sun Microsysnmn-ocompming und fiuzy Iogic. 112mm: tech- wmsnlreadylmsngnphicinurfacefwunflx nobgy man: l-iigh-puacixion voice mongnition nmchincs which w: nmning u: ATaT-crcuod Unix. Ami 1 new vmion o!’ Unix i: being dabcymd pancm moognition lcchnology. flgvoicesurcrecogxiizedufoflouTosmt. signedby ncotunniimcalladthe0puasyslnul nuxulncrwmkslcunthcclmmwinicsot Lwelvn Foundazion. und amsisling ofDigjul Pquipmml. wund: necassary f0: volca judgcmuu. Ar. m: IBM. und Hmvlen Packnd. man;0mm.

pamm reoopliliun wchnology. Alle: Ihn. the fuzzycompma logicdoddu Ihn piwity Fotomroctwords. Finnlly.mesynuumulyacslhcworda fonelltiomhip mddecidea Ihnemiwxtinwlfich Ihey In bein; und. ‘Ilnmw wchnoloycmreongnlzcnbunßß

Malte the m51of Desktop Publlshiyntäur

NEC Sides With A1861‘

—

Two More Companles Take Sides ‘POKYO. JAPAN 1988 NOV l5 (N3)

0m am: nimm.rmjurlqnnseoompunerproduom huvemadnnllimcainmccmmwu whnn ouman: will decid: Ihn man:cf m:Unix optiminz iyannn. 0m o! lhehpamle mmpuwr gims.

ofsuaielüotlwordssofanneordingbfln flkifilncuiclndualxyCmhnsdncidedloutn ATAT‘: die. Melmvhih. ü: hingen d a n n conpluy. Hinchi pomisa h qply die technology to n documenircrieval man.

——

ParalIel-Computing Answer CHICAGO (N3) Univmiiy o! minoi: nneuches u die Cent: rot 5 haeuch und u (Ihnmpaip-Ulbcu. FBlChfinglnOnVirusCase

WASHINGTON 1988NOV H (Nm-TheFBI Iadhy DlvidKadi.hnveumumedmhumnfiv: squlthsfiolnd"awughclmsam"inramll» vhiehcould IümIcunzcallndthoCaüSyacn. malt: lauge-anale panllcl pmeessiug puuiblomd scdeinnaignimoflhespfldofnvirmdflough neadamc und gwanmenl oompnus 21min; puLCny-übpawnr. ormuawilhhflgnnchot Bahky Unix 43 m nllepdly kundig! by oomhinu hltdwn ninuha und soitwnn. hat Comell Universixy gradum staunt Robert T. bem und an linh Iwb Ich o! passen ad Llonimklmflfshlbflisnoompuuflpfllwifli memotyngsdianndlhesyflnnwuldbcmnd mcmpa-ncmNüunaISoauiwAwwyandm whhumnyu zsfipiocawrs stumm’: lvuy expmonthcUnixoperazäusysmMcrrishu des manch: h: human-ab;grausam und um: in Wdiigun Ililh I! 1110m. h: In: munotiu in n way Ihn‘: vuy Im." Klick wu refund nominell! n0 Ihn: pnu. Pmoecutnn m: qunnd u nqying. Tho Cedt 13mm puvod in lookinguißßfiammvaundflaupohihlm nach. Kurt omlimnd. by piawing duuugh nav- inneaiualmmhrbndacamufederflenmanlcnmplubunchnurkpwogrumuspouhclon plnctmflnlnwmkaaviolaüonnnfisdemeflw. IodiuoffluCuyX-Wmlfichpuhwila punuhnblehyfhuuxdupionywinjflllh millionfilhtystamulndlnlhemlnwuva. suulnwaeahmfinaimmafelmyifflm illegal wenn occm on two ocrmore govcrnmmt wemfillimimmiaxpunumpumspfincdarmflfly ounpuutsindiffcuuanenmlbixccuwil» SUSJMDOO ach. liam Scssiomhutniddiullu FBI Will decidn wizhln Lwo wach whetlur otiminal violaliun: oocursdmdwhamntobriagchages.

ONCOURSE

Icaming Centres"

‚

- 669-9800

400 1190 Mnlville St.‚ Vnncouvcr, B.C.

’

HAVE YOU EVER WANTBI) A PRINTBD CIRCUITU LAYOUT PROGRAM WHICH WILL EASILY ALLOW YOU T0: v’

LUSEHEIRCUIE‚CGAORKAWI;HLEDEGNNGSZ'BY3TPCS?

V IBEUNIILHIEGUEANDIJSEWHHORWTIIDUTAMQJSE?

r izzanmvnmonmvwxwmcssmmwonxs? v auammnzomamumuiamvnn EXCEIJDNANDEIBERFHB?

v iamcsvotmowncismmromvmm v’ WORKSONPQXTORAW. V

PTATEPAHB?

.-SCIEE

PGPRO: 1STTIE

POR YOU

SCHEMATTC

PCI m n m a m v u n m m u m ß u m r o w m m m m a v m

S350 5150

PACKLä: gMLPEQAIBANDCIIBYIAIOVUHJATB SPÜAL

SPECIPIC INSTRUMENTS LTD. BILL JENKINS 291-6171

‘lhecunpvaza Plpcr Dwcxnbu 1988 v 15

Foundation Expands

BOSTON. MASSACHUSEITS i988 NOV l1 (NB) —'U1eOpenSoftwareFoundation i133 uddod new members. OSF i: a group of nIiIti-oomputer Inalcers trying Io man: a xtandardizcd vcrsion of the Unix operafing system fumtdcd on IBME AIX dialect of Unix. Joining 0S? Im:Compulu’ Consoles Inc‚. Data Guten! Corp.. Infomtix Software Ing. and Landmark Grapltics Corp.. all of the 11.5.. and Hitachi Ltd. cf Toltyo. OSF has also axmounced thatitwillcstablish anoflic: inTolcyo. temparanly hcadcd by Yoshiro Ohi. formerly of IBM Japan.

COMPUTER SYSTEMS

Your Computer Solution Store

IDC Speaker Predicts

Moderate Unix Growth

-PC .

101-

m KRAM

III

5.3: dfive ‚ K6’, MS-DOS a GW-BASI -4.7

mfgäm

‘l

‘ '

1,09999

‘

W'EXNMID|C

° 3.5

ffiicd"?!

52599.99

40848 Stereo MOIÜIOIIDOIUÖÖ

„i: »

DHVG

„„‚;"*“_„„_„„„„‚„

‚CGNMDA Vidaa

Unix syatctn: TORONTO 1938 Nov 4 (NB) will accouxtt for about four patent of ainglc-usa computers shipped in 1992, accarding to Vicld Brown. dimctm ol‘ xyxtem: rcscamh fur International Data Cotp, of Pramingltaxxt. Muss. Speaking at a day-lnng cnnfermc: spmuoxcd by lDC Canada Ltd.ofTaronto. uubsidinry ofth: Amen’canreaeamh fin-n. Brownaaidaboutoxx:percetttof angle-um ayatem: shipped in 1987 Im Unix. Altltough Unix will temain a minor slice of m: dnktop system pia. Brown noted. m: figure: mpresatt a SGI-planen: armual growth in Uni: sales. eonsidcrahly higher man in thc maxknt a: a whole. Brownalso nid76peromt ofwotkslaüom shipped in 1987 wa: Unix-band. llp fmm about half m: Iitaxkctin1984. By1992.sltesaid. lDCexpect: 83 pacent of Workstations sltipped to nm Unix. with outly Digital Equipment 001p. still nelling werkmtions with a proprietuy opetating syatent.

AMIGA

i:"Hilflmlll f

... Äj.

‚Klnunbiorajflvlücywg...

atloßth Ave.;suney‚B.o.vs'r;2vI;. Hijfi-i

am»

AT&T Pushes Unix Tradentark

NEW YORK (NB)

l-"J I—'— "-"

.552. °

wir?" -Ü.

."“’

—AT&T

i: expanding ila Unix Uademark llcmsing ptoyam In covcr Unix System V producta. AT&T aay: thc muvc is a nasult of vendor xcqucsu. Undc:tlw platt.vendors who bu:pmduct: u: System V Release 3.2 and Ineet AT&T's requimnents will b: able In use In: trademark Unix in the u m :of lhc poducts.

Motorola Unix t0 Run DOS SCHAUMBURGJuNBy-Mouolahubought

a way to let Unix eomputen designaad Ironnd its 68000 and 88000 rnicraprocuuot cltips tun MS-

DOSsoftwarmPmvioummhodflurmutingDOS-

mder-Unix Ieqttired apecial cimlitry whiclt ermtlated thc IBM PC desigt. with all im Emirafiom. Thc new packnge. callecl XDOS. was writben by Hunter System: Schwan: cf Motmtain View. Calif. It directly oonvcxt: progtams written in DOSintoUtIlJtpxogrmns whichnmasfastas

Works onall IOO-per-cent HPand compalible LaserJet prlnters

—

super cartrldga. Byitsall itoontalne eswnttally all 1h: nurmttl portralI-mude füllt!» avallabla h all 1h: Dlhfll standard font camldgos comblnad.

u Total compatlhlllly wlh arlatlng luntmmidges. Just toll your soltvoara Ihm yuu hava rmlupla lont cartridgea. and you're all soll

—

GIFaatnt lnlal primlnq tlmo nonoed ta mit lu lnnts toload. Even lastet man printer: Hut muat h m“

‘*'3«*’.;-‘;“fißfizx "3' 065b{N1\ ‘I \ ?+lä\f:gr:p‚:o{>‘p

Lä°+"@’a*1'‚‘?«’9 | ißßßnrfiä x "“""

es Q“

üv-Qgüfl:

< QÖQSK ‘b

a,‘

am.‘

“

„ n ;

AT&T Wins Air Force Contract

WASHINGTON (NB) —Despitsa adimeult um: in catablislting itself in m eomputer bunten, ATEThas won anAir Fomeontractthatguarmtcc: thewmpany’: funxre in eomputittg. AIIATEI‘ spokesman called Ehe SUS.929 million awud tlto “laxgcst Computer conlnct wer awaxdcd by th: federal govenuneatt.” Depending an wltal options Ihe Air Fotos exercises. th: cuntnct could b:

am Avenue. Vancouvcr. a.c. vsv 2v7

11:Gltrrtaw!

—

19,3%.

875-0977

—

Dbase On DEC VAX

MAYNARD. Maas. (NR) Digital Equipmcxtl Corp. has signed a marlceting and devcloptneru agreanexttwiflt Asmon-Tat: Coa-p. toputtlmdßase daxabaae program into Digital‘: VAXNMS und Ultrix (Unix) ezwimnments. “Iltis Itey agmemcnl will provide a leadenhip anlution lhnl. Ineets the needs of am’uaen." said Digital Prcsidmt Kennethülsettffhedeal malt:Iltc firsllimc dBasehas becn avlillbl: un multiusex computars and 32-bit

Workstations.

Digitnlhas also armotmced anew H1:sei-via:fou pumnal computer networkx. Callcd PCIANI Server 2000. an SU.S.18‚0O0 package (hat in.Cludes a MicroVAX 2000 plus : contml oonsole servets and aoftware ID ü: l6 PC: togetha. cm b: linkedintnother networks. grcatly expanding (h6size of (h:syalem.

Stm Micro Splits Stock

MOUNTAN VIEW. CL (N3) —Smt Microsysums. in anattcmptto malt: its stockmore attractivc u:ixtvswrs. has split it two-for-one. ‘m: idca i: to altract more 5mal} investora. not just th: inatitutional Bayern. say: 51m‘; Chief Exccutive Saat: Mehlealy. Th: stock aplit will tesult in a dividencl to currentatockboltlas cmDecember m.

COMDEX TRENDS

A Review Of Comdex Trends

LAS VEGAS. NEVADA. 1988NOV 19(NB)—While major Amcricln vcndors argued about 8lll1dBdS(mF\/S. ATäT. MCA vs. EISA) 01er: wer: sonne noticeable technology trend: In b: seen a: Iltis year's Fall Comdtu. Here's our

Newsbyte: aaseaamcnL Fax is being npidly integralen! into tltccomputing etwirmuncnt. Not only wer: Ihm mnny fast mithin: cmdiaplay, bul many spomd RS-BZ pona. and mm3 Amozioan oompttm oompaniß. mmt notably Wang hbs. made a point of integxatin; fax intages into their systems. Color has finally an-lved. Pmly that's bccuuse operating 53mm: hav: been upgndod to handle the danand: ofcolor. Applclut: abuttdoned blankand-whilc to ooncentmte on The Mac l1. IBM‘: VGA stamlnrd can handle real eolor photographa. Atari und Commodore continue a: facton bccause developers have many cnlor applicatiotts ontlte S’l'and AmigamachineaThm-e wercoolot scnnnersandcolor pa-iuttea-s of all typuondisplay. Attd prlces will b: ooming down. The "FourTlgm“—Singapore.Taiwan. Hang have raiaed tlu: sutkes in Kong and Korea worldwid: oompuling by ofluixtg ilmovation a5 weil a: low pricca. T117: GUIS fux-answcting macltin: was 1h:autptisc 01' lhe Show. and if Ihe machim’: Tuiwanese malte: cm deliver an it: pwtnises, n5U.S.l.200 maritim which separate: [u und voice Calls by next spwing. the Japanesc will have plenty In worry about. The “mentory sltonaga" will man tut-n into a memory glm. bot it's beeoming clear how businossea will In: umextra memory. Raine: man passlngmmemessagesbetweencompttters, we'll sea man: oomplex Inenagcs, 001m picnnes. stereo aottnd. und i n . Finally. Comdex itsell’. Despite growittg complainta that it's too big und lach: llooua. increuing nmnbuuofpeoplekeepcomittg. Finalattcndano: was stimmst! a: 11090001113 ln a city wlan: thure ara only 60.000 hotal rooma). Cmpontm Bayer: ISIICIMIS dincton now domittutecoxtvention azaaiana. And i1‘: clcur Tltc Interface Gmup i: Hering 1h: wmplaints. with platt: to mov: Macintosh devalopers imo a separat: MacDex. Noam cm “see it all" Untertan’:phrue) my-

—

Thcnuws addsevettntorecmmtsion In thulready dizzyittg array of cnmpeting Unix veraions. othcr opeuating system choioes. and yaphic interfaoes now available orcotning im ecmputu buym und um:

x. I.

„€204“‘x

Call 875-09‘)? lur l HEE contplete sample Innl prlnlnut

|e43

Can’t Beat Em, So Join ‘Em Microsoft To Get Into Unix

S699

ONLY

5°

theyranonPCLMotumlaseestlfisasawayto lat MS-DOS aoftwure oompunies enter the Unix market quickly. It's also a way to closa Unix system nles In cumpanic-„s which now rely on PCs.

REDMOND. Wu. (NB) With tlte Unix operatD Easy In um All maoommonly medod lonts 810 systcm incteasingly conqueaing mm: terriing or lont caruldgea alway: mm. Nonned toooortfnnaxo lory, Microsoft's supremacy in th: operating sysThe pem arena i5 being threatmed. and mw MicroM016 C1Charactar eine lrom Iargost polnt. admits hincompmy i: wmkhtg on rango anywhere. plus plus extemiv: apflcial chamclet aoffschainnan tno. Billüatcninmintuview willt Software Unix rrath etc. and wlth aynbola, Support drawlng. legal Ihe Reuters Finmcial News Service. suys Microsoft is designing grxphic: softwltc for Unix sysALL 55 FONTS ." andtha Iemmtheprojectiacodcwnutttod" utd-reault will irwoxpoxatc elanents of Frauentaflott Manager and OSI2 [w Unix machines. Gans wasn't saying when these new product: will b: nvailable.just tltut they would eventually. r ‘o;

D Mor: lhan dotlble the lonts and syntbol m: poasibla Wllh 1'451 909l 0' Wmlüadabl‘? ‘W5 l" YWV Fllnllf-

—

EI5s fonl: auch individuell,’ band-malten plus multplo synbol sets (lor wen more lont capabilily], all ln10diflerenttypelaoaa

For unly about Mill you'd pay lor two ordlnaty camldges ynu can hau: all ol Ihe edtanced capabllllles ol tha

Ammg the loscrs wer: Zmitlt Data Systems. Lockheed Missiles 8cSpan: (30.; Planning Research Corp„ Honeywell Fedaral Systmts. und IBM. “Winning this cnntract fimtly eswblishes ATüT a: a leader in th: fcdcrul computer mattecplaee," nid Waren Corgmt. vice ptesidmt of ÄTET“: federal ayatems divisiott. was

oben Software

wonh more man SUSJ hillion. Th: key to da: nward was ATEI“: Unix opcrating System. 'l'he Alt’ Foto: spocifiod Unix für n11bidders. Bidding

—

momandfewtrynliveryattexideawctalhedtp hacl a shurt. specificllstofbootlt: and topic: laid out. And iIComdex does reflecttlt: atatc ofthc industry. ‘u: boom jlßt Iteep: an boomhtg. For a man: compm: avcrvicw. au m:neun section an Comdax.

.....

. . . . . . . . — . _ . . . . . . „ . . . 1 _ — „ ‚

„ . — _ . _ . ‚ . . . _ . . _ . _ _ — — — . . . . _ . . . . . _ ä . ‚

H” —

Show Overvicw The Computer Mob Desoends On Las Vegas

hummpCumpuu Ccnm.hsc.h1‘roy.Mich.. addad a cal] für new dhtribufim mlationsluip: in LaSVEGASJüEVADA 1988NOV 1404B)- Iluhchlstry. ‘Themosxpowafnnl imighnru m: Cotndex i: very hig. Wim diflceuu cxhibil momarilylhcomthumnfiethcmostmozn-yflha aiyht

hllklüfhflüflvisilonarxdzjflßrcponaxixmny

uid.

hcthobiggulavexuiximhistmyoffixmcrimx Software Hofizons: compnrms. Whelhe: mycme will b: ahle t0 nuke Groupware, Standards Fights aaueofitnllhmthasuyflEWSBYTBhn IASVEGASJIEVADA. 1988NOV l5 (N8)lwudulosofpooplosmying lwuuüeuwuy und Thccozndcx Software Summit. honnd by Enhar ’

oanmutinginbnemhshnwfiotebwmbookzd

solidnzüngSlmflllyfunshowfiuldidtflopm untiJMonday moming. Thctrdthflheldwhuouhilsnoqahnflhn a: my pwioru: Comdex. which is nying sommIhing omaideriru umIngo numbu o! Min-spe-

Drlmtedimoflhoflzhuolßncwxlaannumnd

C o m p u t e r Automation Ltd.

‚

Freud wcontrlbm t0 die promation OfHE-Tech in Vancouver

‘im

QÄAKKE

an ummbjoa ofgrwpwnc. summa which im

poopluhnalhcirworkundtlndtubehhadinin oompmm u Ihzy do in mal llfo.

data 3 “ ” Systems _

Fndüibbmmptnsidmlofsofiwuchbfishirm Cotp. klamm‘: Vieh. Cdii. doesn't mit du:

....... .

cificshomuvailnblqtudfixefwtßppkismnkhg groupwm mnocpt will cve: fly. "l think gmupm news hat. (Thcy an. howcvu.mnking rumozs wm will go (h: uny o! da: oommunc. Don't —t.l-nelnlcsthultnlnng-wniwduncbioahlqa— oonfase Ililh n youp pnpe.” tnpbeingnunoumeducfllymlmurmmwthu Dynon. o1’ muss. dingmd. "Whacva thc nnv kund i3 oonfxulon. bclwem gnphäc intuitiver. hmhrtophfumhühuanuwukhhflzup

human vasionl cf um. und batman veßiom o! Ihr: IBM standnrd. IBM’: Tury Laurmboch mit! n kzynou pmgl adieu: Ihn oompny i: oummirmodloißMCAbmdelfinhavhgnanounoed I new AT-clmc. Preußen. Rad Canon

cmmdomuumnßinwidflyditpmmfieldicm gatoogcflmmdshucdmbnflidaamltäm

longuaqnusfionofwhcmeryoushaaldumndor whothn‘ Comdcx in worth iL It's just becomc u neocssuy hnssle o! doing busimts. 11k: nfl-nlghl pngnnmfivgussbnsmduserpoupmeofixplf you're sctiou man: Ihl Umbau. yotfn: hat. Yuu mly hure dann! 3und1’ ‘n: Hering und scxcnninghnyouh hure.

Paneßts Emphdze Graphics, Networks, Lack ofstandards

LASVEGASJIBVADA. 1988NOV 14 (N3)-

‘hnsewanbxofulkahomnmmuxdoompflry

whoarufthnfinumly Swvolobu IndhisNcXT madaine. Thn ootpom: micxo managen in ms

SW-penonmdimocuunodlomjectlobidroam. undludfowkindwordsforApplcbecanseiu

! l i

m ; „4-‚4.‘

mfiwmamnonovivayllfingosnprmüsaw

du I've bcm dolng for 4-5 yem on myWortsuüon.“ To which Stmt shol hoch. ‘F0: SUSJIIOOO.‘ I: was | good exchmgo. bu u: in

thcfiuidmfialdflbnmlhmwasmflcmuinü

manzhcosPunixaundmexpecudtohcbu-d Ihm Jim.’ on IBM'sAD( implemuuflon of Unix. flupundüufomdounmmponnd. howcva. Pnnel Pick Hol Software For jndumodlpmaknpusuunloompulmmierb 1989 use. "W: say wcwa oome auch n Ion; wny." sfid LAS VEGAS. NEVADA. 1988 NOV 15 (N3)Philippelühnptusdmrofßuluadlnmnnfimnl Astfivedlflaunpaopie whuwillbcnu I0 lnc..huScomV|1lcy.Cnlif.“Wafl.I|Iünkwo hormestsohwm pmducn of 1989. mdyouge: fin haven't cum! a Ion; wny. becnun it's va-y dinaentlisn. Buttlzlissovalqxinploou. A: difßwh fm pvfieuinul t0 find tolnfiou: Ihn: ncocndeapntelmflxcsofkwm man! thuhu meet thcir mods. becluu Llwy hur: u: becomc hocomo an arm! evcnl. im induuy expuu Mumm-haue." Knhn unphuiznd du: imponmct of Iinkhs cnlcgofles 3o! multiple mauians. pcnanlloompulns wilhlatger systans fofcoopWordpuocasotnnonmmduhllfictmoficovpßs mfiwptooeuhg. Andwillimmmchflmm Windom opeming ankamen: will be hm in of Miflmflofi 001]). in Raimund. WEIL. mmad 1989. aacmdüxg 1o Tim Bnjuin. ezmcudvo vlcenaworkhg und gnphical nur intcxfioa es ü: ptesidattofCrcam Strategie: lesend:humaIwolzsymwdizectionshmchdxxsuyztptesem tioxmlixlslnlosmCllif. Hcmcndonedhni. Erom Rio]: Interne. preaidam und chic! uocuivc o!

spnod zumuten

12Min.0 um: um 20/40 bmyu H.D. .’. " j v

ptop

"-' a v'."--"-."r! x'c'v'--' u: iwn/Äx „In! Hlnifr:

rm w.

S55. W.Hastings, Harbour Center Lower Mail, Vancouver. CIPhonc: (604) 684-8146 D Fax: (604) 684-8128

QUANTUM I

OSflorMS-DOSmmciümbcAmIeMnchlosh

cnflmeenxphnis willboongctfirxg nmntcn

SupersPor-t 286

.'I.'.'.':'rv":'x.'.'1'II‚I;’J1|':|":'J-A'\.

mlogyfrhomedincnmhcnucnmdnudif-

orUniLlienidBMvülmwmonowdcvelop mfIBMw-iflnoumcncwpoducufrmndevelop-

.. .

Shnrp Fax UX-ISO

\>H."'.‘."

pionmNLIndNaXfhninomporrated. Mm-nnkoounthnmxhfixmmofcorpmmson‘In.Waavood. Hass. w: mit chlnplal on dwpcnclundauunglyuxdonodflb-Romtccb-

eoopmaivdyfOnthuubjeuofNcXIheaid. “wcwinpuahNexTslzpßlwünixinudnmfm NeXT vhich IBM im lioenud) in nschu. bot In’ momcuumis Wim 05B." LamanbndnmndnmxpcciflcxoplytnmoomBanyFolsowmIflocproIidenIflSm Mimmuofllobmlhvnetnpesfidmuofflla Da: aosysnans. Mounnin View. CdiL. nprucnud Sysisms (iroupof ATaTCo. in Morrislfllfli.NJ. UnixonthepuwLÜmtsaynonoOS/Zflha Knvnuapplmded theOpen Schwan: Foundafion quipped. “My vicw ums/z i: Limit’:yestndny‘: —o{wln'chlBM

1.’!

podmudtnflfixhlnfltefinnlflndhascfsfifl. Iheyaxpucsnedgxeuimaminhypumv. Iwpernudh. u! odur minimal wlüch Appl: h:

ATblasflugooduilv/mhndfimplynmoutof

wunfmnxfiaxgmuxxha-fot worldagwvardaünixsmflad. Butheaddndfl wish Ihutbeywwldllucnloflramxstounenwho In min; Ihn"; lnday.” Bad-cum Null Unix" System V.Invasiondnvelopod b)! Aufl".ruhe!

|.|„„

wucismemdalyhgtnodalmuwill infectnppli-

fuenmYouanwnadauboseofxa-nnguzixm Thuix pmliauutionndex‘: koymtepaneltlfi: uliclaouxcD-ROM nlltlntimgwhmyoumay monxing agned an Ihn nood fur mnduds in Ihn nevcuoeuuyoarkwormofnqxzhupibdh compmcrinanstry. Whudmycouldnotaguon Ihecotner.” was. whichnmduds? Rodcaniompnsldaxlnld Fa-nmdsmuganunlmflngetforncvbmip chic!‘ exanniw: o! Compaq Counpnaa Coup. in Houmn. Texu. momod Ih: Extendod lndusuy nassopponnnitiesnmhlhahflilfordcounmnvtu Standudmdaitgcum (ELBA) wltichhhcanpmy buoyodbyauxowofhflidsslnwhgrwioeummy iry wilh inmllod PCs in cnmdll. But Tau’)! Lzmmhds. sein: via-paddeln und genial mmugcrof IBM UnindS m a in Enorme.N.Y.. defendedhisoosmuny‘:movenn nimm-compuible Min-n dann!Amhltocuun. saying m:old

m: umllv|hthnmrnnn| .4__‚.’..

caüouu. Noomwfllbuaynpouxpwue. ‘Ihefllbuy

lpplicdgnm ummanage nenne: dm: by F9“?!Wfiflmcuqlbcupuidmtdchklbfisppo ofConlpqaundusuncpuuLplnnfiihdhisflsA noflwmnphn-omoontplafliodflnnnhmoinemh bnndcalpwinwayüncdnynAnddouuof Im’ powa. compcnla luvo forgoucn du tlscr. exhitinon [mm Indio. Tnimn. China und olha ‘Weh rock'n; man efiu produou for powa poinuwmofiahg AT-oonupnfihlo auchnoch uscn. while fcwer pooplc hnve um! capnbllity so saloupriouwellmdnsUßJßoo-imhfihg bopowumouPEno-of-osenndnflisficptfich; xmnimumdlohwue. Conndnx Im evolved from n major pro: «an: mmmitnptxtuulhmnifiynnwfcnwmhe nid.

tongiuucummacmmwhetedevchpcxrepat-

ofilflnäolä

NOWLOCATED IN HARBOUR CENTER wwm ‚um.

Give your business a quantum leap forward in

I productivity.

A1Jump Software Ltd., we're in busmess to put ' nücrocomputers to work for your businessWe

highly rated implementafion and naining Eofier setvices. Our custom programming experience „I means wecan tailor your system to match your

defined needs. Wehave excellent zcarefully references.

g Fmd oul about the Import and Inmas Software

packages. Featuring integrated Purchase Order, FBill of Materials, Manufacturing and Fmished i Goods Inventoly, Work Order, Customer Order, '‚MRP, and Report Writer modules. i Make a big jump forward in productivity. Call _Wesley Kenzie, Robert _ ‘I-‘isher, Stephen Schramm; gCliif Enquist, or Ken

Greenlaw at 6885867.

D’

Thacomwla Popo: v Dooamba Ü

S F l7

TRI TECH COMPUTERS

SPECIALS Data Perfect AT 286 640K RAM on board

Slmm of Atlanta. wlfich is du: m ship by

—

wlaäosrbzeziffi‘:

852,095

40MB Hard Drive (40ms)

Parallel/Serial/Clock/Calendar Enhanced ATKeyboard Monographics card with color emulation

or leise for only S72/month

Develapnuu Cum. Bajarin also workgmup npplicarions as animponmI sofiwne urot for Iho ooming yur. Ariadn- fmqumtly muttionod softwar: cmgory wu prcsontafion pmgruns auch 1s IBM‘: PC SIoI-yboud l1.

Hi-Res TTL Monitor 1 Yearwarranty

Foreign Firma Steal Some Of The New Technology Thunder

Genius Moose packagc Dr. Halo Paint sse Roland 1012 Prlnter S275 Including cable EGA Monitor 8: Card svso (W:Iake uades)

Word Perfect 5.0

LAS VEGAS. NEVADA. 1988 NOV 15(N3)Anoneütneyoucould rclyonforeignfixmsnooffu mc-Ioo producu II lowct pricos. N0 mors. Now it's Inpaneso firrm which so: In: uchnology pacc inpexiphezabmhile Amcrlcm firmsfighIIocIuch up. .

S375

" ‘I mnzseanne-äem scoond (3 limo) |

I I I

neues:

NIv...„..........„...s1s9|

llwßnostrprlselouenbigcrowdulhoSony

KJV...................SI49 |

boolh. wheteondom wercbcing Iakmfur ulinoof emaeablo oprical drives. “Ph: CD: u: mcasod in jucken which look llkc Macintosh floppies on stmoids. und whil: Ih: drivo's aocess Iimo ol’ 90 nüllisooomds unnpmes unfavorably wizhmespeed of today's hat! dislcs. ü‘: im mough Eo: many amlicuions. ‘Ph: uniu u: shippiixg now Eton: Tokyo. und you cm oxpecl |.o 3:: pmduols with themonihcComdex show floormxtfall. In thc Canon boolh. Ihey're breaking now gxouruls on 1x500- petformanoe Willi m:31-130 bubblo-jot pwinwu’.The prlnurusa a crridg: und a "bubb1e" Ieclmology In giv: you lucr prinmx

LW‘Ewifisflewßa

597-4777

8823 120TH Street Delta, B.c. '

Look what's Happening in Accounting

NE WVIEWS

qunlityatadotmatrixprinuaspecdofno chnractorspaseomiztCmonishiastlinglofiild

UnmatchedPower

Tho Vlsual Approoch to Accounting

andFlexibility

o a Businossporson. you roly on A lnlormation lo koop your busnnoss oompolitlvo. Ncwvlowo Accounting Soli-

ware, with unmaIolIod powor and llexlblllty. gwos you lho informatlon you nood. whon

n l W622“In"l9 Icon

aoooun ngpackage lo win tho PC M azuyno Award ior Technical Excellenco. W y? Becauso iIuses stato-

ol-the anIechnology to provide you with Iho most poworiui and versalilo aocountin syslorn ovordovolopod. liyou wem a simpl flod. intuitive aooounIin syslom. lasI und flexible reponlng. and In ormation ucutront es you oan po. then look at Nowvlowo.

drlvus which will lcl Ihc PGA cmulul: Iho lmor paaren which In: populu in Ihe U.S. A Canon s-pokcsmm aclcnowlodgod Iheonly prinIcr In: BI130 cm omulal: Ioday in Ihn IBM Proprinzer. buI claimocl aoompmy called Mecro Soflwlr: in Ncw Jersey has anemulntor for In: H-P Lamjctxoady Io go.

Microsoft To Release Windows Word 2nd Q 1989

easorthuwillnmundcrMswixldowsas wallas

Prcsenution Mangan. will b: rcleosod in Ih: sec-

0nd quancr of ncxl ycur.

Ihe UninedSnreswlymxtyelr. ‘I'll: systom may b6 an [h2 matt:m a n : in Clmda.

Fasten", Smaller 386 Mother-

boards

LAS VEGAS, NEVADA. 1988NOV l6 (N13)-

Motherboards using Ihe80386 prooessor mpienIifuln Comdcx Ihis year. including a few built on Iho now 386S)! veusion of Ihn chip. und a coupl: IhaI push Ihn 386‘: speod limiI. Mylex Corp. in on: company slxctohing Ihe speoclbufler. lß M3086 boudi: dcsigned l0 nm u 15 In 33 megahcnz. Th: mwiy mundocad hoard will soll for "und:SUSAJIOO." aooordirlg In man mginccr Cmni: ALISÜJL Wave Male im. of Sm Francisco. momwlüle. claims w hav: Ih: world's Inslcsi. 25-mognhextz 386 motherboud. Byrunningwiihzao Wnilsmtes alltho timmwlv: Mute clainns. Ihe BuHoI-386AT 1 m m in pcriormman aquivalmu Io mlBM ATrunIüIIg at 42 MHz. This vcnion 5:11: Im’SU.S 2.748 with four magnbylm cf RAM. Wavo-Mnle also hu lö-mcgnhat: und 20- megalwtz 386 boands. Ordinary 25-rnegahonz386 band: u Comdcx are pfioed axound SU.S.l.5Ü0 Tor Ih: Inost pun. typi-

caliywimupnooaunwgnbywofmunoryasa

standard feann. Manch Camping: SysuansofClevoland. Ohio. i: selling jxoocasor bouds (h:size o1’ AT cxpmsion cnrds. An 80286 boud 5011s for 5U.S.749. an SOBSGSXbOuId-omoftho fzw nndiapluy u Ehe Show for SU.S.995. Honda using Ihc Standard 386 chips rang: up In SU.S.2‚39S.

Microsoft Strategy Announcemenl

LAS VEGAS. NEVADA. 1983NOV l4 (NB)—Microsoftexomüves. lcdby Chuimxanßill Gatcx. luve hriefed Lh: um: a1 II lunshoon hold in 1h: Rivieupenthouac suilcs. Thc primazy purpos: of 1h: moeting wu Io disclwo (h:key feaunu of Microsoft’: xicw busirless plnn. The plm bcgan wiIh Ihc zoom! division of Microsoft's ApplicuIimzs Division into sevon Business Uniu. Each uniI is respornsiblo {er a group of relnod sollwaro applicalions. Tho koy elemmt. revealod for lhc First time Inday. in Ih: us: of a common €016,01’ onginc. fof each of Ih: company's man): soflwm producu. Thi: engin: will allow L-ach appllootion Io b: simultancumly mlousod. für all throo of I11: operaIing syslcm mviroxuncnts which Microsoft bis chosm l0 mgct. with amixiimum of developmcnt cffozl. Only appwoxmlaroly 20% of 1h: cod: will noed Io be difiereru for the respecüv: cnvimn-

——

LAS VBGAS. NEVADA, i988 NOV l4 (NB) Nfiaosoft Cnrpowion hu mnomcod Ihn! 1h: defmita vamion ofWindow: Word. Ihcwordprac-

Jcfl’ Raikes. gcnoral manage: of Microsoft‘: Offic: Bush-lass UniI. Inilcing noNEWSBYTES. Thqusands aclded. "Winden/s Word will offen’ Ih: nun: Iyp: novgcaa Io oxpons. uso Mowl/lowolor Ihelr o1’ intorfac: 1s Exccl md nmnlly b: diffozont for yoursell why busmosaos._ Find outbooomi Ihn mosI Ihan Word 5.0 which i: a chuactcr buod word Nowvlnn l8 qoidzly anada. soltwaro in pmcessor. Windowx Ward will hnv: 1h: Same bopular aooounllng hmctionality u Mac Word 4.0. which is Ihe laIesI of Ih: ward proocssor uvailabl: unde: Ih: Version Newviews or To Jean: more about *; Macintosh opcraiing cnvixozunmt. Sinoo Micmattend a free Seminar, ca" your Authorlzed Newvlews Dealer. soft suppom n sImIdurd usu imarface. Windows PFllllA TRAINING OENTRE TXL MANAGEMENT Word will huv: t0 follow." Authorlud Doolor & Training SYSTEMS mc. Contro Apple Shows lt IS Authorlzod Muster Doalor a 207-3900 E Hastings St, Cortlflod Oonoullnnl The Mainstream 20101 W. Broadway. Bumaby LAS VHIÜAS. NEVADA. 1988 NOV 16 (N3) 1V13 0 0 0 W " Tal. (604) 294-4567 For Iho seoondycnrinnmwmppl:Iookaroomofif Fax (504) 294-4557 (B04) 876-711? Ihe main show floor Io man in: fximds and oonfound im erlomies. “What's Ihr: messogo Ihis WORKSHOP DATES: FFIEE SEIIINAHS yoar?" an Apple genau askod a: we enterod. "An Dec. 15.16: 1111.23.24 lntro toNewViews exwnsion of Ih: managt: [mm last yeax." NewViows Don. Inlamodialc Cum: Prima D:c.l5 de. Jan. 20 1.2 ‘Training 11m mosng: in, in two words. Macintosh I1. Evcry singl: demonstmion in 1h: Apple boolh lhis yoar was running offnll. 111er:wer: separat: Spoclal Offors on O. W. Page Devolopod Workshops dulu for Apple Io man VARs cornpoting against PRIMA for Details! Please Call IBM in businoss markou. Unix in lcclmicll mur‘ lhe Atari und Amign inmulIi-mcdia markcß. klels.

pooplo across Canoda. lrom

menls.

Tha du: objcct mviroruncnu am: 057T: Pracmuxionlulmgger. DOS Windows unddermIivea-cuch u New Wim: from l-lewleu- Packurd—a.rvd Ihe Apple Macinmslz. Unix i: m I p r c s cmly Lmdo: oonsiduation du: t0 a Incl: of suffiv ciom commonaliry in Ihn Lmdulying binuy oodo used by varrioxis hmlware plnfonns. Produot damonstmions wer: hosIod by Via: ptesidenl Miko Maples who imroducod gmoral managen. Fron-l two of Ih: Ihren mw businoss uniIs which oompris: m:Microsoft Applicalion Division. lcfl Ruikos. lmud of the offxco buxincs: uniI. demmmruod Microsoft Word 5.0 for m: indumy‘: gaben-in; which winde: mmy oa‘ um mosi influmtinl malysts und journaiisu.

—

P Rl

l8 vflmComßulw Papa eDownbcr.192a .

und fnr daukzup publlshislg. Only Iwo sofnnr: dovelnpm wer: ffivotod with spaco in Ihis booth. Alphagmflüos displayod ils PrintShop of Ihc Fumxc. whioh oombines daslctop publishing {unotimls with unordering sysmn und aooomtirxg. It's comIhe foImdaIion for a iin: of prim shopa

soflisempeaadno armounoesoon. Michacihliller. exocutive editnr nf lnfoworld. nid Windows appücaticmin551ml.includingMiaosoffs Emol m: I. will b: im in 1989. Jcffrcy Turm. "Wccun Summe: in of commy. und odlnor Cnmbtidgo. pmyisnowbuildingarowidthe publishz print on any Postscript or QuickDnw prinIcr. Max.also nw Ami u a product Io wamh. 111er:wunompriscintho rcpealod menüom evon sond mit files via modern o: {u aI 300 dpi." ot’ Lotos l-2-3 Relcuc 3. dBase IV und Ihe 05H. said Dirocwr Eman Bei-lose. Prumution Mmagcr a: irnpommt schwul’: for Ogivar Introduces 386SX 1989. LAS VEGAS. NEVADA. 1988NOV 16(NB) Wmp. Iho prosenmüon sprudslwet propnm Inc. of Montreal. m: of Iho Ogivnr fo: Apple‘: Macintosh cotnpm: [zum Infonnix fint Tochmlogiu lo rclcaso an 80386 Computer. i: oomplniu Software of 1513:1. Kmns. und: Bujarhfs list Ihr:First with a now chip. AICorndcx. wwell u I h n d‘ Raben. Orbnch. dirocwr of 15minman; 1h: showod ins System 5x386. buod an oompnny oomputu nlu (o: 47th Stroot Compumr. Millor lntol‘: SUSSGSX pooossor. bouis Belmont, viocin 1nd Dlvid Scoll, of Corponnc Schwarm. lnc.. of hmmmtionnl sales. snid 1h: 5x386 i9 prosidmt Wutwood. Man. boIh mmtiorxod Hohes. an u» still Ihn Federn Cornmuniawaiüng apwoval Uy Loms yel-Imnleuod workgmup npplicaxion fmm should b: avnilabl: in und cntiom Conrxmission. montiomd

Choice of (1.2 MBor 360K) floppy

you'-

cniandoms. aWimows wordproccssoi-Mioxo-

—

45;: Tihjingsflgo Cogsider When

‘Au w e n "

Buying A Laptop Computer

m:FU m

ABvJyMOuidaGIoLAPIDPCOMFUTERS

‚.

_‚».;:"

-Packa d Ball 5

‘

Rolex and enjoy your oomputar with the most popula: 8. Im latent games 1mm Nil-TEX. Genres umeducale, games mm are emenalni man amjust plain UN andfames

AST Comtex Roland o

P u m a ] Cumputa‘: u: bocoming coanrnonplac: und Sven menfinl in man)! penplg‘: Ihres. Wahmisomnuxbedcsixctohxvaawcawalf when nwny { m m offioe. o:hume. Same ebnen-m fcel laptops wülbc amajot 5mm}: an:inthe nur.

fewyasumunymarepooplcdixovaflubanefiuoflifeontlwrondwithoonnpuzcn. Wim: um the Laien Tnndslnhlptopa?

Samsung Panasonic NEC v Toshlba _ ’ Ashton-‘Ihte Lotus Microsoft

um am optiom. An « u n d flcppy drin. und upmshn Chassis an avnilablc l'on mny be

somamnchixu.Anhmnnl2400baudmoduz|h Ionxetimns m Option. Vary anal! nunmal mo-

dansucnomavaillble. Hmldisbflcoptionnl onmmymodsls. Whert Cum W: Expcct Laptops To GoIn Tho

und mach man

also specinliza in repairlng or modifyhu all types o1’ IBMpnüble oonaptmrs und prinacn.

impovedflnsaaundisphygwlfldurefuamu compacunduncmnchluspovaünnCRTmThe populuity of um: nuchlms in mwing npidly nmongbusilmumdsnlcspeoplcwhomvel.

Jul

Fron „

u m und anWort ‘nunmal.

Nur Future? m logialx23: foumanuhcnrm i: u:mutilapupmooarpnfihlnenawuunbcgogical minimnindon ofthc pombhßlfllcuc und) min neun-Votumdm smrage. dirplny clnrily und cotnpuzcnmadcpossiblebylhcdovolopnmof monocluom mpnmufion o!’ colan. whfle n-

Opcn 9 um. to 6 m.

duciu da.weighc. und huuy powc: connnp-

lion. Soludons would man In be: 1.Highdcnsity diskcu:drlves (IMMWIOKb compntibk). Lqxopnmcunuulypinqmmyonuaaacpncth 2.RuminSofnme: DOS.ward und so: mmy neu: malte: und modah dluing du n wide choicc of am: aonwm inprooessing ROM. mahnt, whlch shwldmullitlmm fcarwea 1nd 3. Llrgn treu. hightuohatiaa. oonmuy. nonlomxpioa LCDs. 4. Nun-volatile Pveflcardlapwpsnnfltrdmfluthwhntß (human xciruhnd) RAM. m buhhl: mmory. Happcnlngwnl Serum? Wlfilclhemlylflbüpltyswuccfifficultm BoIrDolGoAbouChoodngALnphp?

‘c:

NU-‘IEK-COMPIHERS

160-04350113.

3524 Kmgswny.

K???“

mnsimIßDdiIphwmwhwesLpu-nwütflcil-

nolngy. Will: vuiaus ooloa und sonne urith Dick lighxing. San: umarmt! Innen umhat amI n s t und clmity. G8 plant und anno-hab:cm1 displays offetpodlogibilizy. buuregeocr-

allymmicxpuuivcmdphcenhenvicdaunnd ca bauay summa». Same umm a n displtys hxve BOA naolutimu. LCD wenn: up umil rocmtlyoouldonlydisphy fiunZtoSp-ny-ncale

rqxsmmimolcolassouctacemlynnmed modalnluveupuo lblavehofylyihxjymne IßD: dlsplay chuuran in hold. Mnny lupwp sacuuhlvenvaydiflcrenlaspeczrldflwühh

hdgmmmcßfgwhichdflsmugnpificflcficla

m’

Beiuhuupgndctblemanadcsklopmhoicc ofalnpwpnqxiresnmu-ewafulmalyfisofyau yumlndfulmrmthfladaofnlmflpfila

oanprmnitc. weighhg kann: agaimt man

weighmruugcfxomtlßlhuformcNEctflu-nlighl.

b u m :2DIhs. ( u : [all haben! mithin: will: huddixhgasplamudlspkysnxdhnvybnua-

Out ofTown? Out ofTouch?...

insmmunitsoflctmumumchflflswhfich

will sdd significndy 1o um!und hallt. Mnny

lapmpsoflcuconsidarflalelhtofoptbnflqxipman. whioh willnflhot lotlloollofyotzxplrclusl. und m m9 limiu o! fumm o! nur synmuostlapuphuennoctafaamxhoopocuaor.

bemmcovalflfflnacmalsiuofflxcnanmisdso Whlslvmnld Nut M: laptop Faul Ute? nnissucywshouldpxyaazuionlaxsmflht Mmmyouneasnrauunmmxq. mach nur: n in ordn0mm: xquir: ncrollin; w e m your knfionnuion. buthlggar 501cm:vom

nacosxofbothdollnrsuxdbuntylife.

bontdhynotaadfeel. Selauamnclünawithu

ncraetlyoucmnad euily. Your mxicipuledappli-

cniomwilldcumhnüzmmuoinunayunfl mlsomcnon111e deahop PC las bococnu: n Iomewhu | 0 - diskmrageyouwillmodJJonc hucklit [L13düphys I r e vcry xcldablo. Display: naic pmdtlcl.upgndcable wifl: smndard moduhr duipedfothcklighfingmdiffiaxhmnad. pau naihbb {ran IHM pmy ambulant. Uhu: du heilig: h nicht! off nooomcnc Lapmpuncfulea: nundmisnmcbaskmpu bllerypowonLapmpleostnlolmonmansimiotfctnncxpuuionslumomrspruvidconemtwo hlyeqxflptdcshwPCahudnmmynawmdch und dann n usunfly poyicmy. umhin; Ihn cuumgtbpmuhnwinmmdoubledlypudawnowncncqflvemmtufozupydhg. wud p r a l l ! ! ! on p-ioet. Below i: a simpler o! Whnt Da] Lool For In A Keyboard Layout? zum: of umlnptopn nvailablc in 1h: Vancmxvcr Deshopkzybudlqouahnabecuncßkly zu.

Whnubout Uns-nun u p m p ?

mndmtbvxhpmtpkaybondnvqyauflymmm

mvuypoornndmaymhitdifincunfwyoum

ndnpzfrumkoyixqonymdeahopsomelqnpu pmvid: im compcüon ofyour Enorm deshnp

lwybondndmryuumuhmmhugbutdmim‘:

Hand X1‘ Turbo Compntibles

AnltndPPCflo Ufhisisnmnsunlllplop. um: t o t a l Igood. M! siz: I01 key huadonhunu-ypnchitmu xocbammm llilbflwimbnzßaienlzlsabitbeavynxdawkwnd buemyourlmhuhlhllsiakqhofldmku

vq-ypncdcalwhuzyoumonflnmaduyoudo ab! cf nanbq’ washing. 1h: u n d :kann! whdfilbmnvafiawaflufhlucmgtuen. layouzismwial. Mmy ofthn knybuuü svailablc menwütwmscreutianorbndflizmdismtu

hnvc Ihr:numbm wriunnm Ihasiduoflcncrkoys nudyoohnreaoammlhnnhwflzsfluuck twildxnaiacmhuvaynwlcwnißetlerlngmn n: emargüu will: sepcnu: mmmio keypuda. NoublnhceucmhybouüfiunNEC. WhatlflndlofOpflonl Equipncnl Shouldl Conslder?

AbuckütLCDJxuddhLndhundmodm.

ncdabkammflfismnnablypieedmnchfino hsahiltialdflübmdmodunJtahooperms fxunnvuicty ofpowar sauren. lhhvueSpnrk-‘Ihnmscolorpalenauvail-

nhleonlvclfibfißaefliflxfiuinmaxuu

axtopdanuisflmbuzaypackflflwknybofldon zhislapwphalixthnoäsyuxduaaoanbixmon of finden und uns: heya min; 2 hmds fa-

subaqubebflncompumhpa. Givcttuegflthnflllsflseinfiammionvofldflfhis a gifithat wm you oryour fflends in touch wlth thn oomputet universe

yunr, gfiw

Compum Paperl nur fricnds will remmnbu yourt

out

htfixlnean thmugh-

listen just uzyour newyearnndyoumnwjnoyhasslefrushopping. ' ' auiomhelownndwewmuvlu MUIn-nomhlyimxes foruch man: _your Hat. lt injust 513.99 for thcfinl mm: own new Iubucfiptiorü und

511.99 reachadditional fLAndwewilln (ovxgour eanattractiwcnrdtoannouncn auch Plllounhoform nndsmditlang-o y! lfymnqtflnmnspaoemmply ‘Ihn Computer Papa 3205 Wut 13th Avuvnnomavu EC. 76K 2116. attachvinthothhfomuxdmfllittoz To oder by plane,all (600733-5996. ._ .1

S“ M!

ription

PlaIeuInma-yarnhaiphuflorlhl

tttlflhflfllnkiihfilmlfislLnähäfiflfi.

CiyIFfovRoIIlCoda: l.N

1N .‚ Addreu____________

einnahmen:

cuy/Pfvlronucoax

Paymenl: Ü Payrlmllfitbid Ü Vinü

arm-al-

53081::

City/PIrv/Poflal

Code:

‘Inforum: Papa: Wann:1988 a 19‘

Business Pro Computer Products SALES-RENTALS-LEASE-SERVICE-MAINTENANCE CONTRACTS-REPAIRS DESKTOP

PRINTEFIS

LASER?’

. . -

‘ESTIIäIIÄRSPSON

_ _-

. TOP SOLUTIONS LOW PRICES TQSH|BA

PLOTTERS

LAPTOP/ PORTABLE COMPUTERS

DIGITIZERS

- --

TAPE BACKUP

FAX

- - -

ARCHIVE evenex o MOUNTAIN WANGTEK GENOA oncmo TECMAR

‚Tosmm

SCANNERS

MODEMS

HP MKIROTEK

-- --

' '

DRNES

SEAGATE IOMEGA

ÄQfmDJfiäBZYäEM

705m3“' T 5 “

PRACTICAL pennmenus

unrrn. oecsmaan 21.1988 uuuuonnonooonooooooS5_366_OO

nannnoooonoooononos5'999_OO unnnoonoonnoonoous4ißgs_oo

onnnnonoooooouoS4J99_0O

ROLAND (HÄVEN)PR2417 """"“"“°S599.00 ROLÄND. LÄSER PHINTER -°°""""“S2.999.00 nunnononnnnnonooos769_OO ÄRCHIVE 40MB TAPE BÄCKUP °""°"S577.00

-- - --- -. -

LOTUS EXCEL DBASE |v

WORDPERFECT MS wono MULTIMATE RBASE PAGEMAKEFI VENTURA NORTON WOHDSTAR SMART

SMC acou

CHIPS

copnocessons

BYTE MAGAZINETOP RATED ACcEL 386 20 MHz MICRONICS SYSTEM BOAHD ‘IMBRAM 40 MB HARD DISK 1.2 MBDRIVE. --—

t- ucts

gzn-asso East Hastings st.‚ Vancouver B.C. v5|< 2A9 FAX (504) 299-0530

NOVEL PUFIE DATA

BPC Business Pro Computer f0

-- --

NETWOHKS

SOFTWARE

' äsEnagorFIgsEswonLoponT

MlCFlOPOLIS umnscnnas

I20 T11: Computer Papa: Dccembcr 198S

' GTCO ° SUMMAG RAPHICS ' HITACHI KURTA

BONDWELL ° ZENITH ' MITSUBISHI ° SHARP

HEWLETT PACKARD

° HOUSTON INSTRUMENTS ° MUTOH ° IOLINE ROLAND

° COMPAQ ° EPSON ° NEC TOSHIBA ° IPC

' NEC '

' EPSON ‘ “P ‘ NEC o PANASONIC OMS ;QK|DATA. A31’ CANON CmZEN v ROLAND FUJITSU

ZENITH wysg A355; NEC PACKARD BELL * PC II -MICRONICS 0 SAMSUNG LEADING EDGE * IPC EVEaEx ACCEL As| MITSUBISHI 0 MITAC

IBM AT&T

34.19100

:-mit2"Lt-si:-=::-.:2:::=::-:e::»2:.::-=1‚f’ PHÜEB BUBJECT T0 CHNflE IMTI-DUT NOTICE

Ltd.

SAL ES

299-0530

a-aunwiv-wvv

..———.—n-0—n—

Homlinthgdbporhgsmmmmiapuut furmuwmnl5lld"drive.1'hismnclincmlyhe npndpino-(ennu-sbumfllpuniac.

KaypmzflflPlu-flfismndflualypiudmm-

punurhanhyhnudwilhpndkyoundhcl

‘flzbndflikflüflconlpmflnlflbdisphyßmm omwlugmuflmuzmdnbhuxhunickna sommcainpxtflfponhhachfldßanm-

nnucomswithflwfluicmdwocdsm-MOO

111111 1110101191001 111999177119. und 17104km.

—

1200 und

NEC Ulk-nun "n11: mazing 1990p “U13

onlyMlhluV-Büpocauruuuiüflfl;

hoounwihflofiofkwuflnlorflmnm

diahwhichunßnscplnubnuerynrflaindlu

Ihmdncunwhrinswüdiedfimhflniz: keyhocd pmvidcs quiu will: fendbaü DOS SJhUfiJHEmGMS-DOSMIDQEIBEIROM.

1111110100111911111240o11111110100m.0001'u1p011 971d ROM und d-ivc. Businm 0nd sind ROM

cnücmcaminupm 111111.7'11m110;011d

bnckliufitphy.Th.emdm'guble lithiumbcucry lulnboutilhnwaxltinunoved fmnchugingin

99011911115 1.21b7001192352. 11710110911513.5‘ disk-

eucdrivcmncmruiwfiwmdftnmninlmhlb

11172ox11.110p11011.1. NEC 1119111511005 91.-71101-:1.1111001110Hb_ which fofluwnlßes Ihn: [Ist NBCV-SO

camonlthasnfallsiukzyhoudirithmniccled

mdpiasmlkaycßdhacaflonofthaünarkcy i9Iliahfly 511111111111. ‘[110 scplnß muuorltmmnrio ktypndilbcdadabovemeowflkflkgyxflw

lofbncflitfllpfltwistlfibucneuhhiflahlue

—

andcuilyreadlblc. NEC Mullfipeed HD 111i:

uns: wi1h5l2k0fROMwhich0onIaimNonpdFi1a. D10161’. 01411111117. Setup, Ind Teleoom noftwue. 1a

51211 0311111150 011012911 m00 (000013; 110011011) RAM m included. Tho 01102115711 disphy i9hackliL 711975 i9 n ncpamc nuncriclcmwt hypod.

lwyboufi 125101.9 9nd kcy 9011001 an: V0731 good. This modal da09 nouuppon amuh co-proccuor. ‘R9-

5110111701521 vThcmllsizedkeyboadhv-xh sapazatcxmnarickeypndfismilyuxdhunndfl feeLflwbncklitLCDhuslhnindooumutl-lov-

au. 1110

Shnp h: marny (093909 und i9 11a expansive. _. ‘fand: IÜILT -wl:ihtlmerlugcndhavy.

misoompumroflmmnyfinflwufcnlnodat

primhhnagwdhckluLCDdi-tpllywxfllnp keybocdhmmpuuhcdefinphaybocd 9716011199119! floppydrive.

ToshlbaTIOIII-‘Ihisisuxpensivelmnpeomu

wimMS-DO81lli11ROM.Tb5di9-_phyis0lu curmuwith 01000111501101940: 200790110111100111100 agoodhludducznn1111111199

1500111990011. 7001111111 TINO-Thiliuvaynmfll 1101011111111

Survey of Laptops Avala Ilamfoctuor‘ 5

111101101

_ _

4111011011 PPC 540 901111111011 9 701110 90111111011 BT 2o 001011110 3110111

001011110 5110p 1+1 001011110 9110p 1+1 2o

200091110

11 Ulralight 111.21) 115c 011111110111 (2 14111 1501411111011000 EI. NEC 1111111100000 110 Sanyo 151.7 5111110904521 50001071011 1110001 2

71111001 .

V30 90099

90099 V-20

90099 9009s V-20

V30 v-30 V30 V30 90099 V30 90099 5111111109011 114000120 90099 V-20 71111011 1400 1.7 7011011 1400 LT2o 1.91 V-2o 7001119071000 90099 700111110 71200 90095 7001111107120020991 90005

anal 5111:

9 9 9 47719.54 47719.54

The Lower Mamland Marke:

ßxlnmn

‚

54011

1211

D1911

011m 2 1172011

L110

‚n10 19

2 1172011

011 x011

34911

54011

1 1172011. 20 M0 1012 1172011

49111

1.25111

21172011 72011 5201110

2111 2111

1.2514

011

47719.54

47719

1'111111 9.93 9.53 21411 47719.54 94011 47719.54 911011 914.77 911011 7.19 4.7719 47719 54011 7 7.15 7.15 4.77 5 211 47719.5 1 47719.5 1

21172011 1.44111 0111.

a: 7g

2 1172011

4-9111

21172011 72011520151 2 1172011 72011 5 20 1411 2 1172011 01

9111

72011 + 2011111

1.511111

1.54

1.54 79911 79911

1291.1 51111 511111

72011 a.2011.1 72011 2 1172011 01 7201142011111

;_:;.-.

4 x 17.9 9 3.5 x 13.5 x 12 3.5 x 13.5 x 12 2.5 x 13.2 x 12 3.2 x 13 x 13 32 x 13 x 13

19.2 132 10 9 9 .. 15

35x13x115

1.4 11.9 x 9 3 1.4 x 11.9 x 9.3 3.1 x 19.5 124

4.4

2111 2111

1.441111 0111

-._.shog_ltj’cbgpaj‚|ggcflod 2111111111511’. 1.101 P1100

4.4 11.5

1.4111

14.3 7.9 13 9.7 9.7

3.5 x 13.7 12.5 2.41121251: 11.4 3x 122x 13.7 3 x 122 x12.2 3 x 12.2 x122 3.5 x 14.5 x 12.5 3.5 x 14.5 x 12.9

2.5 x 12.2 x 12 2.5x12.2x 12

13.11 13:. 94

4111

2-4111 7111

2x122x11

52095 52739 53595 52749 53595 55495 53520 54799

55999

53275 55155 52099 54495 53599 55299

91599 52495 51999

54299 55999

azoldbhufldhkhafinmmfummindufl-

in; 11ranovnhla bmny 9nd 011117301- md 300d

keyboudThcmeunismlbcnkliL

80286 Laptops mtsubhhlMPä-‘lhislgmphuahigfly 10511110 11" um 054111411. 1101 1111111 004 100011111071. Keyboard nummern could b: baut hat focluxlrespunnmgoodflnpioeismauivo [umhin capahlemachinc. 70011111073200-71110 12Mhz.l91b.c0n1puut

hszmhlxmcpfibleapuuinnslolnßfik

connpaflble 65591171 Ind mp1: dinkstotngu. 1115

lMbkAMcmbchcrenscdlo-ßblbwilhomufiag

lhoexpnnflm: 110147110732001001100011111

compnnarmdisreasonnblyprizxdfimibhpwpu Tushihslü-fluveryhgflflcguflnflludisphy an 111i: 1119011111011: 111122111109: und 0011111991 connnhmdnhoodhomdnwctaflecfiunsfifiukey» lacnrdisxapomivnwnhmuniveupfiauzvcflalalmsoftwmandpodmmualsnehcludadh

vcrymllfemnudmndhc. ZmImTurbuPonJIC-fltisoanptwhasm mmmflinypogowhitelfibdfisphjnhatxbedp’

90110111011 9300

90295

0011111011 9L7 295 11.40 000295 1411001110111 1492951. 1151001110111 1921m- 20

1150 1110000011 295 1120 210500011295 7001111071500 700111110 73200 20111111 3100150011

20111111 3000109011 299

1.44 .1 40 11111 2 111.441.111 1.44 4 201411 51111 72011.11.44M s.20 M11 51411 401411 511111 1441201110 5111

3.911111

90295 50295 90295 90290 900299 90299 90299

2.51111 2.51111

41.111 21191

900299

2M:

71111001 —- 9110011 591111101 0m _ 1150 P1050000 395 15 90395 NEC 11103110011 395 15 90395 700111110 75100 90395 9115 700111111175200 20 90399 20111111 70111007011 399 50995 9112 5112 711100511011 3954 1110000190395

uhnblckcybouwdauuklbcbunnfluflwbospon im mmy Immun ifyou u: 1001:1113 f0: npowcrful uuchina. A Nah Mann Print: ‘Ibepicasnhovewereobtnirxodhasxuvcyof 711000010 arejustanmpling ofxhamcm relailershthecily. W0Iecdvodarmge o! 511g-

populuhpnpPCLTlummmmymmnindudin; new 1und0]: just kein; Inland. ‘H110 tahla whichfollows survey: Ihcsnmdolhm.

001110011 91.7255 11120 900299

guudmuilpricinghommucvendmndaen whm 1110 S.R.P. was 00mm. 1h: nlling 1111101: vnried 00111100111011150011101111011000111101-‚010-

15.9 14 14 11.4 19

72011 1 401411

72011114414

_‚

L110 2-3111

I10

1.44 9 40 111111 17.9 101411 1.44 9100141 25111 17.9 41411 1.44 4 401.111 14.7 911110 1.44 4 100111 .5 10.9111 19.9 3140 1.44 1 401411 2 9111 14.7 311111 1111111 2400 9 1110110111 2 9111 14.7 101.411

14.5

_ m51

3 x 12.2 x 12.2 3 122 x 122

14.5

4201111

1401111110111! '.I-n10111'-;'— -

3.5 x123x 142 3.5 x 12.3x 14.2 35 xz12.9 x 149 55xz129x149 2.7x122x125 3.9 x14.5x 15.5

15.9

-‚

59099 54995

55095 57999 59599 95999 59499 57599

Q9599

49x01x01

3.9 x 15.9 x 13.9 511.499 3.9 x15.9 x 13.5 512.799 97x 14.2 x 12.4 511.599 3.9 x 14.3 15.3 515.999 475x 132 x 147 512.399 4.75 x 13.2 x 14.7 512.999

Lookfnrthefecnltuyoumemuaddwmsml

souse cunmutflgsfrgomfioäoffllcuszßtgflflifle. plcesmlhnsllhhwfihnomxfialblc dnppinzgfcrpieondlhclwdofnqaponlhuyou

quanü ofsalnmmoslcmmmdisoomufigure willrequtilnlnmnwcucxixwillbemmoonaf900m5 bcuboußofioffliauüayomownpflc- fecdvonopaymmifflwvundorlshzowlodgublc iuon tniuuixwinvuyovcdmoawcfl. uulwmhguopvvidununmnspponbyvu. -D0c91abc719B8 v2!

.1;

" W f fl i

-|'I1'*

I 0 1

>'."1’

„das:

2.3%..“

‚Ewm

E9:

...

RQN

„b a.

mmrazn

.5. onoooi.

95.:. ntzflm

549355 „H95.

‚UHU

r i

3mm:

‚m .u.__.msam

nuhfi

= «Gnu-Ä-.

cczcn

„mgmmm

nohfi

25|. zfiw

9:57

B nxh l nuuw.

mm:

„mom

mösvoä d

0:1.

„m55

ozcmo

öSaEoo BEQEou .m_nm__m>m

mäacom

„o „E: __E

öSaEoo

maxräm.

Esoogn wncmwaop:

.9: „maaoo

„o

‚

man m5.

„

„musöm

__:_

‚E.

Eo:

„vom

mmoogu

5115:5

mbcflsmä

„m33

o 2

„mzweäom

mueaaoo

„mocämän

„vom mmz: E:oum.Q

„äqm

„wagen

„Eo:

mmuca

805-5 mmocq

3o.

„o

m5 0cm

zmäoocm>

m5:

m: xmuämsm.

.„

..„_

Ezoumö

39.93: .__m

Emmää

„Eäazuä oucocmaxm

dösooa

12..:

.„„.m‚.c._

ämmmmm

.2.

„i: „z:

aß.das..

.„‚..O:_w‚.

>aam<um

ZZ-The Computer Papa-Daumens!!!

FG..

umaä.

„ü....

wg.

mmP...

m „._m...

a. .3

„m

‚ü „.2..

n... „n..

um 3.2

wann

3.3

„man

..„_.:.„.„.

2....

3..... 3.49,.

O m?! n95.»

__ was..

mmdon

s. .

9832..

t3..“

2:53:34

02....

näw

sneiw

.200 3....

.31.

53min.»

...:.... m33 33..

.F9.i„.7a.f mouwaurfiuonflaä ‚Knien

... mw „m.. m w

.„

s3.

‚a:

anno}

:...

. DQ =

2...:

..uuco..>

a: s3 5a

.52.»

P500

E... «u...

„.3...

8.... „S2392.

m... mm9».

man.

man

3....

5.3..

2.3.

.„

02:.)

03.:..

du.)

.25... . .95.. cF s m

24:.)

v2.20

2.:

8m.

äct= .9=3> .x.I!

v3.55;

„

s n.

3e..

‚m.

2.. a...

m Tag.

.2.

3N»

3.2.

nmdvn

was:

3E.

. 2n.

‚.2...

toten

und

..:n.Su.„.

7..»

v9.52.

.m.

„.2:

62.53.5.

„.

‚Lüfinq...

1323W

zum.

a. n.

ü.

„S u».

.„m....

n. m. 3.3

„m...

fiifiä nznz via».. 2.52

a. a 3 a an... a. E.‚n...

m...

am..»

n38

.195.

‚WER.

40....

a „a...

.5...

8.2.

.38.

5:393.51:

3.3.

93.9..

3.58..

e...

m. .

„n u. „a

m: n.

m» c

„m...

mmmn

„in...

n52..

„M...

„a...

{Zu

8,...

2..

3.2l.

3.8.

35:56

„n.

9.533:

s...

.t:.%.r2.

‚2a‚...

.33.. 5310g

25...:

„haue,

n59;

55.3

„m...

m..

3.5

36m

„z:

3.....

ä „E2

=un:.o>

...„„.3.e...

„.953 30m0» 59...‘ zucuh ‚.25..

flötnühu.

i8 so...

3.02

mm2.

Uafizmocmozwum i u}

mrnw i önä

S8..

.33. .

3.3 n...

mm2.

o0.

.‚....

Ftäu

9.8

.uEo.n:uA_D

„E..

mzoä.o_z:ä2oo

2.9.: 32m.

1.53.0

5... 3.3320 1U..

sind 212m >_.nz.=m.nno.u

‚ü...

2..

08.5.2.1

5....

u...

ä...

mflxmdw-‚WQN

n3...

„w?“

wo .

_..._._..

083.228.

u...

‚lau summa 050k

s...

__o0 „E...

s.w

._.

omcmmm

gzflä.

0m.36539.5

.28 253.3

3....;

Es?

‚.28.

n...

5d)

summa...

-..

Sie..

„E...

5..

_.osn.‚om

„um

mm...

s 3.3.

. 55:00. 22.3..

.‚.‚.........„„.. ‚.5... E... „i... „zu.. 3..

.2. „w...

1.5..

.5...

. „m... ‚unter.

3.3

JPmMunur-ic‚ t

m =au5o>

3...

63.5

antun

zozqsmo?

.355

an .

v9.15.

32a:

.‚s

.36

‚.588.

Hans

„A.

R man

.2...

31.9894.

UCH<E>

„m..

wmvw

o! 2a

0:00

m3...

„m8,.

m: ä

au. San-Ei

oämmomo

a...

3.:... 7....

E...

„a...

a..)

>..o.:.

5.30.

.uo_o._n‚_8oh

.2:

u‚.us.h.m .

„.2..

2....

.„..o..

m .38..

n.. 8....

‚e234.

.:._„...s m...

Caen»?

„.222

‚n

3....

..x.m.3m.

8.3 ‚.3.

9428

2...

ging;

ü...

um.

nmmz

paar.

2.25 zozaonom

mm9..

2:0;

me.

Wlbm o...

mwoxo

Batzen

.5.

„.62..

....a.......„x... 5.... „zu; 2.9.5 f..i‚2:fs2. ...„..m 5.5.5

3.98

32m

„.222... 8.3. ins-c.

n33;

als:

«M0 i.‚nw.„.m.u.uponom

m. 3.3

3.3

Äuumu

zopncetfinfioo

....„.._..„ fixornafih 1.9.2..

Sie.

5:2.

5.32.45.

äu-

„m...

mmmn

ca.52

8....

. am.. „m..

„._.„.„._„„_.„_...

‚.

u».

m0..

„dal3?

m..

:._..:o 8mm

„m.

3.8. 33.

mnnxgmmuo

„S:

„man

unten

„.3

a........

.00

‚mawwwgfi-apm.

‚in..

.51‘..

L. xmmwfim

.„...„.„.«.‚„.„._m. 50.. Banne

i. 8...»..

äou am.

„raus.

uuäasud

.mD.„.€.

6....

an.

„„.

äägnaüäo

ca.25

.. ..

man

...

a...

„i-

.:am»...

0..

!i.-.:5=.o..m.. 2.2:

...u s aus..

anan 8.E.anno-R.3

m4.?

.s?.

.23

„

3 .52.

„E.. „Es. „ä...

omämoozm

„a2..

0% n.

nmo.oa.o3:.

iP„oa8u.n.2uifla?a

m2...

s. U35..

man:

Waden

. 23K

5...

850 Efinffiu .235.. PS..

3te aus 33.3.

o...

.32!t3’:

au.

. 8.6.2.3.5.

3.3.3.

xnmou-n

„m.

D33053

u..» „H.

ad... .2...

‚Sau.. „.393.

mm6.

‚.2..

mw_._.=._.D

4....... toz n

A}...

41..

3525x153.

.5214..-..

.32..

„Ente.

5.13::

.935

Eoox

„m .

aowxmmo

o...

„h...

„.338

Samt...

m...

1.95...

E3...

nuauxunnEoo

„.252.

_. .

o...

äeaEoo

‚.513..

um.»

5.2.5

.00»

‚

am...

360

.2.__.:.

„n..“

G..-

mm um

„m...

„m..

e...

m...

n.. .

„am..

32m

00002€.

m....

„a..

amm8.n..

zmwmmagtnfleqflmo

m. m.

a. MM...

‚s1?

2... .:.....„.:o 8...

D800

„u...

„um.„m... w „a...

3.:...

n..

.4..

r.._.n.„.

22a

s...

„ä.

uliu

5.....

.3..

.. im um ...um

w0=._n<m0

„ran

„am

3....

n35

m..

mm .

s._ m.

‚n.

„a... Q9.

2. ms

.3 .

3...

23m

3.3

„man.

anS

3..

VU9

x3.

=.< 6...

>QGU

=ono„.x2

o...

I. ‘l1

.23

5...;

„m.

w?‚ mm S. .

310m

. s...m... .

. .

GONO-

w...

„..

ü...

.9.

wann.

.295).

„an..

‚z. .‚.‚...„..vw„.„ Eäw22m 1.1.3

‚E-m .335.

ou.E_.:Z „5 i 32.

„.9

.2.. 3.3.

3.8

gzuncm

1... ‚E...

‚. i:

....

m: t

3.8i

...‚....„._...

„m26

.932

„ozcou

„um.

„m...

in...

U392:

‚n.

v2.5

-253.

m31

2... 365m9?

a... M...

3.:

„äm3 ..Qw

m39

a2.. mm_._._.=._.3

c. n...

n...

am n...

s...

„.8

. t um m ..‚

.54.

l: a: NÜGNWCJ

huaxmma

HwCanpnwPnpn omeembetlwß e23 ---i._

The Maximizer Helps

PRODUCT: The Mnximizor 301030 1.6 PUBUSHER: Pinotron Suitwaro SYSTEM REOUIHELETTS:IBMPC orcnrnpatüalo. 64OK.Mo 720kdislu oronn360k disk and a hard drlvo, EGA lucotnntmdedPamlnlponaptitttec mquirod. System cloddcalnndnr roqulrod for aomo 1090m. Pmca: C8195 Singln Usnr. LAN versions

am availnuatorasandzoorrnoreusus.

Like Pncklht (reviewedin thn (Jcmbcr isst: of The Compulcr Papa) m:Muimiw is nnothcr prc-suttcucd datn baue. 111i: am 1sdesignod to kncp tnck o! Clients Im! c m l x ß Im! 1o nur: min. schedules. lauen. lud tnlcphone listinp. etc. tn help Ihn exocutivc o: nlns professimnl in

zuz.‘ ‚an-actfi‘ y The Easy-To-Follow Accounting System For Growing Business Everything trom cheque vtriling, invoicing. job costing, Canadian payroll to general Iedger and accounts receivable payable in clear Colourful pictures. Easy to use for all accounting statt.

itlxxctuchinpro-ductivity mdwmpetitiverlcss. Uncr friendly intcrfnon. m:was: 1odu:nnd flexibility am whnl mnku min ptogtnm nunctive. Anlnslnllpogmn nndlnstnllntiun mdTeclnticnl Rcfctnnco booklct tanke insullationcuy.T116 User's Guido nnd 1.1l: Quick Rnfnrcnoe cm1 pmvide der instructium und n: m11 illustrntcd. 112c Muimiru in n B-Tricvc type dm bunt. which pruvidcn rapid Access 1o dntn. nnd usw n windowing type env ltotuttom. 11m": m d'une types o! wittdow: (man.1in3 nnd (Oma) which ovcrlnyctteaztotlnan theynreopmedsckctiom arcmnd: by ausor, pnxe up nnd down kcyn. au’ etttaing Ihn fixst leuu 01' n mcnu dualen A motbe isnotusodllummbe: ofrooordn inonly lintitcd by your disk man. Functiona o! The Mnxlmlzcr l. Client/Genua: Rnoords oontnin mnny fields. including ‘Snluution’ fol’ mnil menge. [nur phone mmbcxxlnstnndnextaonuctdntcamdmu o! tmlimited lcnglh. A recorrd cnn b: designntod ‘Private’. when you want to cxclude othe: LAN uscxs fmm im. lLgttun/Snlnctionpovidu nnndilorfot mil-

in; taten. n mnil menge fncility. 3nd pxinling cf 1mm.lnbels nndmvdopns (usingClimufmunr-‘t record dann). 3. Personal Rocordn Ire und f0: schcdulirlg your nctivitics uxlmnimnitxing mies md mcnmn.

goes farmensuxc imggrityofthcdnmbasc. Suggestion: f0! Enhmmmuu ofFuuue Vmions The Muiminer i: nhmdy a vcxy nttractive pmgramhttsuftwmcnmpmicsconsmttlysu-ivn m cnhnncc und: prodncts. Somc suggcstimts m

Pineuec Softwar: am: 4. schaduled activificfl und lppoinunents f0: lhc dny 1. Supplyixtg print: drivers. The ptolifcznfion of wank or month. prinmrs onlhc muknl mutenthis 135k incrcuixxgly 5. llal-Up/Qttick Acmnn cm 115e a dixcclouy difflcttlt für soflwue mmpnnins. you hnve schaut! {mm ClicnllCmtnct reooxüs. lfitmopngeduuwbemmadonsmmlypcsof usittguundinhifyouhnvc nmodem. Youcnn rccordx. so Ihn: such rocords cnn be autotmticafly uuanotu whileontltephoncnttdcnlldwntionis dcleted o: downlnudcd an n dann wlwn thcy will Ionen}.Cnmpletnd Calls can bcmnrltcd on Ihn [ist Clcnrly hzvn beccmc obsolet; 3. The semp ptogxm mould malte povision Ion min; um LZMb drivcn. 4. Mnking provision i'm mit] printnrs. S. Prinmut ol’ mottgagc achcdulas. G.Rc-pouitianing of wimlown so they don't block display ot’ 1.1l:nnmc 1o which du: displnycd wenn: '

The Maximizer will typically be used by

sales people...

is related.

Pinerree Suflwnre Cmada Ltd. is listcd on the VSE. The fixm i5 locltzd in Richmond. B.C.‚ so productnxpfxxt i5nvnihblc In rcgiswed uscrs via with nn meist. n Richmond phnne nutnbcr. 6. Pnymmt Cnlculntions cnnble you w cnlcuThe Muimiur can nuw impurt und expnrt lnte mongagcs und kann: und display puymcnt dattl. il i5n0 Immer copy pmtcctcd. und i: nupplied nchedulec an bolh 5.25 " (36OKb) md 3.5” (720Kb) disk7. Utilides emblc you wsct up pnsswords und cusnffltz singlc uscx vctsion i: vay cnmpetiüvcly syswm dcfntms etc. pricud nt S193 Useful Im- Salm l-lxecutlves Timing nf (bis ptodut-t i: exccllcnt. lt is deo The Muhnizu will rypically b: uscd by Inlu signpd In nm an lnp top Computers, ulu of which peoplc. who ucnotnecessnrily computu oriented an: upcctod u: grnw rnpidly und n i e : enecutives nnd face Iwqucnt phone calls und otha disunc- ampuniculnxly nnracted to portable compuring. dem, while using n pmgrnm. The progrum "u Pinetrec aim: to becnme the- lculux in snlt-‚n intuitive und thus canily lenrned. The ENTER kcy productivity suflwlre. ‘m:Maximizc: i: nun:nelecu from nmmu u: lisL '11: ESCape kcy cxiu tively gxiccd. an:fricndly 1nd is npowqlul ulu In 1h: previous windvw. n:which time you havc pruductivity tool. lt should bc I wixmcr. die Option to snvc chnngcs. Rocotds an: fmtnved Chrln J. Motten. B.Com. (325-9609) i3 a to n temponxy file. lf Uwe i5an intcmrption (mich Technlcal Wrilar and Photographen, who n5 n power fnilmc) during n uve. an inwmplct: in scmtare and hardwma apeciallzes tnoard i: nulomnticnlly dincxfied. 111i: [nun-c usnr manuals.wtiting

DEALERS Bevill Computer SOFViCP Inc. Surrey.

GUS-WM

SECoInpuIcr Consultanlgtlnc. kamloops, 31115-1202 ÄCIPJD

Compuware Inc VEIHCOLIVOT. GSS-dfilfzsb’ Eagle Computvng Systems

DeIta.9—13—G765

A 8 7 Soltware SySIUIHS N. Varucciuvor, 906-1640 or 904-5154

ROWEHH Ottley

N. Va n c o t t v e r, 929-8295 R..J.L. Management Ltd Vtctona. 721-2700 Halsey rulanagement Ltd.

V0l1COLl‘JE’l.U?9-5343 John [ w e n s

rulanacinmeutt

Limited

Vancouuren- 084-4909

Raymond CI19ttrtg.C.G.A. Vancouvet, BM-t I35

HMS

SYSTEMS INC.

681-9575 B C. Dislrtbutor

. f4Ämflmpuflpu ofleonmbet 1935

Pixie Perform (SloWly) P1100001’: PIXIE PUBUSHER: 2a rtphics SYSTEM REOUI ENTS: PC I P82 er 100%oompatibla Windows 2.0): oompatbla graphicscard. 512KRAM. M0060 0063.0: Hardware noommondod. AT(12Mhz +) wlth last wenn dlsk ( a 38B lor mal production). VGA graphics card (an aooolorntod graphlcs card likn Ihn NEC MVA 1024 or VIDEO TS VRAMeaIdwihSIZK onboatd will helpmovo thls progmm a Eule qulcker. PRICE: 50.8. 195 Fonts S96 nach. PixiebyzenognplticnknPCwinnlownlm bnscd dmting und dnvfmg ptogxnm nilncd n:

moseofunintaenedingntfingotufliontpum visuals" elf-wem ä. onto pnper o1 unnsparency.

Hxiehasthncnpnhilityofprodtxcingverysophiaticnud pnscmntion pnphicx. Thn i: n micm vmion of Zcnogxfitic‘: high und oolour pnpltiu pnckage Miragc.With Pinieyou cm pull

inümpannnmnbcroftcntnndgrnfiucfiles Erom oLha i m m u n mch u; LDDBPIC. CADDFX. CGM, vidoonläowflC. G. ASCII tnxt eithct diroctlyonlunugh the WMÖOHISMCLIHICÜVMF) with its inhcttm64K limllation.Output 111c:fmm

—

Pixiecmbencutntnoawmdownooutpntible

ouptttdcvmmwellfixieimgescmbc I n n s fmnd to Desktop Publixhixtg pncluges. sudt u Plgatnnker. Output filc formntn cunently availnbleforPixio am: DünnpmuünphicsMemfilcs (CGMhhcoldstnndlzdwhthimpußmmonl utddrnwingprogxnm. 2)Wtndows Mm Files (WMF)(Cotnpatiblc withVenntn Publishcr vcrsion 1.12 pntch using Lhc CUFIDVPEXE 51:. nnd Pngemaker 3.0. 3) SCODL files which muscdtodrivefinemnuixcnmuuwhichpn» dann high rnnolutim (2250 by 1500 llnes) oolnur slidcs (mm.cnmputet‘ filcs. Who News Pinie’! Anybody wlnlxubtnnknpeswmtimvisunls

onnmgttlnrbnsisnxtdhntndolhctnwnllinn xhort paiod of timc wilhout cxpmdmg mach czcaüve cncrgy. With n few simple mcnu nein:dotts you cnn nchicve notncvnxy intpessivc locking aolou: Süden. wlotr plus ‚und mamnl 0010m prinmutn fort’ a very tcasonnbl: mit ans: (blnck ä‘. whit: outputon m05! Windown compndbln output dcvicnn too fot evcn 1ms). Problems h Hendncbß. Sonne problum nxis: with Pinie.Tosmnmnrian buicfly: bitmapped foms. trnnsfct problcms. nluggish pufounnrwe. bugs ä. Winduw: WINJINTI nighnnntes. Thnl Pinie. bflling itself n: n high rcsoluümt output churüxxg pncknge. comu with onJy bitmnpped fontn was nsloutxlixtg und itriming. Thouglt lheyptomiumsctidyouHclveti-znhlfumnil (reg. S9511) USvnluc) Im’Im: with your mgintrn1km und. n: 595.00 US n p0p fur fonu your ctcativity quickly bocomes limitodby you: budgct. Not stuprixinglymnly Plxle. Mirngc. Autunm (n11 sind pnckngu) (um: von: Wim (bis propnm. Alsonolctltnttlmercmtvector fonxs. onlyftllcd polygons n1 whnt looks to be about n 280 dpi resolution. Fron: tbc pncltnging, l was mislnd inlo Ihinking n11my Winden: ianu was nvniinblc u: Ihn packnge neuem: Ihcm. 'n-tny m. laut only in Iheir bit mnppnd fomt. which man: nnt mnath curvu when going t0 an output dcvioe. Export!“ Armut Importing nrtwork created by Pinie: into Vantun Publinhcr was uneucoessful in all rny attgmpu using die WMF forma. lmpocrting Ihcm simply dumpul Vcnnnfium manory. hnpunhtgWMF: crcatedby Pixiemultndhxno imngcbcing unmferred both in Vcntun L12 und in Pagcmkcr 3.0. GEM und CGM filc formnts unnsfened u; Venmrn axtd Pugcmnka but with poor rasulls whcn coiow was und und thctenultn was not preuy. Only thc blncl: ‚I‘. whitn imagmt nnponed n: CGM man ware suocessful in thcit- nppnnrnnce. Speed, or Lack Tbereof Spcedinnaothnthmgwltidt mispozxunlnch. Sao-etliches}: titucn tenbystnnl. Pixie inthci:

docutncntntimt nclmowlodgc Iltis und nutlu: m m : usofttl Suggestion: which you would bc wisc t0

follow; lilte leuing your computer dn the worin ovflnigtl.

TII: Drudnd WINLINI Configurntitm ‘Ute ethn- l-roblam neu {er thi: pmgnm in renlly inhcmnl in nll Windows progxwru thnt

dmndcd WIINBII file which 1sLhc nocasnry cvil nllowirxg you u: neues;printing dcviccs und anmmizeperformanccin this und all otltex Wimiows band applicaliouu. In thin cnee Pixia ptovide somn “magicnmnbcn"whichcm beplnoedintbe WIND“ fihnndthatnncfifwdtoctntonziupafomnnceinfixintlfingsliltcthopshadowmxt andtctttbordu wldthsetaflztftxmnntcly they did nol werken Ihn firnt eflort. but I rcmuin hopefttl WM! I! Don Wall ' The 300d news. Intpordng grnphics into Pinie

isnmnpnndittnllmynttcmpmsucassfulittnll filn formats clnimcd. Text impnrts well n: ASCII

md Ihn oumvh wixhin Ihn progrnm m ncczptable though slow. Colour cnnuol und ctmtrol ofthechmtittg iunctiom i: excallmt. The chnru you man: am whu Hxie rufen In as “smnrt“. Ihn: 1.-, tlwy an: wntcxt sensitive to Lheir futctionih: in. Uyoumodifynvnlmofß-Dpic chttn with fnur nngmnms Ihr: zcmnittittg Ihre: m: modificd in vintnl pmoponions which mflccu Ihe new valuc. Cxcnung chnm i: a snap u: Pixit: hat mcnl pn-‚cxistingfu-mm you cmjust sruffyow du:intn und huvc 300d looking results itmnedimly.Malting ncw cluru i: xpeeded by hnving w unly an: thrne instmccs u!’ n 4211m‘: increments und Phi: guesnns thercsL My xunpl: outputwas of 500d qunlity. 1h: Ihnmnl colour printu nnd man’: cmera lmages I hat! produced locnlly n: Grnphicnlly Spnaking wen: o! cmcllmt qunliry, Lhnnb losem:crnative bnckgruund: provided by

the pnoductim Hilf.

Ward Stlrrat is a Iocal olactronic publishor und graphlc arllst. 734-3594

or most designers and crcaüve people, the Apple ® Macintosh” can be the pcrfect soluüon for thcir

nceds’,

And now. the Mac can be perfect in colour, as well aus I colourfinl in black and whitc. Pur those of you ummay be skeptical. just dleck out our ad on pagc 069 of lhe

Colour Scanning:

High rcsolution input 0Fcolour iznages for USC in Mac Created

CÜIÜUT

Dccember Equkymagazinc...

Now that we havc your attention. E I

Der. us show you how you can connect your 131cm with the powcr and potential of Macintosh Computer Connecüon is offering two one day seminars an lhe latest in colour publistting and design. From colour scanning to separaüon. thcsc seminars will offer infnrmation and insight that cvcn the most '

demandjng

prufessional will appreciarc.

documents.

Manipulation;

C010“ Correcüofl Dr

scanned intagcs and creation of CUSIOIII

-’IWO CIBICS [0 ChOOSC from:

o‘

15.

Colour proofing and professional quality colour seperations of auWork-

-Vancouver Trade and Convcnlion Center, Canada Plane.

‘Refmhmnß 5 m “

‚ I

625.00 per person

Conmcljanice at 7366677 for dcuils and reservalions

Accounting

Networks

AccIountlng

;

v E Nu

SoIlrak Systems has been providing North American companies with expett advice on automating thelr aooountin using Computer Associates ACCPAC Plus Accountin Software. Awa ad Computer Associates‘ Access Consultant O! The ear (1987) and Developor of the Yafr (1988). weghave been reoognized as providing products and servica above and the norm. beyrond

Netäorks

Sottrak Systems, a Novell Authorized Systems Integrator, enjoys an excellgant reputatlon for knowledge and competence in Iocal area network Installation and Support. Our ople and roducts can sucoessfully impIeLment your muttI-user netwo System wnt out brealdng the bank.

SofIrak Systems ’

SYSTEMSIM.

Sinbe 1984. Softgak Systems has focused on the Accounting. LocaIArea Network and Offnce Automation workgrou requirements of the busnness community. No-one knows ACCPAC an Novell Iike wed0. lf ou want 63 man-years of miete-Computer experience working for you. cal us."

"The whole is greater than the sum of its parts..." Softrak specializes in workgroup installations. W9 have rhe uftimate experfise accountingl in etware ü?! / ACCPAC ® Plus solufions for business. T0 automate your accounring or move up to an ACCPAC Plus network —give

departrzent, us a ca .

For ame Whole Star-y’ phone‘ ; :

- oF-mfl“ ‚ m:

SYSTEmSnc.

w amnuvanoouvar. 8.0. v6.1 W1

„Thc Compuu: Papa’ n.Dqounba 1938.- 25

1 : :

Features '

1nd W306 Micmpuuflm

m m 1 ; idinn schallt In Sä I MHz Ü Wflv fing

_ '

„ w “

I 324:: COMPAQ cnmpuhln mmory M!

xm!

J5’ 144 m: Hoppy Drin u)

Mn 3.5"

Nun-tun S14.0

M.,..„ w... cm0: Clnckfllalundu Im im man: man: Tnmuu lG-bit VGA Vndm nun: (ngincr lrvd

PnnuMcurLflMlPS

Power Maar 1.02 Kwletstoln

‘WWNGJ

um. |4" VGA m m :

„um

. Evaluation Report

‘t.

fi“

(IAILIJHMEVIXGAWAXDÄ

’

2.1.0 29.4 4.1.9

Lundmnrlcfl.”

" W M 0°“H * “ W M 5 26-“ Nfaunpuaflc da! 2 54h: Xflannpuiflc 11ml

‘

.‚

‚.53

Caen, und‘;

m um Drin ( u m m a n m00

n” 25.5

PuwuMemIflMIFS

sxulzmnflwflm Plnlhl nenne: Pn-

Nun-Cache Modul

„ c m “ s‘ 4'“ lmdmlrltfl.”

an‘: RAM enp-uausu mMB

226’

JNTELIJGENT PERSONAL COMPUTER

05H. UNIX, XILNIX. PC-D@. M8»noflnovfll. Windu-n 386. Cent-arm: DOS. PC-MOS Complulin R d o c n u b l c m a n d i y m n ß fl a l k n lmIEMS Schwul: u.- Denlmdfllr H10! Sonwm ickanhla qmm

0Min: '

turymuunivclfltüche

sulcluM

Maraumßmnooocand

Zfißflizxfndd "

Hfluxfluklflnnfllfil-ÜJPBIIIHI

36699.99"

‘ulflprul in n a h m : { u m CADAIm

Fabian“. (Oaober. I90! man). Im nunmal ab;n: m: Man-I zus-mm.

"Sasgmedllmflhmdnlflimylflllml-n

IPC Series of liaptop & Portables

IPC Laptop

F i a t

:"::"""'"""“"‘ -

nflifiulflnunflhhfifliflnfl'

‚an‘:

I j fl - u a n l k - j fi - v fl - n u z

—

antuAf-c-ufll-da-Lwha

u m ‘

’“‘"“"""""".‘

DHDHVC . IIIMIIINnDvI-n a - n a a n n fl fl u n n n - u I-daarlzuunqwnvum

—

‘ ‘ .

„M“,

M‚__„.„‚„‚_

nun-nunmal

—

Infipßulfl

nun-nun

DunstNWHHIHHOO-

macnpda-II-sct-xmaanh-b

1 L ! nusmuu-nn-qu,

Inst-n:

Contad your dualer for demlls on populm- lPCfbruble Moddsmdl au: IPC 386 LCD-ENG IPC 286 LCD-ING IPC 88 LC'D—I020

PIIIU IJVDCDINVM‘ .

Iiylilfiil‘

0Min

ü fl ä b Imflflüifllfllfin

9 i n 7 !

VancouvaTel: 873-5595 Fax: 873-4552

FarnonhfunufimordeuonmubmfiuxmnndrhelPCdulanawpu. Kitchcner Toronm Klnaton Tel: 748-6738 Tel: 494-5250 Tel: 384-4210

Calgnry ‘I'd: 250-2590 Fax: 250-3059

Vnnouver nicht: IPC Sywanu Ins.

Fax: 748-9769

m Wen 7th Amme. Vncouva’. 5L‘. VSY 1 M ]

Fax: 494-5504

Fax: 384-7459

Montreal ‘I'd: 659-6522 1591365945623

‘Manflohricmn-fibufi. h h a n n - fl y - p u u p - u n - q g u n a u fi u p u u . . . u u - n q o n m u u Q v n a w - q n o fi p q t v - u n - ‚ u x n - g n - n m u m a n n v - n fl q n fl u Iy-nuu-qunflaflmlnuuy.

h n o n v a u r q j ü n u n w m n fl u c n n i fl o m u fl m v fl u m o - n - u a x n x n u fl fl n Ic-‚L-n-nnnu-ugnmr-qnug-a-nmn-qnnnnm

zs-‘fiicmrxpnifiifiu-nnmhuxwa

Strange And

Step Up When You Step Out.

O I h t n a n I n m u r - u l n u fl a l v y a l a i v fl n fl n ‘

Wonderful

PRODUCT: DoskPahI 2.0 a.DeskDraw .95 PUBUSHER: Zodoor 4500 E Spoedway #22 Tucson. Arizona 35712-5305 ceuzyaaI-a1o1 SYSTEM REOIIFIEIEWIB: 512KE Mac o! hattet. Syshm 4.1or highor. Roquiu 45K RAM. 005k Aocnsnry PHICE: 5U.S. 60

lIv-Ilflllt 1--0

ist: b a t m a n - n . F i t . IIIYQD

(ü

I-uuuu

nun-nun.

oqmamany.

735910 z tvalhbbmany . Its Müstdllphy umTwiaod NOMIIUO INTN) Und: und b0 n nun any wquewwolgn ' roodlrommmlfeot Banden Iho 1:13:50.296 nicropro19m.

ConvanUoiu war dcwlopad in Vancomw b)

cum’!!! 129mm:mpeasusmnu.

annimmt

Step out in stvle.

fiflaflfflifm”ü?“ Um.

aovmoa

„man-w

Ioavotho 1' 909mm und Ihoofliclorxc}. potfonnlmo Ihonoxt

. unflfiop Iaptop-tho '

-|-

wdaoonalbladcnmwimneasplay MS-DOSOSJOo hgsymm "‘Owlilnotvflom} MS . O H hdonsnyLMMBSI/zwloppydaok flafiflmal a

Aoxpaniondouloaooomnxoduo namory

meinden uuwotml modom

1 ynv mawfaauw’: irnind wnnanry

"w „;_ mt:nm":.°:°„-.-.:I=:.M-

MITSUBISHI ELECTRONICS

’

1Westcoast Computers i (604) 986-7680 a g; saure:-

— IN

79mm

CV-IINAÄ I n ! L Ä P T O P

COMPUTER IIARDwAKI-I,

sorzwnkt, Ivcrzssar

DüetiionutdUnitmThsModcfinthczdcfmu

um: Iype o1’ oomemion you desixc. Direczion

allows you In dclcnninc which way you m: couvaflng. I'm uxnmplc Iran-I US/Impuinl meusurc: In Maria. Finally you plck your unim nach u gnllommdllnsfllhmyoumzeyoanmotnuaxxd puah Ituoqunlkcymdymhaveyomcmvctsion

mp 286L Laptop PC

1915 lonsdale A m , North Vnncouven B.C.

pmoanscrcpvudsbeu. Oncflrwo, ‘Ilm-Comvert 11m 113cc humane you rnusl clidr. m Modc.

‘

iufracfimofasecmxdxoaxflubAvmiomüw

HypaCudnuclc 1xa tad slowa.) IIi: nvety hmdy utility i1‘ you u: in design. mginoering. 1311111634. research. ednution. school. o: cvm i! you hnve

caxiousscvmyeuoldcwmjasthavclohxow. NmTotnb Cuwcftnd Aminor cvmplairut Agnlnst thc fixsl vmion u: Text Handllng Ilwtthe progmn doesn’: mmmbex whm: iu dm Ihr:also i5nlnya cf um IDOIII avnilablc. Yuu 6166m: wmuoswitchcatcgocm mit! text. muvc andrcsiu it. und man mmi1 ries you andevcrytimeyou Im:In remgodm yom way hoch l0 Ihe inm a bit-map.

or u3o .m.

Granit-amAppßcmian: Tln Propan DakPainI. {zum hdnx. i: n a n h a n d puiu P8001167: cumnunb PIIBLIBHEB: Graphuom Appfculiom 315 pugnm for the AppleMnciruosh umvom u n da1: messen. Whüc i: rivaln many of Ihr: eur- Primus: Au. Vanoouw (604) 255-8077 rcmly Nlflnblc ILInd-Ilnna popmm und hu SYSTEM REQIIHEMENTS: DA: 612K or mme uniqtw feines, it i: a HIIIB wird ‘min heuer. Hyporcard vorslon: 1 MncPIusorbemr. PflIcE: u.s. 559.95 auch or 579.95 Ior both qponch I0 dein; Ihinp. wcblntnconverdol Pfauen T110 Futures Didyoueverwotsdmhowbi; IIIcEu-Ihwash l1 i: In exunmely usefu! mcmory xinea i: lets relation w Sauna? Or und n0 Icmw ruht now. you wenn. Import. 1nd cdit bit-mapped hmges wilhoul having In nxit you: pagc lnyout or Word how In eonvm mflu plf yllon to kilomcuul Ihre? hnuwauothueuzdovernofloooth: pmcasing ponnm. I! includa n stand-ahnt dilfauu anuvetsiom cm b: u 1Min; und: I I : vasimhxtwu denipadmnirmvankAMAppkmuwonwwmcimoshwhmyoubuyflw m i d m desk nceeucry. Inland ComctUIIiu m e a m q n m t unit Daskhintmvidcanhixamspped pnptxicsedilnr newly Mmmehodvmocdfcnuuasaunemlwflhfl convmionpognm. flwptogmn was doveloped wcighß und hciahll. l Bush pmfln. I16 lcvcl bynloalvuneouvaootnpnycanndtinplzicTen Anlaufen. This proylm. ndhbb in hoauooLaTexnlooltvlichdnfllmammmup bothdestacceuuynmflypefiudsmkfmmas. o!’ und free rouüm 170 text. ncungle). objccu cdiublc panuns. (1 pnltcm ubln i: availnble for i: a powerful und oompnhunsive way 1o convcn ovcr 1500 diflerent Imiu o! measnrenxmu. mixingman) und saveuloopyover Inodasflhnro The propnm groups nnuniu ofmeuwemmx i8uho n gnbbu rund. 0m: uniquc { n u n i: Ihe nbilily In ligham o: inufldiffumdnufilcufluiu.Eleuxic-ityzfleal. L131: t Radiuion. Machmics. 11m6. darkmsckctodrmofmüunpmiagnmof Hisuy. Uni! Coca tQcm-Iütitcs tndWhimsy. Onca you ‘I11: cm screenl. won' t with percmugc prognm fll-‘flmrdMncPmlfxlu mdsupponslnrga-‚screcn decidc which Inayou:oanvoßion i: in.you man nnonilors. Youcmsoalcobjcmcimuproportion- Ihre: motc humms, cum your dcsüed mit. push Ihfäqnds‘ sipkcy, md you haue you anlwcr. I: freehmd. ‘nlly ‘Ihepvgunaflyreoafisyowounvafimhm Daskhitxfsmmtunehasaruzgeofm-b-l amxtfilnaoflmifyoumdoisxgnbnnchof mumflcnion o! rexiucüon. Oneoilhenumtofthemw feinstem: lxskPaim oonversioru. Ihcy m: l.II rooorded. You hnve m: 2.0i: 1h: mncmmncüonofbitmapmltisabfl nplionofnotsavinguufilcumeetxdofmc und you cm In: III: nun-Irland eopy und kludgmumYuuhflaboopymdpuuth sufion. Immun u: plane Ihr: mahnt imo ward ps1: Installing wen: umhin imo noch: wog-n (prasumably Duhhnwnnecflwygetilupn mufnbacmseDeskPainLnabItmappedpIv gnun. Bm i1um bring new m’: l0 old MacPninI Clip-m ccllcctioum. 1'116 p x o g i n 11m includes a slidc Ihcw kann. Mnldpk Windum (Sort 00 111er: Ire no antun! multiple windom. Zudem geu Iound lhil shonconüng by includhg um: copics ‘o! III: pmgram nuned Dukpaint. Deskpmü und D u m m n: Documenmlon ‘The pnperbeckdocmnenmion is dem und mmplele. Thc nunmal. III beflrting a grnphics pogram. ispmfusely illuslrnnd wixh acohum oftcxt flirtet! by hcndlinu in hold least: high Iighfin; Iha min poinxs.

Step up to high pcrformance.

' ’

flolderthlllwldsthanxlwmldalsohflvelfilsdlo Tln Problems havehnmnblemdoubledickmmelflodeufl This Version is rcwonnbly hat given Ihe mm. Ihem b: movod dixoctly In m:Direction choioc. Liom of DNs. howeva Ihn usc o1aome mols am 711i: would tpeod up III: Ielection pmmss. Fim11b: jerky. espaciafly c switchirxg In Iextmodn nIIJJy. I xcmllablc Iis: of IIll (h:uniu cnnuinod wouldluvcbemnukiwnowifywmh Dtskbruw .95 Zahnnmmnohinüßhnbüofhningmfin- seaudxofscmethfltgyoummtgoflnoughm: ished progzams. Tbcy dld du's originally wilh dasigners categorinüon of m:units I0 discovcr DeskPuim .95, und Ihen mmugh use: fecdback whmnpaniculumüzisnmul. lnslcaclifyou could scroll n lisl o1‘ menmments und dunkle Ibey tefinnd 1h:pungmn und innproved its spoed und scteenhuflliu, DukDnw is 51111 very mach clickonrheotreyou wmmtxenrcheswouldbe an unfmishcd producl. bux 151:: it's prodoocuw fuuerfimiswouldüxenbrixgyauhuunpossibfie hold: much pmmilc. Th: man prmnising { m m comrmion man dm u: nuilnblc. ‘u I11: simplc ability In Im: mm: Iaxt und man Further Cnnvenion Plans Thc mmpmy does plan upgndu wim new puu i: hack in m II pagc layuul. prognm nach a5 uniß bcing nddcd u m11 ß pvopim wgndcx. PueMzkn. flxeyuculsoaduduling mMS-DOS vmiontor II h A Goou Den! DaskPniIu is aminxpmsive. nmI-oopy pnotectod mit! 1989. M! in an. i1i: n vcry intjtussive m). wenn! l0 pmgram. regnrdlm o1’ its summa waryt. (u.Ihn zum. profentonnllydoneandexuuncly aumtnce human huxdling multiplc windowx Ihn righI pccpla. etc.) lhnissüllwall wonhconsidcrixu {er in manglh.

iYes! 1Cbnada

Portable

Computer i Tezeprgone; 1-800-663-1061 Vancauvcr Area: 534-6441 #204 20189, 56th Ave.‚ B.C. ;Lang1ey‚ ‘ VBA 3Y6

‚

Phone or wribe today f o r free Information kit._

"ow that you'vr rompleted your dcsktnp publishing projvct on Ilw I-umputer. what ncxl? O user's Edge provirlvs (waliw uutput for your ÜIPS O Your" choicv nf high resplution unmmnic or Laserwritcr IInIx Pomficmvr Output O Even to ‘film ng-gativeö Your chuice of Macintosh” 0148M“ 0 Your

choice o1fonts O [arge Ubrary’ of softwarc 6 Plan-I something no Computer um give you: scrvivne urith a smile. Call. Ami ge: 112e Edga

*4 Lasefs

662-377

789 Wrsr Fade-r 53.. Suite 830. F6C IE2, Vanmuner, B.C. Fax 681-2300

_TbeCuanII=l{Ipc_r_.-De°qnbn1233 ‘.37

This Data Base Does Graphics

INTERACTIVE COMPUTER TRAINING

PRODUCT: Opus I VersIon 2.0 PUBUSHER: Rnykoro Software 749 Brunswick St. San Fransisoo. CA 94112 (415)

AclL i: a colIn-rian Iargc

ofn-adily atuihbtu linc drawing:

PHODUCT:Am + LottorsGraphIc Oomposor

333-7833

SYSTEM REGIJIREIIENTS: 512K IBM PC orPS/Z.harddriva rncomrnondetLCGiA ECU‘. VGA, orHermIoa; mousu roootramondo-d. run tlrno Window: includod. 5.25‘ disks. PHICE: U.S. S395

Version 1.0

SH unnr m m : pmv...

Tim ACCESS n!

CILÜNIWER

Iuusziuh’ (jung;

984-4671 North Vancouver (ü! the Seabus)

Mvn-TIW" 1-9?" Frx’ ErSa: 1 - 4pm.

BASIC OPERATING SKILLS BUSINESS COMPUTER SKILLS Word Prooessing Data Bases Finandal Spreadsheets

Hands onTraining Set Your Own Pace Set YourOwn Schedule Start Anydme lnstruchor Led Workshops Available

HEAT

Whul Dous I! De? PUBLISHER: Computer Suppon Corp. opu. I u urelationnldumbm nmnirxgundn SYSTEM REOUIREIIENTS: IBM PC. PO Whadows wir]: an Microsoft druwing and AT. compdiblus. 512K RAM and n hnrd environmml. Ihn billu Incl! u:imngrumd “Ihn hypackuwing dick and Microsoh Vwndows 1.04. or higher. Whallhalmcuxsislhuyiw PHCE: U.S. S395 Optional typefams S25 pxogmnforyuuPc". cun creute u vbuulbr Drin-Incl daubase. Focr exauch. amplu. you might Im:u map of Cmada a5 your This sofrwm i5 peu for nm-urdm noeding to opcrinrg atmen. Clickhlg an British Colmnbiu gamma um-ucrivo. professional Images fnr thair Would bring upu Ixrger map o!B.C. Ancthcerclick publicatiom. An: ä Latursdoesmuclyonyotn onVuncuuvu- wcmld bring upamupof Vunmuvcr dtuwing still: u: help you geraume high quulity und thea [zum aber: clicking an an objoct would Irochmcuchungundflyun. Amdxuushflno tamgupyoudnonvuiomsulesoufleuo: Inols for anfing endet. um. sqnma. am. und whee m:bcs: ruuunnu umetc. imtcad pmvidc: u lurge Iibmy of vocIm-baued h I: Hypercumd on u PC? tymhols. ‘fhe synnbol: includ: m:entire oomplcI i5probnbIy beta: duucribed usucombiOpus meznl. cf geomutrio figurcs. und comu wILh an imleud hundbook for quickly locuting Ihu righz nuziondruwlng uflraluliunulduuhuse progrumJt husuomc fcunmssimilnrlolheblucimouhplosymbol. hoffenmcrwummfloosyunbohdcuwlm

grumI-Iypacurdsuchutheubilitymmmlhnk-

Iihutyismlcdwilhobjcctafimledpqahflcsim

cludirxg. oompuun. officu equipncal. xnuuicul inamunems. nmpu. urban Imdscupes. und unutnlnicul drawmgs. II suppons Mimumft Windows Interim: wilh puII-down menus und mousc suppon. Inlporling xymboln I3also vcxy cuy, und ance imponed yvucunmc Arts+beucrxfcdilitlg malt mundifylhanmuvuflcxyofwuys. Youcun chungeunimugc‘: uizu. mußinsluuiLpuiinm

fromormbuckofmomcrobjecnmpit. und chungu Its eolor. Only cigIu smdurd colors an: avuiluble. bat thcy nun bc mixed mman olhcrs. The lud: of freue druwing cupubüidcs I: both Ihr: nopunsgmuutsuaxgrhuuiwumuu. Byluv.

ingouuhcuaolummodifyimugcsüryhwukqx lhims vcry ximplu. an rhe othc: hund Ihcre um

nmus when simple modifncmnns would grculy cnhunce lhedesircd ixnage. Am + Leunrs docs not permit you 1o edit du: supplied symbols or crenz: cuslomiznd a n s . Howcva. you cm export sym— hol! l0 uny Windows puim progrum. edit tham. mfilhmhhglhunbuchßulfllbrcquimsmnla

sepurute puvpun bu pmthsed.

Oflwounxplumuurwelhurdwpoymluchu

grid system und camnot neu low-resolulion 5 c m : und bit-maps. bul cun Import mose Images [ m m olhcr progrums. II i: also very ulow.

FIIu Import/Export

Anu+ LenetscuninxponUFIäWMFWViniuw:

EPSHPICLMiavuoftPumI. ASCILmdDiaFIPWZMOHB.unditcmcxpon EPS.WMFmd

CGM fllcs. I: ukeu full udvmuge of rhu Windows

clipbourrd. und PugeMnkcr und Venmru Publisha

cun imponiu fiIusdirecdyhwludmgunon-scroen reptcsmmlion of zhu innige.

Type Rundung

HEWLETT F" PACKARD

HEATH/ZENITH COMPUTER CENTHE 3058 Knngswuy. Vancnuvm. B C. VSR 5J? M504) 437-7626

Thgxogxunpmvxdnuatencdiwnhnknytm

impnnßcflwxtbbcbofiqatosooochumm ‘Thu program nun u-‚au und graphics 1h: nme. Thiu ullows you l0 uuc Ihc cditing tooIs wmodify i: in u ximflur manncr In modifying symbols. Typafuccs cm b: rotuwd. fillad wilh u vurioly uf pmcnu und gruy Ionen. und oullhud or rovorscxl You cm blow up m“. lhickm Iines. c u m drop shhdows. und Mp5:du spacing bClWOGI chducBIS.

The Missing Fmm Hure Ihe pacluuing of (h:program i5 u liule on

Ihn fuzzy sIdu. On fast cxuminuion it appeured Ihut I Ing: vuriery offunls wer: includued. In fast. naostof Ihem must b: pumhased aepumly

Conduslon

Amabenasis mcuxytousaflexiblcpackuge

53 Tlu: CompuIetIPapa

Dccembut 1988

AUTHOHIZED DEALER

o! mudy to m: cIip unwiu: bonu: fonu included. I1is reasonubly pricud for what i5includod. H’you uru not much of un Ulill und cm only afford a n : druwing pmgram. Am + Lauer: i; u good choicc.

in; muongorobjucuwhichwhaxdounblgcücked dispiuyduultisrmhowevuusctmplclzn pxogrumming cnvironmenl n: Hypucard. itself 1o duubuue fimctiom. In many ways iI. i: simpler 1o usc lhln Hypercard. m: requirirlg u: exmnsivo an Lnndmunding o! programnfing. I! Im: u bcrm m ofdalubusc fumions immudiutuIy uvailablc umHypercard Hypczcuzd uflows prostumm: 1o nach omside o! ü: pzognm und nunmal ouupmgnums Ihrough lhc um: of X communnhopuslwillnm ullowthistypeofpzogxunu ming. In adxfilim. Opus I uns objoct orimlad gruphics versus Hype-rcarql’;bit nmppod gruphics. I: i: probuhly man: cbucly mmpurublc t0 unolbcr Mucirlnnnh duubusc cullgd Buuinnus Filcvision. LulbutmtleasLHypcrcndiuüeuwhichhls ullowoditun beoomeusmxdudwuyucfisn-itnn dato on In: Mucmrosh. whacus Opus I i: S395. Ilow Good u Drawlng Progrum Docs I! Huve? Tha druwing cnvimnmnnl In Opus I i: quiu: mphisricnled. II ullows you to druw Ihn: sunduxd vnriely o! polygum, circlus. squares. roundcd rccungla und ellipscs. In uddition i! has n frechnaddnving Iool. Youcmmnlß. machamve mdupücdeobjucß. Effocuumcurxrxolbeuchhvud fmm wilhirx Opusmuy be imporlad fmm olhur Window: üuwing progmmu lhrcugh du Clipboard. Thc pmgrm has eigh: lcvcl: of zoom. xi: in und twu cutfmm 100%. Chbcconlpluht uguiml fhmliathnulltheloolsfwckzwinghnuwbu

uccessadfromnhuruaxubnnkdoumthaveu visnümolboxonmuscxeenwifichhnbecmnu

slmdard will: moulchnwirlgpnckugclflrhismnuru m a n mding und hunüng uround {er thc dcsired tooln. To summarizc. i: is u Gnom: drawixzg packuge but mthing l0 mit: homu about. Haw About Data Halm‘! Thc dmhuo imludu m:uundurd search und sclectim fimctiorxsmedmkxcuturemrdsthul man puniculur critcriu. Th: outsunding feamrc of the pruxrlm. in m: you run uIno gruphicully display thc uelectnd infommüm in your druwing u: m11. so um: gnphics assisncd w 1h: selectad reomdu mny bchighlighlnd. or hiddcn [tum view. Whut A r : Tbe File Llmltullons?

Euchfilucuncouxunnupm Iqowrecordswilh u muimum o! 100 Geld: per muwing 5k. Thc muximum munter ot‘ chuucnm per m: Gold in 1023und itwill munageuplu l5 decimul placusin

numeric ficldu. Druwingsiiwu In‘limilodto 16.5" by 165'012 cm X 42 cm)‘ In It l-‘or ‘l'on? IIyou uru Inthcmnrkct foruduubucmznuga andyouhuvcusimatim whidlwouldbemhuncad by u visunI uppruuch, comtidcr Opus I. I: doc: uII thc buicu ol’ du:mnnngcmmn wcll. I n : an usy— to-lenm appouch mprogrumnmg. with theudfiod bonus o1’ lyirlx your data w a visuul Immun. ‘comeay ofConnrrUniLr

‘EEMPIRE COMPUTER Items Sold Over Our 4m Year in Operation

35,600 Computer

CSM MANAGEMENT 8cCONSULTING INC.

CORPORATE ACCOUNT DIVISION Pensum; 3 MONTHS (90 DAYSUERMS FÜR QUAUFIED CORPORATE ACCOUNTS AND CQSSULTANTS RESELLERS: BUY FROM USk HELP YOUR CASH FLOW!

SPCC-Tial ChTi-SÜTIHS ShOPPiDS HOUTS Open t0 9 pm wednesdays‘ nmfidays 3nd Ffidays

There nre Iots of Computer Accessories und great gift items t0 choosc from in om- new showroom.

“x330

FREE ESTIMATE!

System ( l 0 MHz)

286 AT Compuu Computer Procemor --—------"m-«Innl 811286 Miaoproccsaor RAM----—---—v—--—-———-—64OKRAM hknmry m B a d Mentor): Expmsionm-m-Expflabb I0 4 MB on Bald 13-3)

Eüancod Keybocu (101 kcys) man ‘ e s Amba. PR 1012um“

-Time mm Clock/CnIendnr---—--—Banery Bank-Up (2-8 Bit. 6-16 Bit) Expansion Slots ------- - - - - 8 am 11er ---------—--—-NälLou Iler C Harem! l

‚R

""'""""""Sl588 (Regular

mm5 pi“,............. - „um? „ m ? Half Heigm Stange. Device Bays Swing: Bays --1-pam1|c|

—-—3

g in -Medicu1 Smicc Automation Naworks Desktop Pubüahhug Cusnonzjntion. Lncnl

X11 System /-20 MB/ Printer Package

AT System! 40 MB/ EGA/ 24 Pin Printer AT Computer ( l 2 MHz)

9 “ ““ m ”M“

Spezi:

AT Package Deal

ROM - - - - - — - - - - - - - Ä W I I Ü ROM

- @

' Machlne

DBkDIive---——Tcac Lzwmnoppyoaxorivc VsgCatd ------------«EGA Color Gzaphics Video cm Keyboard --------—-—--—-AT Style Enhmmed. 101 K Basic sonwm------------------m-MS DOS Version 4.0 und Front Pancl -------------"Reset ä Turbo Swilchcs and Keyloclt Optional ------------------"B0287 1und1 Co-Prooessol‘

Prc-Order Säle

---------- (368018? 1150)

40 Megabyte Hart! Disk

um: Dnsk -————-—--—--«-——hfim'scrihc 3650 HD (v2Heino

EGA Color Monitor Mumor--—---------——---—-hfiIIi-Miaoß’ackmfl Beil EGA Color

“wg” mfhmmflx

Cerfificate Gct yourFREE 5100 cmCenificntc from FREE

35°")

NEC 24 h“ P"m91"

us in cxchangc for this Coupon, (only 100

-"‘-"""”“°°°"“°'NEC 722m “ m ”24 H" ---------------"170cvs/Wl modc. 55 am! NLQ M040 Speer!

Coupons oflcmd,

Font --------------------—--6 Fonts Available „Bunt-Ja nun/Pan Traclor Pnper Hnndling

Nam“

Auwnmic Sheet Focdcr Interface ------------------—-Parallcl Centronics. Serial opuonnl Buffa--———«——-—-—-----——«—8l( Interna! Buffcr

Pbone:

firsl come , first scrvcd) in Person a; 3031 Main s; only.

P1111531

----

man: ---------------------"-80column widc

.........

Adams“

--------------s29ss (Regularssoss) COMPUTER CLASSES 1. Dm an: (dBaseIlI Phn) 2. Spmadslwcts

.(I..oms123)

COMPUTER RENTALS

XT System ......S49/Week AT System ......S79/week

i‘mflmfiäfifm

wmm’

S. Chinese Word Pmcessmg (China Star) 6. Accouming Packages Analysis

(Ask for monthly discoum rate)

(ACCPAC. Redford. Newvicws)

HEADQUARTERS: SHOWROOM 3031 Main Street. Vnncouwr, 1C.

vsr aus

SALES:

874-158

872- 1668

CONSULTING: 379,416;

;

BRANCH: SERVICE DEFT. 4168 Main 51m!-

Vancouver. ILC V5" 3"

The Pacific Rim Computer & Communications Show mNovunbullalvncmwahxliuvaynwnooapmuflxofl. Pacific Rirn Compan- und Commmicnions Show. Whfle

mallmrelnüomhmroComdcx in mvegu, izhulblscfcxcixing ncwptoducumdisphyJ-fighlighnoflhnshnwimlndudmimpassive 8.000 squam foot booth fmm Toshibn complcn wir}:

mingcmmdgymnnsticslwnmNEChndapupuIrboomwimn hostofoornpumxmnowh. Lnptopswucinnbuuzdmcenmulyof

wnmllreprucmadbyßduncn‘; lnfomnx mdCaInpmerCon-

nection Ihough a few show visimra complnixrod ahout a lach of lowerumdMacintosh producu. Color lnsuprinun wem an dilplly

bolhubtfmmxlndQMfsboothsCmttpumComncdmhadcvm dnggad in ancw Lfnorype L200 Iügh resoluüun pboumpeacuu. Infomu demunnrmd rhe vcmtfliry of du: Machmm with a cunpluüComnclworkimlnxängnVAxmininnmpxwinthcir

mboouuomalapmmvuflmsinchuadsmymfinon. booth. MnrsushimlndlinhndDCtTheKorennounfingenthxchxdnddis— flnflmöaywuabitotawipcoulforüncMedical Schwur: uibunors ofLuer undsnnnsmq. Amndcan oompuwmuuzfnctmm Vandnn uctionu doclnm stayed Iwqy in drova. hpoved ätlndndhnilhxuflklfilnoficefilyflnfllhooflibyßhfi lacnnduxoavaflunldlfeclhglfilamsybafljnufiflodmefir

mostolflncmninxs wer: wld 011L Hcsaid Lherewas ngouddanlof inlual in Nemorking und Desktop Publishing. Show orgmiznrflelcxw [nassemofTracml said du: Ihn: wer: inemea o! 11.000mmdccs. Hopes had been high Ihn.Lhe tum out would Im: bun comidcznhly man: Ihm Inst ycuz. In fact lhe numben wereßvary similu: l0 las: year's mnndnnxx. Mmy blamod ltieniny wurha‘ lndlimilcddownnownprfingfordnltklufla’ slnwing. Man verndox: howcvar. seumd plensed wilh m:show. ’I'hcCompum- Paperdidaquickpoll nmendofüexhawlo 11m2:Itqmflsö follow. qusfioxl du: WouThe-Cozupuu Papa boorh hadngoodlimn. managoduo give awnyinexoessof 10.000oopiu ofourpapa In tmslmwflsnuw visixua andgot achance In meet mm: ofthe peoplc who read au:

Locnl oompatible mmufncurm Comwx. DPS. lPC und MDS wmflnu-alnfmomouttndununstrutcmrhmzhiflnpownudam eosteficcdvchnxdwuc. fluhighuxdofAmlcäoauwmlinqlheMuainmshflmiu

empemcwimnewoonmnmdsomalles. ‘Thoshow was co-spuwurwbyQPSJhCmndianInfonmfion

Pmoasingsocietywbwlmlflflutemhmnünshcukaoudin; u: 0m o!’ 2h: orgmizm. John Blochvcfl of Dougln Collegn,

wanzultlr-Afivfyvwümuwmfllywocfitcd» Kinn Singt: [Guln Editor

Jtrome Lim

San Oben

Paul Yong SEACORP TECHNOLOGY CORPORATION

COMTEX “.4 tot af und nur mquirtes am! an Mdonrondukninw hemmunam. W: wer: Im:mgflpcoplt Jammer wüh nur Mm und w: hopc m umachtend man”

—

COMPUTER USERS GROUP Ol? B.C.

“Internat: und Mandant.”

“Good- whada lotoflc

Dalwn Anal COASTWAY SYSTEM TECHNOLOGY "A (und slmv bemm 01m: unnüI n :a! du unedlen! Huhn: inne. W: ’karge nunlberafdocnrxreadym

Marie A

“W: wen: dlsappolnnd will: m doctm’ nmmuan dacfim da1. Bat tlu wand an! am: da): wen nach bemr."

Klrk Henry QMS

INFOMAX COMPUTERS

l-‘Pranh Olsen

— -

COMPULIT DISTRIBUTORS "Prognsxin now mn w:go kann?"

“W:nur: wrypleasedwiththeamoun: und m quaüly a] du pcople. "

"Absotmly excallcnt."

Mark Cooper COOPER 8.: ASSOCIATES " G n u trauen: appomumy far peopte mzu 1h:am nchnology. w: wer: very cxcimiaboamhc ncwNEC 386 grey mit: lapmps. ”

MULTII.

ium’: u}. BIJan Sanii

CENTR MICRO Computers software f

‘

December Specials Featuring:

llllLASER

51,989

‘

32,995

LASER TUHso XT-I van-x? cognpaubne

LASER

LASER 12a Ex Apple mm:oompafibh

LASER 286-M 13mm Compatibb

Indfly Slflfäd

”°'

Hang Rang’: James: nmmhcnnr, WEG“

“um”

‘

|2 MHz 840K nyillm 1.2 MBam»am

Wä-“M

mz-‚smm. 12‘ unter auch monibr o!

äflfihflmmm m»human nuuuuwhon

„m51-

M5 IIÜÜÜH II NOMIN-

XT-Oflhfilbb

9°"

Optional prinhrmadd 8264 spood

‚'"'„„'‚„‘“’°"‚„°"

""’ “

M m ”

81m0 day orfollowing buolnosa day doflvony I: norrnany avnflnblo. but boa: Ihn Inst minuto rush-plaoo your ordu by

3W.”

Dooombonsacmdneaivoagfltiromuswfihamnlvcbodfißo.

HAT Mlco Logitech z-button Mou“w IPaIntshow EnhmoodKeyboard

oos

A wendete womlng a kann synagurom M“

„„‚„„„

9.„ pundny lt nur “man,” ‘"1’ lind

Pgntors

m‘E

505l 30'001”? OfBushoss

Software compfiflflva

pfid,‘

AFIE

Modems

H_ard Drives '—

Siar Nx1ooo or P nasonlc 1091i

Seagato 80MB for AT

8g99

8799

Ö2“) Imemfl

2m KhssWaHüNmimHIaneonwu vsnzrs Phone 43321256 0m o! Town: 1-800-663-4088

599

‚E;

‘°°

„ u m GAMES

”°"“T""°°" .

=wfiamrzmzmxmxrxrßmsfi"

Thlo Montfl 1

Lisraoonlpuoanomsorsotooumovatmmfiamnma "tmusr isoompüodbyPrmtchaCmalflmdisuibutorof softwuc.

4 5

— 10

3 8

1 2 3

4 5 1

1 2 3 4 5

235 300

2 3

147

9 8 4 6 5

1 2 4 3 6 8 7 9

1 2 3 4

80 B3 23

1 2

102 236

——

5 5 7 8 9

49 185

5 8 6 9

9 10

156 70 5 26B

5 5

1 4

B 7 8

53 38 3

53 5

2 12 3

14 30

2 3

52 94 46

2 3

1 3 2 6

1 2 3 4 5

9 10

1 55

4 5

2 3 4 5

7 B

106 52 149 259 87

112 7B

4?’

255 113 33 49 25 231 17 1 52

226

— 1

3 4 5 1

103 70 43

2 3

301 3 145

- ------- --- -- - - -- - -- -- - -- - - ---- -- -- -- - - ---- ---- -- -- - -- - -- -----

110

1 2 3 4

MONITORE Multlaync II NEC Horns Elodronios 410 Monochrorna Amdek Diamond Scan Aum 1381 o Mitsubishi color 7:12 Analog Amdok 80141-6 EGA Mitsubishi

DISK DFIIVES B STORAGE DEVICES Herdcord 20MB o Plus Dovolopmont v IBM 3-112" Drlve 1.44HB Toshiba IBM Hardcard 40MB Plus Davel. IBM 5-114” Drlve 350K Mitsubishi IBM 20MB 81'225 Kit CMSrSoagato IBM

2 3

ACCESSOFIIES Microsoft Moose Paintbrush Microsoft IBM Logltach Ilouee Logitoch IBM lhsterPIace Kensington IBM Intel 802B? Coproceeeor lntol IBM M8Moose PaIntbruah/Whdowa dtfio-oooft IBM PC Ilouse Wmfliigfllf Pop-Up Mousa Systems IBM SS-II System Statut Gurus Man. IBM. MAC Intel N387 Coprocsaaor Intel TOPS Teleconnector Sun Mi IBM. MAC NSIM 2MB Memory Upgrade Naf. Sornloonduaor MAG

BUSINESS

WordPerIact WordPerIe-ot Corp. AP. IBM. 1-2-3 Lotus IBM dBaae II Plus Ashton-Tate IBM Microsoft Werke Microsoft IBM. MAC Harvard Grapllloa Software Pub. IBM. NT Microsoft Windows Microsoft o IBM Microsoft Word Microsoft IBM, MAC WordPerlect Ada. Statlons Wcrdperfoct Corp. NT PFS:FIrat Clrolce Software Pub. IBM « Multinate Adv. II Ashton-Tato IBM COMMUNICATIONS. SYSTEMS s UTILITIES PC Tools Daluxa Central Polnt IBM. MAC Croestalt IM Crosatalk Commun. IBM . Carbon Copy Plus Meridian Tech. IBM Dlrect Access Delta Technology IBM Fastbeolt Plus v Fllh Generation IBM CIoee-Up Norton- IBM Sldeweye Funk AP. IBM Turbo C o Borland IBM TOPS Natworlt- sun IBM. MAC Srnarterm 240 Psrsoft IBM

HOME s EDUCATION

Print Bhop Brcdorbirnd AP. IBM. MAC Microsoft Leernln D05 Microsoft IBM Typlng Tutor IV imon s Schuster AP. IBM. MAC Print Macher Ptus o Uniaon World AP. IBM Cslendar Creator Plus o Power-Up IBM FIECFIEATION Microsoft Fllght Simulator Microsoft IBM. MAC King's Oueat IVo Biorra On-Lino AP. IBM Wttere In World le C. Sandlogo? o AP. IBM. MAC Mean 18 Ultlmete Golf Accofada AP. IBM. MAC Falcon Spoctrum Hoiobyta IBM. MAC

-- -

3 32 24 25 6 18 16 20 2 17 16

5 3

9 19 13

1 4

22 6

s i

BOABDS. MODEMS G:INTEFIFACES I'ma 2 OCA IBM Smartmodeun 2400 I-Iayos EGA Wender ATI Toch. IBM Baelo EGA Gerd Paradiso Syst. IBM Srnartmodem 1200B o Hayoa IBM

B D

PRINTERS KX-Ptosol Dot Metrlc Panasonic KI-P1524 Dot Matrix Panasonic 150P Inltjat Diconix P2200 Plnwrfter NEC Information Systems 1001124 Dot Matrix Panasonic

3 7

;

6 7

Softsel‘: I-Iot List

2 3 4

I 4 2

2 3

thcllSJrndwotItaoouotricshohrdingCanadaThcsocond

This Last Months Month Monlh on Chan 1 2 91

‘s Hit List

Last Montha on ‘ nth Chan ‘

2 .3

2 3 4

45 12

I2 f

46 24

: 1

i4 3

2 3

iI1

17 11

2 3 4

1 2

4 5

1 2 3 4‘

‘

ga i5 gd

|1 4

I5 . B

GFIAPHICS

Adobe Illustrator 8B Adobe Syst. Mao Graph Plus Miaografx o IBM Cenvaa Danaba Software o Mac CrIcItet Software Cricket Software Mac SuperPeInt Slllcon Bosch Software Mac

-- - -- -- ---- - -

UTILITIES Le Mann Bartel Software IBM PC Tools DeIuxe Central PoInt Software Mac Sultceee FIIth Generation Mac Mlcroeoft Wlnclows Microsoft IBM Macro Assembler Iiflorosoft IBM

EDUCATlONII-IOME Typlng Tutor IV Simon E:Schuster o AP. IBM. Mac Leamlng DOS Microsoft o IBM The Prht Shop Brodarbund AP. IIGS. Mac Where In tIte World Is Cannen Sandiego Blodorbund AP. IBM Bank Street Wrlter Brodorbund AP, IBM

- -

— -

PFIINTERS

PH1D12120CPS DotMatrlx-Roland

20 8

PR111216o CPSDotMstrlx- Roland PFI1215 180 CPB 15" Dot Matrix Roland PR1212A 150 CPSDotMatrht-Roland P9125!) 240 GPS Dot Matrix Roland

12 20 13 2 4

MONITORS V410A 12h. 'I‘l’L Ambar Amdak V242A 12In. Amber 11It Datatraln V252A 12In. MultI-Sync Amber Datatraln D0205 CGA Colour Monitor Datatrain D63538 14" BGB Colour Datatrain

- - ----- -- -- -- - -

BUSINESS Lotus 1-2-3 Lotus Dav. Corp. IBM Microooft Ertoel Microsoft IBM. Mao Microsoft Word o Microsoft IBM. Mac Integrated Accounting Bodford Software IBM SImpIy Accounting Bad. Software Mac Microsoft Werke Microsoft IBM. Mac Fllernalter Plus Nashrabo Syatsms Mac DBeae II Plus Ashton-Tata IBM WorksPIua Spell Lundeon B Assoc. Mac PFS First Cltolce Software Pub. IBM

2 17 1e 8 16 9 12 10 24

----- -- -- -

PEFIIPHERALS

PhoneNet Connector Farallon Computlng Mac Microaolt Mouae Microsoft BM Pro Greppfer orange um APIIE. ncs

B85 Sorge Protector PTI (Datashiaid) MacLInIt Plus Dataviz MacIPC SPECIAL APPLICATIONS Topa Top: v IBM. Mac

Xerox Ventura Publlaher PrometheusNenturo IBM All Charge Cord All Computers IBM FIeady Set G0! Lotrasot Mac PC Blast II Communications Raaaarch Group v IBM

er Gift Ideas.... ließ anficm U.S. am! Canadiannslional dirtribtuors. notellofthosc iuzns will b: ynühorsuggostionsforgiflsboyondfltcmflmoftfte Hotüstmiglttincludcsuohthiztgs aveilablolocl es: ‘belohnt:See LheCompmuCaIondarfon-lamosmdtdcphono rauchen ofalargevaricty ofoontputet oaining mit'm. including: Byte Computors. Onoomso loeaming Castro. Computotiand Folltslone Designs. Tito’ Vunoouvcz Desktop Publixhing Castro and othcrs. Training Videos: Tito Vidou Insulin; Stare (gift carfifroatos availablo) Garne:sei Othcr Software: wid: scloctiom of 3 m s aro avaflabte u mmy nur-es. Sloros with Iltis bestholeofions inoludo MC Micro Cents: (IBM. Mac). Supor Software (All typca). Dopplcr’! (IBM). Frictfllywaro (Commodore. IBM. Apple In. snd Nu-Tok ror (IBM. C-64 1nd Amiga). Shsrcweri Software: Sim Cum Scrvicß und PD-SIG have 300d solecümts cf incxpuuivc powcr FCIFWU. Portable _ enormen: Sao the naxt section ona buyers guido tc Laptops. Computer pplles: Caloon Computer has all kinds ofgoodica t'a- lho pcrxon onyour list wirft a lass „

prima’. Boots: seqomßooksellers‘Bestseller Listen mebackpsge ofthis issucforcm-rcnlpoprln titlcs snd

whcrsyoucqnpickthoatupmlsochockoutllneßookwarehomo.

Computers: Artd o! oourse through out this popu- you will 6nd edvcrfilting for sales und 5 m m o!’ tha Iatoet anqgraatost computas [ e r homc artd omcc. Wlumur au), plane teil die vonder: ifyou m i r dratr ad In Tito Coarpukr Papa. Thcir an whouflow uroknpprevüluyou 10th upmdekhyomoflonoa coeeprrrm abnimmt Tlnonkyou.

‘ITaCmnptnorPapu '_Docunb:1988 n31

‘

IIIIIIIIIIIIKZX

) W3

LTRTET i am sowie» ußsiGIW-i 1-“.- TIW‘

U!convwsuor. rsqunramenäu

-— -—

g ‚oyhyyy

U13: ‘O Üfläk 2312|: 10 Icwr W516 Disk. 'o High mmlw

sm-e ' '35;-

1575 ‘was? amA m . ‘u-‘nncoxxvt-n, B.C. vüJ ‘Pv’?

1mm

{__ I “ ?F”

—ncrcCop-‚-Io-L‘»s-

Hnrd Com 101.056! Twce Hnfrn Copwtn Ihgh üuauw ‘vne

—

| (0041732-4446

THUE NETWORKING POWER! LOCAL AHEA NETWORK INCREDIBLE PRICE BBEAKTHROUGHII

CONSULTATIONO INSTRUCTIONUDESICN

©%@@ g

3124.95 per Computer

Oompluo aystorns ready Ior usor Installation

Mafißwäfl5129.532

nlMART | N T E R N A T | O N A LINC. Box12151 Netson Square ' h c o |umb;a V3"°°W°'‚B ""5 Canada V62 2H2 CALL TODAY 1o onoen

5 W ’"043"--------------m 5 1 ”

Cnmdummissichmwm u: manow. pouangi cunu. 5 m m » F0—22D.......................„51499 P0420.

5mm

S?)

......

1C 1 I15

Ü/„g-„fxßvg

"um

„f

.:':-.'»'_='= .g-»_-.„._=(»

m fl m a fl u m m m

47 w.BROADWAY, vmoouvm. B.C. Oper-Sundnv 1 -sp.m.

874-7147

m-m-www

. .

Motherboard “am 80286-10 CPU 640K D‚R AM . . ‘ 1-2 MB D11" Panmfflc H999)’ o 40 MBHard D1sk Dnvc (40 ms or Icss) 450 K33“ dann rang-c, m, Haxd Disk/Floppy Disk ControllcrCard 2 scrial and 2 parallel pons

---

Monochronxc Graphics Card ‚ P u b ” 3°“P5 12725 " m " ' AT Enhaßcüd Keybmrd 0 220 Watt CSA Approved Power Supply BTC Fan fix m“ 1 m: parts and labour wannnty

„e

' ; - .

SK-‘xfv, r.„.‚'‚.,

:_ ___‚.j.mü‚}b\

'°‘-";.

“‘

Spedalist in servicing oomputers Add-on urds und peripherah On-site nervioe provided Fast Tumaround 11m:

ROLAND DATATRAIN r"'v u couwm m a n summa: Aocsssomss

smsune

H39 E- HASUNGS STRE ET VANCOUVER B.C. VÖA I53 T5l1 253 -2070 ‘n’

2?.

jä

148.00

zzgesmelgnnuren

necpszoopnunrenää'äiä}{iä{äwwmm

“

24 plns. 23s GPS. 50K buflor ...‚.........s7se.oo

Wwmm-

P5323 ägTäoRfm K er 5980.00 2'450 pins, .....s7so.oo Fwrrsu oL-34oo PRINTER: PANASONIC Kx-Pwaoi PHJNTER:„„ 525cm CITIZEN 100D PRINTEFI 5 2 6 8 . 0 0 M Pdmm Priood Mm cnble

‘2:5;

"ä? ‚.715

BONUS SPECIALS LOGITECH HAND-HELD SCANNERM 5350.00

MAClNTäl-I OWNERSI F M‘°“"°"" Fxternal H"'d n' i"°°'

„

aus

1-‘:

Omninat Computers pmsents the DATAVUE I'ma of

ponablooompmam; Forpricsunsitiw buyorsJhorols m.g bsp„kru_ n“nun;amlho foatqros und power

3323:3???‚Üfläigääaäffä532116932

' Mist man; digpm' du“ „ m “ pmc„„‚(4‘ 77%,; 52:2:

.752”? Socket.

|(|21ä8:'7°:o‘:°E1023?!

MS-DOS, usor manual. ACadaptor/ rechnrger.

MAcpLy 43 MB (40 m3)

. _ Fa: m m 5 Inrm5 box. I

Bucinoaa Hours: Monday-Snlurday 10-6 PM, Sunday12—5 PM

;

-’f .3:

"Ü 15

läufig?”m°‘}“‘.‚....“.“...‘ä '

i2:

351m5

5° M3 (23 m’) 65 MB(40_ms)

pcn Scvcn Days a Wcck omumET COMPUTER LTD_

32 Thn: Connpuzer Papa o Docamber 198.87

251-7394 FAX: v 251-6825

15MB RAM

386 _16 MHZ

v " "

---

WE SERVICE WHAT WE SELL

ceumomcs PAGEPRtNTER a am»;

1 MBRAM eoM6 um Dm.1.2 m; Floppy

Drivc. Sarial/Parallal Pon, TTL Monitor. Enhanood Keyboa’ d. 220 wan Pm" s"w" ..‚...... . „ __'‚__‚_‚_.___.‚:..‚. .. 3h Q, f, _„__;‚_:_-...

‘

-m.

3eU3’...am

898.00

Bus Monte

399.00 1200 Bund Interna! Modem 3.5.1 1o um XTurbo w/uonstoremmoo 31390.00 um. 12 um A m i » 3990.00 B330 W/Honltor Human: cm Roland 211-10121111: hinter

am am. NEC Lc-aoo 35 resident 10m3 Postscript HPLASERJET senaa n. 39m,512K 52523.00

1 am!„ssasoo monibv a. Padard au: Paradn VGA P|us cm Monitor I: Tuning Multisync 80287-20 Mnlh oo-ptooaaor ....... wenn Mam oo-ptuwsoor

Iafltoch C7 sah!I

spEcmLs

tlo

CHRISTMAS SPECIAL

Lase, primeß

OMMI 286 AT o DTK

IQINIISR

SPECW-

CHRISTMAS SPECIALS

vcjx11=twww<

Eä2:i'ei'-’J'Ä'*:-'—'-"1"’?-':-’fää

sultable tot all Pc compatlblo oomputers Uoor groups o! 6 eomputora or lass Slum aus. Pmflrlns. pnnw: 30 day monoy back guaramoo

681-9087

1'...

w”

c u m }“

m”

355"

‚

pncos am rar cash sah: am): «

.«..—-.v----

‚'51!

vr-Avvv-gtzf‘

372a Main s... Vancouver vsv 3N?

„

...........

The

‚

„

Bt Desktop

Publishers in B.C.? The Colour otl’ Blank Design Cannes: The Colour o1‘ Blank showcasad zhe «miss und Ihn winncn uf 1h: 1988 V Ü A Awrds. Pmsfllxcd by (h:Vmmuva‘ Elacuonic Publishing Associatim (VEPA), inwas cmaxhibil dixrixmg Ihn DESIGN VANCOUVER 5 c m all ovew lhocity during Ocmber21m3QLocamd uthoVmoouvezTmdnumCmvauionCum. Cmisc Ship Terminal Level. The Colmar d

Blank wuopmm thapublicfiomücbbufl In 28. Sponsoren‘! by Adobe Systcnn Iran. LeIruet Graphit Dcsign Schwan. und Quark Inc.‚ orgmized by Muion Mumm. mmlbw uf VEPA Bon-d. und wund by Tom Griff. 1h: cxlufilim wu vcry suocamftll. Mnralhan 1600 visitcrs vizwcd 1h: gnllery dming the wach. A müde vlriety of warl: was displuyed. Exhibit lahels cxpluixiud nll die mm5 rools: software. lmrdwoxemuloutpuLThcwixmmrmged 110m broldsheets. disk Iubcls, xmiutury packnges, wedding invixaxion mies mm m hoch-work ürndy in die oollection of ab: Nntionnl Gallcry cf Cuudn. Surprisixxgly. 83% m’ the I80 ennies wm

madeusingflxelfispplchdncimmnflnlyiäoutof Ihe 25 winnms was produced on DOS ma-

chinns. The Mncimosh dasigners uscd softwm in xhe followlng proponions: 54% with Adobe Illustrator: 43% with Aldus PngcMnkc; 20% using Aldus Freeflaizd. und; 11% using Quark Xpvtss. 01' 1h: DOS-devcloped deslgu: 63% used

xctoxVcnnunPublisl-xrnvhilaiisßia uwdAldus

- 7 \

.—.

......

. . - .

. . . . . . .

Bahnen Graphit Supplles. 681-7351, PowerPoint, Vasion 2.0 b) Micrmqji. plus Follutom Design. . (604) 886-44502. Gridnukzr for the

Brinumhkidga logo. Prizn: QuickSet Grgphlcs. 685-2777, 10 lencr-siu Lmotype

hiazintnsh.

°The Vgnoouva DcslnopPublishingCennPatry ‘Caflwfin: Raume. 608531161’: smüonury, buxinus designer: Broulshoct. Priu: Soume und m11 Data Initial. Ready Set G0. um, 687-7044 und Shrlhig Mlcro -W=ndy Szcphuuon. designet: 1987 pcrsunnl System}, Scannen und J Pacht, 681-2981. 575 I n f o m n x ü o m p u t e r a fi s s - uownrdqanewonechargodlaserprümmm 0696. und Club Canada. MacDraw II. canridgb. -KcilhMlnin.designettToucheRossalmufiputy -Praxis pasign ä Comunaüon, Bob Gibson. doinvizamLPrizxlnfmnax Computers. 688-0696. | ‘Design Vuncouvcr’ prognm. Prinz: und Clnrh Cmada. MacPainr 2.0 und Abnmn Source Products, 687-7044. Am A’: unter: ' . Technology. 685-7343. ProPolnz optical nach C hol] for 1h:Mucinuah. vKciLhllIln-fin. dulgnu: ‘Urhansubjectfpuumo-The VmcouvezDcxhopPuhlishlngCerlm Party 15m1 man: md exhlbition guidc. mm: Osbomc. desipm: ‘Quomim: fmm Chairman . wenn!!! Canadn, 688-9811. Mio-rosa]!PowerZahn‘ lxoadshoet. Prizc: Saunabau Products. Point. ihn-säen 2.0. 687-7044. Xerox Vcnlura Pubünhcr Profssrianal -Keilh Mann. dcaiymr: ‘Advent: Pracfices’ Ecwuiom mnarinl andguida. Prima: Supnme «Georgs Sandwich & Axiom, George Strand- Graphßs, 585-7313. S100 wonh o!’ Linormnic

outpm u: (ihn er repto plpur. Orgnnlzcr’: Choke:

vTouchc Rosa. Peter Prmccs. dasigxiar: Survey results bookld. Prize: Altartut Converslous, 732-1416. S100 wunh o1’ madia convmion o: Linouorxic 300 ouzpuL Orznnlzer’: HonornrimnfPriu: -Tom Grafi’ Exhihifiuns, CIIIIIDI’. Priza: San an Lnser Services, 685-2737. rammufacnre of wo Laser print: 1mm:criridges.

‘IhmAn Suppliu, (416) 363-6156. ü!)sheus of Luamdge P10 lud: plpcr. plus A1115 Carbon 8 Illbbom Western LIJIL, 251-3115. 3 boxas 01'317?" floppy discs.

Ihrlon I l m r o was wen!producor lor 171a Golor cf Blank. Sho i5also Anlclo Goordlnntor ior the Vanccuvor Electronlc Publlshlng Assoziation‘: publlcatlon Mlcropago. Sho can bo reachod a:224-6152

IIlÄII'|IIAF\FI' IIVII"I"\\J I ISOFTWARE INTEGRATED MANAGEMENT SYSTEM FOR PRODUCTION DISTRIBUTION AND ACCOUNTING CONTROL Bin ol MEIIGIIHIS

Accounts Fiecenvabie

PugeMuku.

And The Winncrs Atem. Grund Wlnnars:

Workin

. vGinnpn TEXIWITE. Jim Rimmer. Bmadsheex Incl disl: label. Prima AlamPagcMalcr 3.0for 11|:Macintosh. -Tom Gruft Exhibiüons. Tom Grnfl. designar: Galibo bookwork. Priu: Aldus. Aldus Freal-lmd plus Silioonnectimu Buch, 222-2221. S50 31h of boolrs. asmdiaAllsom Dnloshnozuon. riesige-Niedding Inviufim sei-in. PrizmLlnotype CnnadgZZZ-Olmüßowrfi: of unotypc ouqaut. Keim Maxfin. dasigncr. ‘Mlcfzlnl: Pemock‘ mfianaryfriznzhilcmolt Cannda.688-9811‚ Mbamß Word. Version 4.0 Wlnncru: vTom Gnff Exhihlflons. Tom (hart. desigmr “m: mpmez. D'l'P typa hmadsheets. Prize: Advtnlage Cumpuhrl.430-3113. Apple PersonaIModanplm Saure: DnhPmücis. 6877014. Xerax Vmzura Publirhar, Varsion 2.0. °Keilh Martin. dcsimcr: ‘Smirich’ nazlonnry

’

pnckaga. Prima: Llnotype Cnnnda. 222-0166. 52.50 wonh of Linotypc ouqan. Sludio Allman. Keil}: Mafia/Da}: Sinnvoll. daaigxias: Talenommunicafimß trockne. Prima: Copyco. 684-3655. 5200 wenn o1’ linoumüc 1.100 Ouxpuzor Canon Colmar lasetcopios. vKciLhMu-tin. duignu: ‘Anery’. anumperiodiccl. Prize: 81v: an Laser Services. 6852737, xcmmufacnnc of two Im:ptintu was canxidgcs. -Kei1h Martin. duipu: Wedding Imouneomem. Prima: wenn Cmnputcrl. 688-0696. S300 wenn of QMS Colouzscript Pculsaipt printing suvlcas. Honorahle Mcntlon: IPower Station. Jim Inwe. desigmz: Geugia Mahl-Dental Buflding poswr. Hin: Aldus. Aldu: PagcMakar 3 .0for tha IBM. -Kei|h Martin. duigner: ‘Sylvm’ stltionary. packnging lnbels und btoclnuo. Prima: Busi-

nessPlcmre-sd: Wordx. 688-5468. szsüwonh o1’ Canon Colou: Laser Ccpics. oVentuze Ccmmmücatimu Inc..Gnu-g: Pytlik. dcsigncr: ‘Compufind’ stationary. Prize: La-

ser’sEdgt-.662-3774.S200 wonhofuxiouonlc outpur (paper er 61m). -Torn Grnff Exhibidons. Tom Graff. desipiez: AnnuIJ lilcrxy Journal. UBC. AM5. Prize:

Progress

Nel Requ:emenls

Plaming

PRODUCTION

DISTRIBUTION

General

“SINGLE USER”

L959”

Fnamial Report

Accounts Payzible

“MULTI USER”

Wnter

Assels Register

5 ACCOUNTING

nvnnna Ü Ö P K Ü "n- mi

—

j nvs mIr'1'\\r‚.\1<I-: '|i<;)1„>.=\\"

Suite 1205 1166 AIbemi Strcet, Vancouver, 13c. V6E 323 Telephone: (606) 681-6447 Fax: (604) 682-0698 VANCOUVER v WINNIPEG I0TORONTO SEATTLE 0 LOS ANGELES flwCmipuler Paper

0602120361988 '33

J&.—...’__..-..

...‚..._%...—..>....;...w----'--...._

\ .—

L:\

Now Software Program Helps 'l‘ake Architects From Concepts To Final Drawings

Ü f } I T"; Ü‘Ü5. Phi‘)?! In the greal battle for the reagiert-a eye. the fi m

objcclive i5 t0 bc wen. Becamfie if you're not Seen, ynu re n0! rund. And i! you're not read... Yuu'rr dead!

BE'I'TER

L__Group Designs pruvides flucht 115e of (iesktop puhhshing und

READ THAN DEAD.

Computer graphim

lechnology In bring your words ä: ideas t0 the

nmssn m croative and affordablc ways. l

i’

LK-nrrigflu JOKH‘. Dm: rleimua, ürr-Mrnw. WJHuun +0.: Asmcmmx

Advcrtisingä:

Marketing Cuncepts

‘ü’

Document Design

and Pmduction Makc your nex! profecr better rrud!

_ Group Designs

3737 Angus Dr.

Vancouver, BL‘.

V6] 4H6 %

734-3594 a

Commodore 5:;ä ‘ ; 5E 5g

AMIGA

EXPANDAB E, COMPATABLE, UNIVIATCHABLE The Amiga 2000 has the capability to grow with your needs. A3 a front llne number cruncher. as a desk-top

publishing stalion that can give you professional four-colour as a graphncs tool for your an development, or as a Video und stlde production tool. with 4096 colours und Stereo sound. Expand extefnal memory up 1o 9 MB, add on a board for XT compatability. There are a variety of hard disk options as weil. The Amiga 2000 i5 the

separatlorxs.

microcomputer that meets your

needs. and surpasses your expectationa. Umü you've sann the Amiga 2000. you haven't really boen computing.

57-7105? QFWP«E€VH'“”"I'Ä‘!F'FK

Dom. I.|.L'.

LnEIIJ ‘

€ — u — hat: M0052: 3mm

all?

‘Ph Archiven und TIM Computcr pefiu cf a pojccu plans. secliom. clcvations und Pnncipah ofmmy uchinctnnl finm an mw qumlirles. In Mac Archiuiun. man fnnn und fncing mew decision-nukmg quandmy—zhould Unsinn: frnm a single dnubase. thbyjohlhccomwnuwaßlnlfllhftgfl Bufll In V Qposwroufimoo npplicuionofthocomwmu In 1h: 3D modulo. you am luavu au mach | man aid h: bnn n significut dwalopmax: tolmpnrüstic inmvnguamsmmeimddstqcx Ib h: kannumhin;(a Iheuahg)In nahe ptnfimflivcnmvmfkmorc inlnidvcly; orplnoe n nujof bruhhmugh inlo Idütocturll pncfioe a1] elcrnenrs a: prcciuly u you ahnen. You cm fonom: tima. Such a mjorbnakduough would man: your ownlihmyofwixxdomunddoorsou gobcyondünmhwdlyofmmusimuvmlecn use pre-duigned onap-install au: in ehe 3D Who llrudy use compuun. l0 I simuliert in modul: 1nd irs clcvulion. plm. und Iccüonappeu Which compuut-aidod uchiucmral dann i: in immun-im views insunfly. Adyxmnic nonregudod u commonplnee.” Einen yem 1ms, omeuic vicw of your wen: is availuble a: my with thc micrococnptnlct quält "cnntmmplace". insunL Youcm movc nonmdyom projoctnnreal panupswc luvemched thcpoixloflhruk- 3D; wenn‘: cyc l0 hird‘: cy: und nll nround. h Mcrcover, Mac Axchilrion givcs you um hiddan A: SoftDrnw Computirxg. wo stuwd off by Iixwrunovnl inpexspccüvc. axommctric rudimumhin; nur um entrinnen-lädst! dahin; und meträcvicvm. urith rau] oontmlove: picmrc-plme. dann soflwul romines an In Apple II-it was mnnn point und umera 1cm. quhe ajoy whanmcotfldactuallydraw Apul- 2D Modul: cimlc nmadgeoflhcnauenwiflnommcom‘I'M 2D modulo hns n11 m:sundard nhfüng Pub: "cruhlng" (m: udmscal totm. for thosn mnhandprucechnuthaxucnnihbleonmux Wbcuqwuvrifitunhag-fiaflclbphfmCAD progrunu-singh-‚uad dm.) Howfiuuhaveduulgedhlcss Ihm: goodmicrooonxpuur er auromaüc dimmsiorfing. mmull lines. panllcl danach-Ja: thouofus who nmggled vslianxly Km: chpliatiou by maßen und dlgalicntion Iochvnsinrplacirclflwbowuldpayfinehufiad ooozdhnnte ü’ desired. symmouy. emry pracise thounnd dollars m man for n profcixionnl CAD A: smadnrdgzüfennmsnndpidangmadsoon. whm I0 System?) nodsy mnny compuuaided i! vecwr 1ndbi! Im: bulh wen. mnp puhntchirlg dcsim 1nd drnhing pmgnms an: uvnilnbla n: a un-m-mosl olhn CAD ptognnu have only an: modesl prima. which tun onnluively incxpcnsiva o: u: 0mm. miaooompuux Pub Same Button: & 0m Cum Numhers Mac ArchnrIon-o new conecpt UwQumdfiamoduh iunumexindaucxuncOvct the Im. few yenn SoILDnN im txiod uhles ofdmfinmwu: üontnolmnpmduca mnny ooznputa-nidnd riesig: und dnfting pwo:ovomllqumfity man by design: spnoe annlysls n on Mdxlfrunc gnmI-CADAM computer. nah-elf. You cm obuin plnn neu. volusily Inusgrlthonnminiccurpunnmwcadonnpu- umnn, sutfnoc uns. am! chlrnctefislics oI 3D sann] oompurer. und mmy moro—buz nme of Thema cm b0snvod in formal: suiubl: them acemad to u: lo really be n soludun for elamnms. b: mlysis uxlsmunuy min; antun! sprudIrclibtu. Trey m powerfial 1nd populr. Im: sheet pogrum. somelhin; was (und still in. in ourvicw) mhsing. Seven man]: ago. w: bokcd a: Mac Archi- 1mal U0: irion. Wiminjlanhoußoitxyinginilfeltrighl. In Injunmefusticwwulcsofsalcaoflvlnc Archilrion in Britin}: Colwnbin. a1: ntchilectual finns i: in thmmdüncnsion: conoept snnplo-tlesign wir}: "Noch". mmqaulne Ihm: hlocks (ineina- ufiomhuimdasipfixmhnvebeflmunghlw i115, waching. duplicadng. man“, 1nd so on). Archiuion in thair pracücn. Richard Bolus of Amop Asociatu Architocu und Pllnncn hu insunuy view secüouu. uommetrics. m4 pur cullndh“... die um:inmgmod CAD packngc In: umltlndesigxainrighnthmmnkn specüves Imomnlic two-dimaasionul plms. socüonn. 1nd mhincmlmis nvnilablc auhi: fimc." Hafurthcx elcvnüons fnrtmwmking dnwings. Asanadded canmaaxs um"... man CAD producu an oriborm. i! wen imlndes a “qumüfw” Tor man und unndonlywwaxdaülaprbdlacfimandoftha volumc calculnüm. Mac Axchiuion really ‘nn Monat-MacArchinianncmallyprovcsin vnlue cunflacaoolthnlasdremlfibctdcvclophha inallphuuofl heluh- fimnflteounqxphue her building {mm Lhe oormeptual suges rhmugh und dosign . davelopmml. flimugh to online: l filul cnmuuction dnwing ptoducüon. Flmhnt inicmuicm aboul Mm: Archinimx i: Mac Artmtrlon Inodllns „man: fiom K11Gill atByu: Computers (738‘H: Ihre: müdes Ihn mmprisc Mac Archier Banner Union-mm: u MPnolo 2181) trion m: (6853-6227). vnnlue Computer: ' 31k Duign und Dcvclopnnmt 0 2D: Dnfliag und Delimadm John Lnncuhr ls Maiden o1 SohDraw Qflnflflu’: Qmafily Tlko-off a flrm spocializlng in com‘Phasemodulu und zheir inlerlctims havebcm Oomputlng Inc..tor architncturc. englnaering pmoroonsulling duignod to suhfy Ihn umbuic requixenmu of and oomruction. and in pnesidorll u! Graphnrchimcß und htctior desigmns: tha aoflware davallcTexi Inc.‚ Applicniona A) Ancuy lsd intuitive nwtbod fof designing opor o1 Convadunits". a powcdul unks in I t fl vohuneuic 3D Mm mit In ßailh: oonvorsion program. B) Complcnnnd imtuxxcuordimtionofull u—

101a:

_’

CADSCAN Offers Cost Effective Method of Getting Drawings Into CAD Files |

HowDoYouGetThe Drnwingh? CAD orCounpuln Aided Design offen mmy bamfit: im dahin-s. enginun und ltthilncu.

um 1:5:cunpuly In: ahom 3.11!) naive druninzlvlhidicmnldukaqlnsevmyemlniqzul mnnunfljhUningCADSCANJIn-ncilchkzu Ihny owlddoithtmecmmnthsflflfisnvings cmoflcn mean the diflmme batman-n gctting a 001mm o: notfotmmysmaflerfirmn. Hat-in; Ihcresumcccf CADSCAN m a n Ihn: Lhcy an oompote with mach man fums. Acoording to Mnroail. CADSCAN bis nssemblod ova 5350.000 worth ofequlpunauandmnflcitaoccsnblc mlheircliel»

bmlraininzpeoplcinCADpochgcsiscxpuuive und time nxxlsunünz. Convcrfing a wmpuur 1o

CADalsoleavusflncptoblnmofwhutodowiflx existing drxwings. II i5 very expansive to input olddnwhxgsbylmndirxaCAbproymtumga puchotpoinfinzdevimoflmdnwhmmlefi onpqaemAßwnnbycoxupmyxfhDscAfl Sexvioeshncaxowoflmardafivelyhexpuuive wgy tohnve exisüng dnwings input mdrmduedintn CAD ttwings.

lila Scanner

They scmmapsordrawmgs using nhugescanner which will man up In "E"width cirawings. ‘Ihednwbgnmismgeicabltmnpfilewhich Inka up in anrmnnu: n i m m t af man. For exampkmlvaugcsiurondmlpndghnukeupcfi-

"Jraining people in CAD packages is expansive and time consuming.."

Bigrnquannuüupofdau

WhnrIABIt-Map? Abitmnpilnfllewhichmapshodisplny naemurpinuroutputuawhsofblnckdots.

oftbcdxl ' ptoocssis goodufloeunaqtxicklmbweverlhm nlwaysroughedgeswhichreqtfin chumnn _ htofilnlimefltedxawingsßcomfiin; w CADSCAN‘: mnrketixlg managen Jcfl

Muceminflmeupzonixmonmmgetm ' opamr xciemnuing Ihescmnhg softWIIC.

Pur Lhencltizaczor designer. using CADSCAN

in the oonvcsim ofdnwin; Io CAD. givu Ihem nheadsmnonüwtediou: ülftin; Indtevisim of

rnore time. CADSCAN clninxs (hat dmey can

CADSOANCCn b0roachnd a1Diacovory Parks 100-3700 Gilmora Way. Burqaby. VSG 4M1 (604) 438-7226

uthillndifimalmeflndflxlnpmduoerumlmh Ihm-In dm: spana. Fot- cxnmple.

._ ‚

A-x-wu-‚e-seuar:

20MHz A1?

80386 CPU, 20MHz 2048K RAM Memory 1.2 MBfloppy disk drive AT Enhanced Keyboard 08/2, NOVELL‚ ready.

16 MHZ AT

80286 CPU, 20MHz 1024K RAM memory 1.2 MBfloppy digk driv ATEnhanced Kqyboard

80286 CPU‚16MHz 1024K RAM memory 1.2 MBfloppy disk drlve AT Enhanced Keyboard

31‚925

ATEnhanced Keyboard

. 1mm.

20 MHZ AT Q

1024K RAM memory 1.2 MBfloppy disk drive

ooslloconvettnoCADofSlfiinzcmnpmyhu aconsidenble discoum finden:volnme automm ungirg up w 25% off {er 5.000 duwings er

Ex-zf x-2a g

CX-386 A

S1‚575

-‚

51925191511:amapflfhcfmenufingorresrornuon 00:1: 540mm. A Iypäcal nchilncnlrll flnocrplm in n“D"sizeddrawin; mighwostiß IDICII. 524 f0! Ihn rocognitima. Slmfwrcslnruionfora tolal

ehngewthneixservieesarotxgmymesmnemm

. 80286 CPU‚12MHz

agenndasjciHedCADpersaxbulitmkesmmh

chuwirlgs.

: 2 :I 9'. EIuMAec-Mdwnuwxwa

12 MHz AT

flroonfasionfrumaiahngdnwiruatoCAD

canbedonhbymmmalmeanswifltaCADpack-

dotswamamemuticalformulnwhichdnfiaesme Iine. hmce fllß mme vecnor or objeet-orietxtod

Holt Mlldl? Prima msemningonly sann S10 {m 111%" simdnwixxg mdrmgcuptoSBS fnrm“E“size druwing. Convmionofdrawings uning Ihaemcognltlon modulo man 395mm fw drnwmgs und

dnwixxgs.

The Opfldu

uwbcuutheompulfyonpxiruonadotmauix pimunitwillltillbfljlsfiibefluzethnisfllfiß plimacmdo. Ifhowever. youprimonnluer puimazocwithaploucnuzlincacmbcveryfim. Bmfuslitmuslwtnrulfledfiunnaaiesofbhck

'l€l'!l!<ll!*!“'*"-“‘-NGE-1’ü2ä:üfi'fimfimi

‘s 3 m m box cm plane differenn müdes diffuent llyen oflhe dmvmg. und cmcvmxqoomizelutufitruulamlhnpocflon "

CADS

nur band 111e.

0EX-286

Vecmr drawings an defned by noafllanaticalformula

Mum-uyleredbnwhp

nprdcnlar prima. 111a! in. thebeuertheprüuet.

islinxitedmmuofmescarmeratabomdoodots per inch (dpi). A: Ihis resolutlon mpriming the documm would still hure njnggy lool: m iLThe ncnlslcpislonmllw EI: lhruugludcäcfledrecogaüüm CPU wrilltalzgc rammt: m a n mmmry

‘i’ u}:

capachyfflüsboxhuamcopfifionmndulewhfich cmrecrenmlhelincsofflxcbitmnpfilchmnvec-

Weuelllfnmiliubynowwiflafllejaggadlookof bnmwhidlcolnefiotnmmldolmauixphtmx Thislypeofouqvmislbitmapfileninwafl. Veczot dnwhmgz o: object oriealteddrwüag: cm meomulnndmmtlizninedmdxereeoluümof

8 megabytes o! stonge. This is obviously not pracücal to wotk with, ineddition. Iihe resolution

wie.

Bondwell g

: Speclal features: _ 1200 B/S Modem Turbo Speed 1 Megabyte RAM

. " '

8088 CPU 10 MHz 360K floppy dfive ATKeyboard

Multi-Display Card Amber Monitor MS DOS 3.30 A.

Vancouver 1041 Wust Broadway. Vancotuer, Rlcimmd Omen: #1O 4200 N0. 3 Hoad, Richmond, B

ä‘iä"€I‘i‘iE‘?;E“

276-9588

Edmonton offioo: 13222 118th Avm. Edmonton. Alm.

mcosnm! P9P:

.12?! f3?

u a

VIDEO CAPTUFIE

\RI-.\\ .\Rl; X IILH‘ l)()_\l‚\l\

‚SH |'l

AutoCAD

HHIVIAH ARIC

T711’: sectiott i:

a r e

For Greoter Volue SCHUH! 5cm I'ma-d Z Ü Q W I W I I I! I?‘ 5in0 nmuoanmuuwn PJMILULÜHJI). hat";Fumruitlümllühlh m a n 9 m m Pnolunv.nmuputm: Rnuovun. Ut-HALO Im u nun. man. man. m: amHeumann mfllhnng m01. D05 i‘ L FC-JIIJAY. Moodrm OCR Snnnmecpacw antun-t ypnnu amLau plnu u. mdvbtnm hyw nuapac... u;

am muwdaWHuh-nmncnnnifbwcunnnnnagzuwmupm Kapital”! utnusdm. um.Pc-ITIAY. Vldoocma muptulbno gnwiu Inau a W.Mammut uny m: Immun vim um Cm unmqnttut tun habt 16mm! Cum: ‚im uuqmhvn n bunt anp, und an III-taugt. a unlaut- cm1. itcAm-„wtwnm navuasutwtuxtmfiu man. muomsanmnwq-an attraupangnvitm tückaanumawsn ‚ fi x

R.P. ELECTRONIC COMPONENTS 2113 Westnukve, Van, BC. VISKIN‘!

— Chmnnqulfl

BUSI -m: -

Es: M: 0193

GAMES m— Oma-Jux -11x30mm h-Ihinsov-akrouxum 5C: BOARD (JAMES|2 hhnwoiggmhllo,

RC3 030- IPOIITSGAIESH

Rqnblbuu-Cdfiy.

Galfnfläcunany A1.au.‘

8C!M0 DATABASE PUILJSDIFR-

Pmu (liquid!m; uuquu an

GRAPH-TEC

C5 U1ISJIO- IRNTAIJI 5h EI

1856-6362

“"5

(pleasa 0:111sollst!) _1 »

Minus to vom naeds Put! dow menus Cnstom 314:");

___

Custcm dtcrwmg set-ups

-Consulfing: Ttme und t m n c y savtnq Idee:

wg‘)

-.'

5&5 O ‘M MANMHA mulHauptmann-n

g—‘j*:::1(fl’/'-—.f.

-m a vn :

p q u t n6

scs am

Inhalt

CAD

wtth cther progtmns

-On 111e answer:

5c:anttn-Luvttntontm Fauna-M GIAAGA 2-DCAD III «antun-qmm

—

1o vom CAD needs TYGJIung (tndividuat a:gmup)

IlMJM-Clmvfiblümfllfl

34a: u 3m

Cuqhc

Dtdfing sonnen -Dn:tttna ( Q u c h m d

am au: Ion Ihn-In

COMIAUMCATIONS

5G IIIJMJIO- Q-MDDIIH 53T I du! D! -pvpullldl'llllllnnd‘j

{mithin

PRIXEBI 0 TDVII Nbvcmnnlmnnkm wann

5G H.

-COMPUTER

53 CI l COÄWUTHR TUTOR V44 ‘I'ma (haut K‘:n! ( K 5

COMPUTEH

s du u Tutu

cmpu,human,wann".

SCS 09l 005d.A ADA Cahd k ADA Ccqlhn

DATABASES

5€: antun: P C 4 1 1 ;V20 S an u: Dann.hogn- u; DUDCIU AC5 020.37 " l 8EXPNISI V413

Software. _ EE ESIGN FR 111 __‚

c u;

r.--u

3:;-

‚.‚..— I'ma

. -. J

H?” I’! W U I"'—'

‚r

II l! L-stzgnrr III‘ gttca um III-All.‘ I k‘ at U t I"- ‘m: dnllxtl l|t.||t „ttw ItIh-‘I l'|I.‘I.|IHI1I|' dn-nigtt uullnxnc Im. k.|_-_v'c‚ Mm 3.-! IIIII-huIInII-tl l1 I5 Lttnntl |I|II> . ‚ *tlta-I‚||„1I|-„ gJlWHLLfi 4|13|42;Jxgulxthzn. wunnlalinn, NIIITJHIH Int'l .\l.‘v ItIL‘IIIIIf‘f ‘

J;a_|cu_n't'.ttt|.utu|l||t:-_.am! IuII p|>-.I1v|nt'gas|n_-_»‘ fllllgIlttfflu

I I Itt-„unt-r Jan LJQCN „ m : „t

I 3f)5.tt0_

I’

( w

‘u,

|'-I\|'-.tl:._l. ! |\|_\ nc-‚igtt Im. ‘

"55"

Egöägnom

T„‚"‘‚„"""’„c""‘°""‘“" “

‘

- GRAPHCS

IIIIIIJMIMUMFIßTSUIOPGIfiIH ICS 066-

Ihn L h i n u o l i l fl f fl l ß i fl l

Ihn knu an umhin] Ihm. punnh Kann anpmmluuuggq n— a f C142 ON-VERT ( h u r tGnpüis In»: hin/b H-Innuw, hiwhup. Nuwlnnlil. Mama-vom. kann. Dank.

man.

um:

an!

-Homämäes

SÜ I ' l l PC-IJJITO VIIO X von: ‘binär’ U n h - ln

Klima:

H1 um

IG i131 n HIOTOGHAHIHR Cnlwu ‚nur phaa l a l p h a 3a H39 n LUNA’! COOKHOOK

kühn:h u r t

’

«hab:

IM! IH’ T } ! IHNEN! "Ehrung Hncun in man um: IICG 12.27 - IOKTUNH1111.78 VIO Hindu}.% a 1k m! IQ

P H:

011l L X H G S S D Ü Q V214

“spauosassrs l3

159,40 IIXHBSSCALC V31!

005.30 dC-Wlfll ‘I'M " H I N

VIRSIOH"

I ‘gfluwnflfivroüuw-lflfint IG?-CH|WIHER

Wcfiihjuuugggpyg, bIy

fifZZJMJZS-EUCIMAOIC IIypuI-nwmpuunwfmnd

wüwü-Ufiu-tsaust Aulgxflnwss

äem-ssstuvm mhiwuuü‘

T“‘°""ß”“

Tfifllflfittlflflmfl?” — twmn .‘i'a‘f.'.""' 1

‚

"wfi‚:|:‘m’

“'IW-°"-‘“:5:°MMCTER3 "‘"-"'I' """‘°°"'—_

'„”“‚Am

zß’_nwul_„mumb_

“WEM

SG"I_HG‘OA‘B’"

nunmal-ankam

:‘ä::7_fl"MJ-T_ ---«- *"’“' m“ wctnJmgocsL-avuvm zlin-Cnio-phvqu-onco

gfl-‚hnum gm‘“‘m_m*m7""'3““

SLSCNS-WQIWRITEI

u: uns

t-‚quu. FARBE‘!!! vno

““"""‘_"""„““""'m"““°“' mämwtcxntfat-ntnmn gamma‘

m-vwwb-w-Mrfi-I PR|CE PER msK

s: t Maä’MmMLN»m‘1“ ‘ '

mflgfffirnms,”

‘fiaxi-‘HÜIWMIÜÜÜÜU ntrodtnctory Spodd

sm-äflnmhnhgic-Sßbhauay,

W35WQ5I?’C-5hdhiü30«m

‘mwäflu-‘uflw SIMCOM Sewkx‘ ‘"- “W039(am) 535.231; o: [tun

wlwttsomßmnfl-

Sqtaamab. BC. VON EGO

(604)89z_555l

DON'T 5E FOOLED BY COHED OH OUTDATED ' DCSKS

D25344?

Now

uke

abruk and slrctch. Whcn youcomc bsck youx youcm | ctuwing i5loldcd. 111mm filling thc screcn. You dcrtfthave u:wnil

In: m:drawixtg t0 show u: thc sczcm In um: cntcring commzmds. Avoid Rege-m 3) Having your drawixtg on thc neuen with I 1in1: spacc amund ü»: cdges man3m: tu pick y-ou: fint wiradow zoom and frorn hexe umin ynu cun use zoom dynamjc for mnst o!’ your moviztg around Lhc sann. ihm reducixtg Lima consuming regcm. I bower VIew-m 4) Ttu bis lhing day: 53cm In b: thnmQusly Iinlc xcgcns. 0m: way to speed up the pmcess i: I.o lnwcr Ihc van-reg. There's u ncw one fot man cf you. The viuwrcs i: JUST AutoCAD’: commmfl f0: setting thc resolution of your sann. AutoCAD‘: dcfaull Lt32K x 32K. a bilmore man yuu hatte. Tht: dcfault senkt; i5 I00. You cm lowu this setting to m; luw u you wmt ü. Theonly I dtawback m m vicwres 1s m:cuctesanaacumdto gclmotcmd I tmxcjugged. Ifyou don't mind thia you cm spsed up thc mgcns by maybc 25%. To sct viewrcs: Type: VIEWRES IRHIJRN} I 1xpranqpu: 9o YOU wann‘ FA.S'1'ZO0MS?{YIN) Type: 1/(RBTURN) I: prompts: EJVTER CIRCLE ZOOM PERCDVI’ (l-Zmüüjcdütkv Type: 25 (RETURN) Twcntyfivei:ugoodsafonutnbcrfilhecitcledozftlooktoo budnnd | thc regen isspecdodttpquitea biLThebad min; about shorttegcm 1‘t5 you don't havc um: tn grab unother cofloc. hedicluhlc Prompt: 5)Get to Imcw what AutoCAD is going 1ou]: you. Knowittg m:ponible ptonrpu in my givcn Iinution i: 15k: ' bcing ablc l0 und a wifu’ httsbandl boyfiimd/ girLfria-Id‘: wants before h0 or ahe nsks. Thu malten thcm hzppy und thlt man you hnwyf Pre-Type Commnnds 6) Rcmunber whutluidabouttlwkcybcard buffar? ‘Du's can um’:helpful during a dntwing a5 wclL Whcn ym: m: naht; n ublet a’ m a n mcnu Im’ pickittg eotnmmds. you 1mm wait f0: the eommand In be cxccuted befoxc you cm pick axtolltcr. Ifyou u: using Ihn kcyboud you um typethr: ncxt commnnd whilo thalastotwiswotkhtgfltishalps youtn lumthcprompuuflth progmm u wcll 1s spccding up the dnw-ing 110cc“. Undo Mlstnltu 7) Don't worry nboul mnking nfistakes during n drawing. AutoCAD is an forgivixtg with oqxspmtrot C.und Undo. To be. I'm you nhould alwuyz be on thx: vage of making mistakes. Thin makas yuu push AuwCAD 1nd yomsclf mthe tmüu. Snve Reguhrly 8) 51v: your dmvings zcgulnly. m1 l dort. man cvcry couple of dlys. Savo Lh: dntnrings Lu th: hard disk uI laut evczy Iulf haut. You nevar Imow wlum yout ‘ein; tn b: 55Min] in I datktoomixtfiomofnbhnksczom. kisnhongoodideanokocpn flomy in thcport und nvn you: thwing to Ihc Iloppy every couplc o! houn. Hart! dtivas have n stnngc hnbil of enting dmwittz: oocasiutally. Ifyouhave itonn floppynltomonwoekyw would havc i: two houxs setting to thc point you wer: n whm your "Üdrivcdccidad i! wu Iunch KnowThy DOS 9)Gcnohxow DOS buurLDOS maynotsoan an be too terribly exciting or useful but it oontxoh your whole computer system. I! you gct into troublc und you don't know how t0 useallthe fmcyuülityprogtrmoutthcre. [Joscmptnbabty gu you au: of thc hole. Don't Worry, B: Happy 10) The bes: tip Ihr thc aflicicnt tue o! Autocmistoboahletnsitbachnlumdhne fmwithit. Yau um‘:just I. dnfumttn am! man. You u: now n btlirl. Will’! IM cxpnndad cnplbilidc: o1’ thc wandert!!! dcvic: w: ca.11 the compula. Rczncmblf. don't juil m: AutoCAD. Inakn m: o! AutoCAD! by KeIIy Hain Gcaph-Toc 1-855-6362

I V

' A

i ß

dWÖfiBfiäC-‘Emfis 5G

main

ZOOMIREFURJV),EIRETURJW:(RETURNLÄTX (RETURN)

K5 IIN IKTIHINDIGP1555 [immun

w-vtww»

Alpkmvhunntrgghlfluylpflflu,

type

(HAHIESI3

w y m e m m m

‚c3""""'‚„ _'„ a m M hmmunhiuulhd S ngilhülmyst’fis

screat mmes

5050H OIAPIDG i1

StJnC-TEEIG_HDII_

ENGINEERING

‘ (‘111037-1211 _ t u t z t_ _ ‚tuutttt. ‘

_„

‘slähoton-Sflmrxuxn

(u-‚t \Lt‚.1tl’tsl Putfrnttttattcc H I1t>n xnu lral 1m;- m-‚I und Hwiumtantt"

Wuit-‚h

3353775“

‘‘Youunnonthcmadthxcutdlondtxutocn On the tho manu. You lhtfollowingfi I Drawbtg Nane: (RETURN) {REFURN}

V10

Nut U 1 ! ! ! nlthn oultuTmkdgu

(betrautrühmt u n d :dumm: Ißury

IG M930 ' AJSIIMILYIDBfiJM 2 an n M, U t i l i t y Dung

(III:

LANGUÄGES

SCS IÄJS . CLANUUAGB 1 5 i II Ciln.Intim. i 515 „C171.' PASCAL

P.C.B. Layout

zu. am IBABIILII

2gIphdlha i114 IIUATII

115mm;

u m ! I 1in4:jntvuuu

um: [a tbu-plnyar . „ au: BUSINESS Allach-au sann-human,hpgcnnm-I. '

-AutoCAD" mtegtanon

D0 You Need

antik-intim.)

ICI n21! -MEGAGTI'IJI.Y h n u ä n u n j u m n c h r y u n fl

5c:am -TFJP.5A.Li'fch—maIu

5.9’

Roootd koepmg aetups

Mixing:

5C! H”.V0 IUINFJS wnutsz dhkut-ßOlIII-hhumm lil—l 505 I17! R J N G T Ü I REAL n m! 01 in h:

- m19 btocks a.logen >

Quant) pur

"3ä q"43%,

*3}

IIHJSLHL GROIETALLHRS Abt n: nPün d’ Sah Ihr-I‘‘W nun-n 5C!» IISJJM - PAYIMXJJaruIJ IG

Don't Just U59 AutoCAD“ Male UIB oI AutoCAD"!

llmlttnn

Tnd-aIrGdLmdIdInc SCSHIJ-HEANIIIJTIIJHES

p n f l m [a

ltnn-hQ—I—d DB

adocp brealhttztdfigurcoutwhntlts going t0 taketodo thisjob. 100k fur pnssible blocks or blockx umcan bc edited to fix thc sltuatim. I tcheck fcx things umcm be copiod o: mirroml. Anyming Ihn doesn't have to b: radrawn uns timc. Bufforlng Action 2) AutoCAD Im: a l6 charmant Keyboard buffer. This mcans ü ruhen-Ihm staunen Ionen er nmnbcr: you key in whilc Ihc Computer i: working an the last thing ynu did, 111i: allows you L0 kcc-p n cnuph: of ncpts ahcad o! m:gnme. Tho buffctr comes in hmdy at my mge o1’ thc Ffiütcdiflgl. Dnc pllc: this really xhinos i: an load-up ofan old drlwhtg. A typical usc in um: case might go down Likc lltiu:

SCSI}! 1 5 0 m m }

5C! l75.76‚77‚7I.79 5811MB

s an u:

‚l 1

III-Im

MAJIIION

M a m ah

figttrcd. TIM Lazy Man's Way I) Tho bes: updaten: ummd am m:I u y \ uns. l know uns sounth crazyJJuI. a Iuy pczson i: always Iooking for the laut umotmt o! work l0 get ajob dnne. This i: whnx maku you Im. "Du: [zwar Ituysuoku 1nd mnuae movcs you maltn Ihn: I n : : im:you spcnd cma tinwing. Befon: you statt nnew dnwhtg m:

171m”Dein: ‚k

helpyougetovexflxmmpmflmnkc youabencrproduccrlhmyou

SCS um STOIIMNKT Saum lqfidoflcndlqfiiulic

ADVENTURE

5C!I10! SPAß.‘ QUEGTS S p u 0nd. Dlofonnk Gut. i Bahn 5C!» IIDAIH MJNGON WMORJA

- Ä

_ _ . (6041138-8722, Fax:{604}?38-3002

‚

t/ "Htc LSIIUSI Yt-rsiutts v’ 'I'ltc licsl Prugrunts

im the AutoCAD uscr. novice o: cxpert. Same 01' thcsc ideas may be fantiliax In snme of Lhc expaiu-nced npexuum. bot cweryotte an use a ülflc rcfresher, Who hmws. you may havc forguttcn about samt:of m; litue u-icks urjtutt got ticd up in thcjob i at hand. For thc users tI-mt m: nolso expctimced Ihn:tips might

COfRPUTEva-PER ACCOUNTING

COMPUTER CLENDAR

ACCESS CENTRE 290-145 Chatlwich N. Van 984-4671 Redford for info 5100 Accounfläscall BARKEL BUSSCH L.211 3030 Lincoln AvaCoqlfiflnm 464-8717. Call forniglu schmal standuzs. Bcdfon! Accounting or ACCPAC ECU‘. 3700 Avcnuc. Blmnby, EC. 434-1510. COMP 187 COhIPJZED ACCOUNTING 57653 Jan 10., BBY BURNABY CAREER CENTRE. Melrowwn 437-5711. ACCPAC, Lotos. Call f0: dem]:dny md cvcnixlg BURNABY SCHOOLBD. 5325 Klncaid Bumnhy ACCPAC Gencnl hdgar. 580

880

Redford Accounting,

ACCPAC/Hedlord 890 BUSINESS CTRE 300-1497 Main: Dr. W Van. 929-1147 New Vlnn C111 far dass S149 COMPUTERLAND CEJNTTRE 1035 W. Punk: 683-6152. ACCPAC GL. Dec. 9 S100 Bedlord Accounting. Dec. 6.7.8 5180 COMPUTER EMPIRE. TRAINING 3031 Main 879-4162 Nur Vlnn Accounting C111 for das 8145 CONDIHH PEDPIL 302141124 Lnmdll: N. Van. 984-4349 Redford Accounting S179 ACCPAC Euy Gen. 5179 COMPUTER PLACE 86031111110 8L688-2992 . ACCPAC GIL ‚M? 5179 COQ CONT. EDUC.. 1100:Wiulnw Ave. 906-4261. AccPu: Gnu. Ledger Im. 23 S80 AccPac Account: Pnyahle Im. 23 5U Acch: Account: Bec. Im. 23 8N Badford Anno: Im. 23 5U DOPPLEIPS TRAINING CENTRE 101 W.5th 875-0261 Bariton! Aecountln IACCPAC lday couzses 5175 KWANTIHW COLLEEPE Surrcy. B.C. 588-4411. ACCPAC Intm Dec. 12-16 LANGLEY ‚SCHOOL. Rm88. 21405-5601 Ave533-4227. Redford Accmg, S95 McKAY TECHNICAL INST. 215l Bmnrd Vanc. 736-7221 Cumpnnerlud Bookneplng Course 11 wenn OMNI COLLEGE. #300 905 Wen Pendar. 682-6664. ACCPAC GLDec. 6.20 (days) S160 BEDFOIID Dec. s (am) S160 ACCPAC NR Dec. 7 ouoouxss LEARNBWG 400-1190 Melvillc 669-9800 ‘ACCPACorBedIouüA Callfdrhfo" .\ PITMAN BUS. OOLLEXJE 1490 W. Broadwny 738-7848 Anmunling Call for dass CENTER 735 Clnk Dr. 755-3198 S130 ‘Begfom Acct lntr w ACCPAC Intro A«anfing wlth Badrnrd 8225 ACCPA S145 ACCPAC All/A S275 ' PRIMA TRAINING 207-3 Van 294-4567. Intrnducflou New Vlews Acch. Dec. 5116-‘. lntermedhtelfiwvkwxalcm. Dec. 6 & 7 SOUfl-I GRANVRLE BUS CENT 1652 W 7 ‚Vm 732-8850 ACCPAC ur Bcdfnrd Acctlng Evsry Man. Eva. Jan. 9 TXL MANAGEMENT 876-7117 Nur Vlaws lntro Seminar Dec 15. Jan. 20 990-12 P1451: VANCOUVER COMMUNITY COLLEGE 875-2800 S166 Accounting vrlth ACCPAC Dcc. 9.19 Intro 0o Bndford Dec. 8-12 S145 Advanced Dec. 21 S130 VANOOUVER SCHOOL BOARD 736-7241 ‘h:Tuch ACCPAC-GL or Redford Accounting S90 ACCPAC BP], ACCPAC Es} m-Phn, Baron: I ü 11380

ACCESS CENTER Lmnddc Qluy 984-4671 dBue I11+ Call fordates S140 BARKEL BUS. SCH. 211-3030 Lincoln Coq464-8717. dlhse 111+ C81] f0: dm: BURNABY SCHOOL BOARD 5325 Kincaid St. 299-4361. dBIum-c- Lav. II, 580 CAPILANO COLLEGE 2055 Pm-cell Wly. N Vm984-4901 dBASE 111+

COMPUTERLAND, 1035 W.Pmdcr, 683-6157.

dBaaa 111+. Dec. 8.9.2223 dBIE III+ Ada. Dx.2

SCALL.

S325 S180

COMPUTER PEOFLE 302A 1124 Lnnsdale. 9844349 dBASB III + Intro E:Adv S159 COMPUTER EMPIRETRABQING, 3031 Main 879-4162 dBASE III + (C1111f0: dntcs) 5145 COMPIJTER STATION 2130 Bm-rard Varuoouvet 732-8621 Inmo 0o dBase III + S180 COQUI'1'LAM CONT. EDUC. 110a Wmslow Avc. 936-4261

dBaseIII+Lev.I&ILIm.23

DRAKE 103-1111 Melville St 669-8739 Inhotodßflemflus. Dec. 13 lnmerdfluelfl HlIsDec. 15 FIALAGROIIP SIOJIIZWPenGeI 684-1022

dßßem+2Decfl5

580

S175 S175 S175

dBue III + 1.Dec. 21 KWANTLEN COLLEGE. P.O. Box 9030. Sumy. 588-4411. 1mm 0o dBASE III 4-. S160 OMNT COLLEGE. 0300-905 was: Perxdu- 682-6664. «man: 111+ 1 Dec. l4 (dlys) S160 dBASE III + II Dec. 15.16.19 ONCOURSE LEARNING 400-1190 Melville 669-9800 Using dBase 111+ Dec. 7.8 Applyhg dBase III +. Dec. 21.22 PERSONAL COMP ‘RAIN INST 200-247 Abbol 682-5448 Reflex Plus C111 in: dm S150 PBSC TRAINING CENTRE 1350-1140 W.Pandas: 689-7272 6|3|92 11l + LEVEL 1.2.3 S175 PRECEFT LEARNING CENTER. 735 Cllfk Van 255-3198. 118m:III + Dublin: PUMAN BUS. COLLEGE 1490 W.Broodwny 738-7848 clBu: 111+ Llvcl l. S350 DBuc 111+ Level II S175 UBC CENTRB POR CON'l‘. ED. 5997 1cm Dr.. Van. dBASE 111+ Intel-und. S195 dBASE lll + Adm. S365 VANCOUVER COMMUNTIY COLLEGB 875-8200 htro 1o dBASE III +‚ Dec.l-12 S145 lmrned.dBASE 11l +. Dec. 15 5145 Database Ualng Cllppcr C111 t'a- info 8150 d B m 111+ Intn S145

BURNABY SCHOOL BOARD. 5325 Kincnid. 299-4361. AutoCAD 8160 COQ. CONT. EDUC. 1100:Winslow Ave. 936-4261 Alnocodlmnlafl. 1:11.23 S160 KWANTLEN COLLEGB. PO. Box 9030. Sutrey 5884411. Colnpnlzr Afled Drama; LANGLBY SCHOOL. #88. 21405 56th Ave. 533-4227. Wim Enctly Inn Mepbyn? Call for dass S28 Compum Lltency for Beginnen. MICROAGE 3609 W 16th Ave. 222-1010. S175 Aumocad, UBC CENTRE. FOR CONT. ED.. CASE: Computer Asslstod Schwan C111for inIo

Mbycynplmuhncacmtfldflqsmau. Bulwhnmfisawncnflhpfionpupfloufinguxflhn

Hmrbdmgaa’ Seawägäs

mfiäfl°afißz°ifif‘e‚"a‘mäß%. Hold Dmmmer (604) 041-3780

ä ü fl ß fi d fl t i c fi u j ü i fl fi i fl q fi n 5610681“ FAXfllfij-flfi-flfl

DESKTOP PUBLISHING

1mm. mVenmn. V:

alter

McKAY INS!‘ 215l Burraud St. um. 736-7221 Desktop PuhLGnphtArls 1 2 m m rordms MICROAGE 3609 W 16th Avo. 222-1010.

5200

S175 Pagcnulur. ONINI COLLEGE. #300 905 Was: Funde:- 682-6664. Diploma Course 5 wlts (call f0: dalcsmutomnted Omen: Slums l2 wnkdiplomnounmcallfordatesä covst ONOOURSE LEARNDJG 400-1190 Melville 669-9800 Vantura Intro Dec. 5.6 Adv Dec. 9 S140 S240 Pagemaler Intro Adv Dec. 23 S240 519S DedgnBasksforPCb Dec. l4 PBSC‘IRAINNG CENTRE 1350-1140W.Parade: 689-7272 S450 Pagemxku 1 Call for info PRECEPT LEARNNG CENTRE 735 Cln-k Dr 755-3198 lntro 1o Desktop Publlshlng S130 Desktop Publhhhg w PagcMnker or Veutura 5190 PRIMA TRAINING 207-3900 HasfingsBby 294-4567 DTP ustng Ventun. Pagamalur Call for dates S150 PROFESSIONALTRAWDFG 502-1185 WGeorgia 681-5903

Comwrus & Pnlmznu

RENTAES LTD 0201-1095 Howc Slreel Vancouvcr. B.C. V62 1P6

\688-8685 i?5IUIPPATE:ATBÄ'N'NG;3581119535557 ATTENHQN PC usans

(See also Ehe Macintosh Soclim f0: Mac DTP) CAPIIANO COL2055 Purcell Way. Nonh Van 984-4901 Mlavoson Word 11. Dec. 2.3 5140 S70 Desktop Plblisher. CO 103S W.Pendsr 683-6152 Excel Worksh Sims Dec. 6 Dbasc Graph Dec. 12 PageMaker Inuo Ihm-Dec. 9.19 COMPUTER EMPIRE TRAINING, 3031 Mlin 879-4162. Venturn (call for daran) 514S COQ. CONT. EDUC. 1100| Winslow Ave. 936-4261 Ventnn. Im. 23 380 Pagemaker. Im. B DOPPLEIPS TRAINING CENIBE 101W.5th 875-0261 Ventura or Pagamnlur C111 f0! dass S375 DRAKLETRAINING 100-1111 Melvill: 669-8789 Intro in E801. Interne-d. Eitel Dec. 5 FIALABONNER, Sa. 810-1112 W.Pendzr 684-1022 Ventun 1 Dec. 7.Ventun 2Dec. S KWANILEN OOLLEGE. R0. Box 9030. Surrey. 588-4411.

OWN

RENT T0

Why waste time and money? Call

UPDATE at 688-2727 ‘We specialize in "In offlce" training and updaxing.’

COMPUTER TRAINING

THIS MONTHS SPECIALS

„

Evenlng Glosse: Intro’1o: o MS-DOS o LOTUS I-2-3 o WORDPERFECT

5.0

8165.00

reg. 5195.00 2 Evas. 3ms. auch. '

Endensive Training Guide

Included wrIh course mafericlls I CALL NOW TORESERVE YOUR SPACE INTHESE POPULAR COURSESI

Oma-r discounts nof appticabfa. VANCGNERMISSISSAUGÄCALGARVJORUITO. HAUFAX . H ‚HAMLTON ‚CJEWÜHDGE. LONDONJHJNDBQ BAY

S360 Pagesker on IBM. Ventun an IBM S350 SELKIRK OOLLEGE. Box 1200 Castlegnr 365-7& Eleclronlc Publishlng. Graphi: Design, Phomgnphy, W lyear warum. SIMON ER UNTVERSITY Downmwn 5374255 ventnn Pubflsher CALL SOUTH GRANVIIJE BUS CENT 1652 W 7. Van 732-8850

mcmpmrw-nxmmxgsä 4-7

-—'+_*—_

=_._

COMUTER CALENDAR ;

1 -—com?u'r'e1?ä?ER m

EvatyMon. Eva. I n . 9

UBCCONIINUINGED;I:7huDr„Vm.‚B.C. Postscript Prag. nur D VANCOUVER COMMUNITY 0011.505. human:Iorllhl Doe.1.17

S95 1 8166 8165 S130

PngeMnIur m‘ 11|: IBM hier. Den. 8.14 Pquntln vor IBMEmulator.Don. 19 VANCDUVER ELECTROMC PUBIJSHING ASSOCIAUON

BoxZUTGuVm 875-06771101. hMondhMonflr Mac 316 683-1599 Zndwed. 1035 endet Da: 1:(S50 for munbcra) S80 Aruaouy o1 VANCOUVER UNITY (D11365875-8200 Incro 1oDTP S130 VANCOIJVER DESIEYOPPIIB CENT 11501-1omer 681-9161 Cllnlcs Verrmn Publflur cmforducr Duktop D: VANCOUVER 11001. BOARD 736-7241 cm1o: d m ; DTP: Vuntun or Pngemalur John Oliver S135

GENERAL INTEREST

SFU Fa: ofhppl Sei. 3M. -; P11291-3851.

Supercond. Materials. Supercompnnrgbec 7 S105 Pnv. Mnht. a saso OMNI OOMPIJOLLEGE 300-905 W.Parade: St. 682-6664 111m h P038 D03 Das. 21. Evas. Don. 13.10.15 S100 Bord Dhk Mammut. Den. 20.21.22 S160 BUSINESS COMPUTER Sa. 104 513 Abbau St. Prinen Georg: VZM 3118 561-0276. 1mm. In Oma Automaflomhn. 2.3.4 Kaybourdhgskflh. Typlq Tutor

Novell Neural: Mgmt. Don. 15 DRAKETRAINING 100-1111Mclvme 669-8789 Symphony Spandauer ‚ Nord! Synom M ‚ Drx. 20.21 PBSC TRANING C E 1140W. Pandas 689-7272 Symphony ImBJ-‘rancvwk 11C311im du: INDEETECEI SERV.‚ 265 -167 W2nd Avc. 873-3900. Novcll Natur-e S0106 Curie nach additional patzen

THE MEDICAL OFFICE

INTEGRATED SOFTWARE T

A‘

;

—

1 _ _

LOTUS

D05

330 MB

‚_

Mnndcy

COMPUTIER

Fndnyz pm In 5 prn

Inuu m the Macintosh Mxcmsoa Word

5274030 2440.00 85565.00

253.353}

n u m1o m -

° ATARI

‚

2151 Bastard 5L.

v6] 3B?

_Authorwul

Maler

u s a r ß p m w m w q m u u m w w m r fl m BWE Truhvoarhouoobcmwhrm

33"".-rh‚comwEP:pcr-Dcaabc1988

BC1T Full Tuns 432-8419. Pm ‘I'ma: 434-1610

Anemhhr. BASIC. Fortran IV. RPG l1, C.Cobol. PUI. Prolog. Purer-hause, GBASE, Database Comepls, garni. ocu: BURNABY SCHOOL BD. 532S Kincüd S1. 299-4361. Mlcm Procealng II BASIC I 548 Data Prut. 2: BASIC S65 OOMPUCOLIIGB Van 682-6600 Bby 435 2424 Rich 273-0373 Compuur Pmgr. a.5m. ArnL:

(o: dann wcrocnmputer Eleclronk ‘roch. COMPUTER STATION. 2130 Bm-nrd S1. 73211621. lmro 1o Mkrocomputcu Don. 6. 20 3180 SOUTH GRANVEJE BUS CENT 1652 W 7, Van 732-8850 Intro 1o Computer: Eva-y Man. Eva. Im. 9

SPREADSHEETS

ACCESS CEJNRB lonldfleQuy NNm 984-4671Jmyfi1ne. Sprachkurs: Lohn: I23 (Av. 20 11mm) S140 ACCSYS COMPUTER MANAGEMENT. 81500-355 Bumrd Lom Lov. I Dec. 9 S130 BARKEL BUS SCHOOI. 211-3030 LhoohCoq4-64-8717. 101115123 Call for d m : S00 ECU‘ Fall Tim: R: 432-8419. Pm Timc: 434-1610 COMP 168 5115511111.0111i I1-Level 1 61110.. BBY LOTUS 1-2-3 -Lzvcl ljm 12.. H81’ jrn 21 12.. COQ BURNABY CAREER CETTRB. Bumflry. 437.57.11. Lama „Call BURNABY SCH DTP/Pnfihr BD. 5325 Kimcid S: 299-4361. “‘*-\

Lotos 1-2-3 COMPUCOLLEGE

500

‘

FINISH Hrcu SCHOOL

3500MB COMPUTER IJTERATE.... ;

Vaneouvu commnnity collep. ‚m Ring Dünn!Campus. 1155 EM Hündin! Becomc oomputer lltemte und eam grade 11

und mcredltnatthenmetmnmclasaaamln our tun 23-513mm computer lebt. wlth war 70

hoursoflnntrucmmadditiinalflshounof eachwee lsavnllable. supetvhedopax

Classea atarlJanuary Ethand an: lswoekn tmuon Iorncwstudenb DecemInlnngth. ber 12-15. Only 058.00 per coune. plus 012.00

—-

61875-6111. lau!518. OOIPUTER 062 Beginning course in touch keyboardmg (typmg AM/PM COMPUTER IIYIOARDINO O72 lntermedlnlc coum: In touch keyboardlng. AM/PM commnx 911111118 008 g coune In oomputcr lltemcy. D05. Ms Word. Muluplnn. und dBaJe 111+. AM/PM ODIPUTII. STUDIE! 073 lntroductaow courae in oomputer programmmg min BASIC AM/PM

esamg usmg WordPerfect. AM/PM

1100001171110 062 Beginnmg man: In accourmng. P141 only.

PROGRAMMING & DEVELOPMENT

PascalAmonly. WORD Ploclfißnm 062 lntro 1o ward proa-

065.00 065.00 935-00 51 30.00

550

1e o . pammlnguslng äuogllscllflcloflßmvanondoounem

Miuonnk Band Microsoft Woflm [2 dann) Bodford sxmpty Aanunun! lzdnysl 130-00

VAN SCHDOL BD. 1595 W 1011|Ava. .736-7241. 1111m. to Macintosh

tawn. F01’ man: Information phonzcnlhyhhma

ALTERNATIVE CONCEPTS INC.

A___

S145

und studcntservlcufioeandaono1h: best den] In

‘

1111m 1o Modular!!!

um: 630.00 appllcation fee

DTK 286 Packages 65MB roa MB

wer to

166419434331

scoxnuzunmppynxoumabsym

IRIHNMI-‚V-uunnlcwl“

‘i?

o Accesroflos

12 MHz! Paper white IuOnIIOrMS-DOS 3.30

7323850 "...:"":T« Get the

- -

Microcomputer Equipmanf SERVICE

BEDFORD DESKTOP PUBLISHING SECRETARIAL UPGRADE

‘x

JAMESMACPHEQSOOLASCJ

was survom

“ a m

Client Spodflc nl for lila. UBC CONTÜINUINO 5D. 5997 Ions 01.. V111.

0101-1026-5617151. D000. B.C‚ VJL 2B?

“W

SIR 5m

DELTA COMPUTERS

_ g; -

srso

‘

Computer. wonpmzrecr

sm am sm

I‘

lntroductlon 1o

BUSINESS CENTRE

sxso

mmgmwm ’

s F°.*.-':„„sT°..‚„"E.:„-Eg°" MAC surponr 681- s7.

CLASSEG.

‘m

Pqennker 161mm. D... 19

DAY or EVENING

MACINTOSH

ADVANTAGE COMPUTERS Suite 1760 505 3mm! S1. 1mm to Mac. Inmmed Mac. humaner Mlcnooft Werks, Word, ExcnLHypcrcar-d BURNABY SCHOOL BOARD. 5325 Kincaid. Bumaby 00410111 Arm. o: Madonna. CAPIIANO 001.. 2055 Pur-neu Way. Nonh Van 934-4901

Etui/Datums: o». 12 Microsoft Word Dec.1.14. 1s mer. Microsoft Word. n». 5.19 Pagemkzr Intro Den. 9

ACCSYS mmmm MANAGEMENT 01500-355 Burma

SAU S100

DRAKE O l00-1111Mc1vi11e 669-8789 Nord! Sys Mgr fEnd Uanr S415 INDERTECH SERV.. 265 -167 W 2nd Au.873-3900. Kann NCIVIII Training 1mm. course 1er buyen considuring purclme of tNovell nctwotk. ‘m: himxry. 1h: man. du Oanpetilictl. 1h: compnubilily ad Ihn diflcmt Davor cf Netwm. l puren 5400. auch pemon S100.

Macintosh Orlentatlon. Euaelworlflaoet. Dcc.6

S039 535mm mamhenhip:

S115

(‚UMPIHER EVIPIRETRAINING. 3031 Main 8794162. 1mal. (e111for dann!)

o8ü‘%“{xe‘€3’:i'ä€ä’ä5"v°f‘5‘„'fo5muuz

cmmoconoes manw... um Van 914-4901 1m mComphthidoflhflacm sm comuren m m 5 mmmc.3031 Main 879-4162. Medien! Sohwm r (soll Im’dass) ms Mmrcm. sovrwmus axourxevmamuy 73s-

S175

LOCAL AREA NETWORKS

nun.

S130

Aroamd 7 " “ 473a s mm5: s... aumby 3c.291-2261

Only 558.00 for 70 hours Call:T875-6111 ext.E 573.

COmPUTETFPAPERCOMPUTER-CAIENDAR Van 682-6600 Bby 435-2424. Rich 273-0373.

Cal Mlcrocouxputu- haben Applicntlons COMPUTER EMPIRETRAINING. 3031 Main 879-4162. Lotus 1-2-3 (Call für dem) 516 COMPUTER PWPLE 302A 1124 lonsdah NVm. 934-4349 140015133 S159 COMPUTER STATION2130 Bwmrd. Van. 732-8621 100115123Intro Doc. 1.14 Slü

®MPUTERLAND 1035 W. Pcndcr 683-6152. 1mm 1014:1115 123, Dec. 2.7.1120 Interna. Loms 123. Das. 8.21 AC7. Dom: 12.3. Den. 19

COQ. CONT. EDLTC. 11001 Wirulnw

Mms1-2-3Isv.1&I1Jm23

Au. 936-4261

51H 5180. 5180 580

DOPPLER 101 W.51h. Vnncouver 375-0261 140m3 123 lntro er Adv. C111 im (1111:: 5175 DRAKE TRAINING 100-1111 Metville 669-8789 140413123 I n n e Deut. 6.14 S175 Lama 123 Intm. Der. 20.21(Eve‚) Lohn: 123 Adv Dec. 12Meeres Dec. 7 S175 FIALA GROUP 810-1112 W Punk: Vnnoouver. 684-1022. 101115123 Lev 1.Dec. 19.29 1.011512: Lw 2. Die. 135175 1mm l-Z-J Lev. 3 Den. 23 IPC svsmvxs, 22a w.7m; 873-5595 Lotu 123 Basic: Call Ihr dann: S150 KWANTIEN CTJLLEGE. P.O. Box 9030. Sutray. 53.4411. um. 1.2.3, wer. 51s LANGLEY SEOONDARY SCHOOL 533-4227.

Müll 1-2-3. WCROAGE. 3609 W 16th Avg 222- 1010.

585

1.401118 123 5175 OMNI COLLEGE. 4300-905 was: Puder 682-6664. 1.01115 1-2-3 Lw. 1 Dec. 8 (dnyl) 5160 Lohn 1-2-3- Lev lDcc. 6.7.8 (was) S160 10111514-3 I...11De:.12.13.14 Lotos 1-2-3 L 111124121 OPKXJURSE LEARNNG 400-1190_Mduükm0-9Bm Udnx laotus Dec.

1.1% .

S195 AppLLotu Dqsßrfli! U11: Mlcrfiäon Werks. Dec. 12.13 S195 son E1001Laus-Matte ÄPFSC TRAINING CENTRE 1350-1140 w.Pcndcr 689-7272 Lohn m 1 & 2.Mamas. Funsüons Call for info S175 1.000s Sammelt IV 1&2; Suurtl; Etui l 51.75 ‘ PTTMAN BUS. COILEGE MQOWEBmdUCyTJI-THB 1 Seltene-Maß (Tauben: LEARNDJG CENTER 735 C1111: Dr. 255-3193 Elltlfll 1 S IMDOGB S105

\-mmA-r3Än5Rzo7—39ooe1-zmmm 294-4557 Unfug Lotus 123 Call for dm:

Data Management 8: Grnphs

6.. 502-1185 W Geargil 681-5913. {er info

5150 S105

539 S175

1652 W 7.Ave Van 732-8850 Man. Eva. Im. 9 120m5 1-2-3 UBC O0 BD. Courses 81014 Bochum. UBC. Adv. 1.401115 l-2-3 Den. 5-6 5% S175 Unlng Hallmark. VANCOUVER COMMUNTFY OOLLEGE 875-8200 lmuslß 1mm Den. 3-11 S145 hier Doc. 5-9 516 S175 1kmuns 113 VANCOUVER SCHOOL BD736-7241 S80 1.011513. Exccl

TELECOMMUNICATIONS

PBSC TRAINING 1350-1140 W. Funde: 51689-7272 Cmsnll (e111{er dem)

S175

USING YOUR PC

ACCESS CENTRE laondsdnle Quay 9844671 Disk Operttlng 5111118 Gr.11 for dem 5125 AOCSYS COMPUTER MANAGEMENT. 111500-355 Dumm! D08 Den. 8 S130 BARKEL BUS. 211-3030 LinaolnAvc.Coq. 464-8717 M3 D05Tina-h]C111for dass BCIT FdlTme . 432-8419. PnTmc:434-1610 COMPUTING R THE TIMID Jan 179,081! Pub 6.B01’.Mnr 6.BBY COMP 701 UNDERSFANDING PC/MS DOS jn 2G9. Blfifljm 11 l0, COQ. Feb 2.0 BBY, Feb 21C COMP 101INTRO H.I". ü IBM PCJan 0 BB Jan 10.11111’. ju 10.. 182 BBY.Jan 11.. 182 BBY Jan 11.. 182 BBYJI: l2. BDYJII l2. BBY. jn 25

14351km 15.581’. Feb 2. 111W COMP I02 11.1’. a:IBM PC Wach 13Mmh. B111’ COMP 104 COMPS IN BUSINESS 714061“ 9.1331’

Jan 19 10.11111’.Jan 14., BBY.Feb 2.5., BBY,jnn 9., COQ Jn 11.. COQJm 14.. COQ. Feb 25 25.. COQ COMI’ 160 COMP. SYS. INTRO Leveljn 10., BBY in 11.. VAN

3 RNABY SCHOOL 11D. S1125 Kincaid 51299-4361.

MICH) Prommlng 1

MS DOS/DM

RI.C.S. Computer Services

S31 S75 S80

Courses Avallable: -htroducflon 1oComputers _ und Dosrthe disk operailng syafem. --Bosk: word prooealng. -spreodaheeh.

Underntlndlng EWS/DOS. BUSNESS COMPUTER CENTRE. Sre. 104 S13 Ahbnu 5L Prima: George. V2141 311B 561 41276. MS-DOS a:Your PC. Im. 5.6 n. CAPIIANO COLLEGE 2055 Pumell Wxy. N.Via 984-4901 Bades of MICH! S185 DOS 1&2 5105 Manning Your Hut! Disk DOS for IBM-PC Lev. I1. 5105 COMPUTER PEOPLB 302A-1124 lmudale. 984-4349 lnrro Mlcrooomp 5169 MS-DOS Escada]: Herd DBk Man. 595 . S179 Coup. Scnluflons for Smnll Bus. COMPITIER PLACE 860 ßumnd S1. 299-31113 MSlPC-DOS Level I. 5179 COMPUTER S1ATION 2130 Bmrud Vmcmrvcr 732-8621 lnn-o to DOS, Dec. 6.20 5115 COMPUTERLAWDIOSS W Pendu 683-6152. Herd D151: Management Dec. 1.7.1520 S1110 lntro In Mlcrommp. 1300.9 COQCONT. EDUC. 1100: Winslow Ave. 936-4261 1mm in IBM PC. Im. 2.’-

Compufemed Accounmg.

htroducfow progmmmrwg

-Mrd

In BASIC 0nd Pascal. diak monogement, For more Information Call.

589-2215 ext. 17

0 m m ; P.I.C.s. Computer Services s1e117h.149I4 40:11h Ave.‚ smemßc.

Undcrilxndhg MS 100331523

IBM h. Im. 23 „ m 23 DRAKE TRAINING 100-1111 Mclvilic 669-8789 DOS Intro Dec. 6.19 (Eva) 111111110008. Doc.8 DOPPLER 101 W, 5th. Vmcouvcr 875-0261 111m): Micns 8: DOS C011 10|’dates FIALA GROUP 810-1112 W Pcnder S1. 684-1022 1mm b Computers; Dec. 17 D08 Lcv 1&2 Dec. 1.16.30 KWANTLEN COLLEGE. Surrty. B.C. 588-4411. [milde IBM PC

WATOHING T.V.

SS05-

-WE GUARANTE IT! Areynxmnmwduyigmhnmmaxxpuyaapuufimccmpfimfi

S125

unmnlnbanmwunuynanfinvifinfiamuuflchgwdnina dennoch. Thcwdoohofiumupumuquiduflqndlflnehm

S175

Inpynundaipuwmnahymasaq-hyqquyuuownpeuudhlhc poncydyaumuhanuadfioc. henevideoupauenawnumm

I l h i fl n d v fl y fl ä fl y d a n fl v s y u u w fi l fi n n n fl k d l n v ü h l l i l l fi m t n e fl ü i n l fl l fi q a s v fl y fi w fl ü

S175

Ü” APPLE Iummnle 0 Leim 123 Appleworlte ‘ Ü ’1° Word Prooeeelng WordPedeot D03 diene I14 Pagemaltlf Gpnedlheeh

Computers Intro Intro. to Mlcrocomp 81 DOS. Dec. 12-16 S160 S35 Mnnugina Your HEIM D1511Call for dem Intro t0 IBM PC De: 5: MICROAGE 3609 W 16111 Ave. 222-1010 Intro |0 PCS/DOS.Adv. DOS C111 for d u : 5175 OMNI3LKIE 03111-905 Welt Puder. 682-6664. lntro to PCs & D08 SIÜ m1 Herd DB! M 5160 ONCOURSE G 400-1190 Melville 669-9900 Ushg the Mkrocomp. Dec. 21 U DOS Den. 1.3 5195 PBSC G CENTRE 1350-1140 W. Puder 689-7272 11100h PC 1DOS 1 8 2 ‚ AdvnudCnfl für dm: S175 PITMAN BUSCOLLEGE 1490 W. Bmedwny 738-7848 lntro In Ruine:Schwan. Oricnmion MS-Dtß PRECEPI‘ LEARNNO CENTRE 735 Clark Dr255-3198 lntrotiPCJ 5145 PRNA TRAINING ET 207-3911) Hasdnsl. Van 294-4567. Mluvcom lniro, Yen‘ Herd Drlve S105 pnoamAngfx-Jc 502-118 U511! w Oeorzin. 681-5903. DOS S175 Mkrnnn Winden/Graph 5175 300'111GRANVIILEBUS C341‘ 1652 w 7, Van 732-8850 DOS Every Man. Eva. Im. 9 UBC Cemn b: Conürming Edmlüm MS-DOS: S60 350 Keyboard Sldlls Call (er dass Lenrnlng nbout Mkrocompums VANCOUVER COMMUNTTY COLLEGE 875-8200 lltro I: Coup. Dec. 2-18 5145 15cm. 0013M PC-XIDa-al. S145 VANCOUVER SCHOOL DOARD 736-7241 1mm IBM PC

us wen: wenn”

man“.

w.” „ n , “

For man humanen a l l : Masako Holdings

Ltd

o 275-1565

Payroll System Now wrlflen In dBASE IVfor up

1o 10 flmec fader procemng. oMufl-oompony

oMulfl-rofes oMum-union oUser deflned deducflons oEose of use oCustom deslgnad features oAll govemmem reporfs oHofllne appofl oAnnuol update:

VANCOUVER DESKTOP PUBUSHING CENTRE Ltd 1150 Homers! 681-9161. Suphzn Osbomu. Roedy G m n lnlruducdon MSDOS Call for dass S119

S129

WORD PROCESSING ACCSYS COMPUTER MANAGEMENT. 01503-355 Bwmd WordPcrfect Im. I Das. 16.20 S130 ACCESS CENTRE Lonntlnle Quay 984-4671 1in1: Sldlhccompulcr-buod tnixfing. Ilnytime. S125 WordPerfecl, MSWoM. Dkplnywflu. Mammut: S140 BCIT. 3700 Willingden Avc.. Bumlby. 434-1610. COMP 164 MICROSOFT WORD 82373 jn 10.. BBY COMP 164 MICROSOFT WORD 82384 21Feb. BBY BARKEL BUSINESS 211-3030 Coqairlm 464-8717 WordPafect. Wordsur C111 fur dnu BURNABY SCHOOL BD. 5325 Kincaid St299-436L AES Alpha + lndtvld. Prag. S40 Appleworks.

Canadian

.‚

Vemun neu evnlleble!

am Mahood um... Richmmud

. zwmw.

‘u?

«WINTER LEAMUOG I5 I Ü W Ä S E58’?

Troub

Ueder 11|: oodffrollbleshooflng

S495

„

zorcom Software Corporaflon PO Box 1657. Station A Vamcouver. B.C. V60 2P?

(604) 420-1502

(dBASE N ”

Esc frodomonc o1 Asiaten-rate)

m.Computer Pape:

Decemba

1933135

S80

Worfiparlact Lcvll.

ausmass saures. 1497 Marine Dr.w Van. 925-1147

S149 WordPerfect COMPUTER EMPIRETRAINING. 3031 Main 8794162.

WordPerfact. WordStIr (e111 im dass) Chinese W1’ (call for dates)

COMPUTER 1150m: 302111124 1 , 4 m m NVm. 984-4349

MS Word WardPerfect 3169 COMPUTER STATION 2130 Bumrd Van 732-8621 Wordhrfect, Word, Muitmnte, Dlspinywrite 4, S180 0609.15.20 ÜOMFUTERLAND 1035 W. Patin’ 683-6152. 8180 Display Wrlw 4 111110. Das. 6.21 51m Dlnplaywrltn 4. Inlnr. Das. 2o MS Word Basic SklMDec. 1.14.15 S325 Microsoft Word OH, Sirliis. Das. 5.19 SIÜ Microsofl Word Ada. Das. 9 8180 Muilimate Adv. i] 1111m. Das. 5 S180 Mulflrnnh Adv. 111mm. Das. 12 S180 Muidmale Adv. II Adh U00. l9 H“ WordPerfect 4.2 Adv,Das. l6 S180 WordPerfeet 5.0. Des. 5.6.2.2.3 S325 wordPerfact 5.0 1111er. D00. 14 8100 WordPerfeet 5.0 111111.. Dec. 16 8180 OOQ. CONT. EDUC. 11W:Winslow Ava. 9364261 Mlcroaon Word 1 8: 11Im. 23 Multirnall Adv. ‚im. 23 S80 Worfl Perfaetlälllm23 S80 DAC COMPUTER TRAINING. 682-2627. Diplay Wriu 4 ä Word Perfeel. DOPPLER TRAINING CENTREIOI W. 51h, V111875-0261 WordPußsL Wurdfiiultimate, Dhplaywrite 3175 FIALA GROUP 810-1112 W Fanden. Van 684-1022 Muitimahe Adv. 1.Das. 2:2 Mulümle Adv. II. 2, Das. 6 WordPerfecl 1.Das. 2.20 WordPerfc-ct 2. Das. 8.28 woirdPerfefl 3. Des. 14 Word Lev. 2. Des. 27 Word Lev. I. Das. 12Dispiaywrite 4.1.21‘. 1.Dec. 9 WordStar zooo S175 DRAKE TRAINING 100-1111 Maiville 669-3789 Display Wriln 4 1111m Das. 20 WordPar-fact lntro 5.0. Dm. 1.7.1528

‘

577191118 Computer 3707D Mast Go Rogardless of cost

xr Keyboards 339.00

‚

11"}.

(

“'-

11/

S75 Woraperrecz, 1mm lmermed. Worciperfecl. Dec. 3 3110 Word Frau, Mioorn/Wang. S250 LANGLEY SCHOOL. Run 88. 21405 - 56th Ava 533-4227. Word Perfect Dec. 6 I S85 MICROAGE 3609 W 16th Avc 222-1010 MS Word 8175 Word Perlen Part 1

OMNI GOLLEGE. 6300-905 Wen Pendel’. 682-6664.

S160 WordPerfecILD-orßfdaya) . MS Word 1Das. 15(d!!!) 8160 ONCOURSE LEARNNG 400-1190 Msiviiia 669-9800 AppiyingWorfiPerfect Das. 15.16 *

lJ-si

Muitimneßec. 12.13

MS ord. Das. 15.16 _ _ PBSC TRAINING 1350-1140W. Ferner 81689-7272

Displnywrlte 4 1&2 ; Mit-Mann Word 1.2&3; Multlnnle Adv-II 1‚2&3 worurerfbct Lev 1‚2&3 3175 PITMAN BUS. COLLEGE. 1490 Wkmsdwqy 738-7848. Word Proe- Coneepts a Theories; Applic; Prodn; Adv _ PRECEFI‘ LEARNNG CENTRE 735 Clark Dr 255-3198

Wordperfec! Levl S1 Word S145 PRIMA TRAINING 207-3900 Hastings. Bby. 294-4567 WorIlPerfect 2 wks. Adv 4 wk: 3150 PROETRAIN. ASSOC 502-1185 WGeorg’: 681-5903. wordPafect Lev. 1. S350

wordParfect Level II MS Word Lev. I.

5175 S350 SOUTH GRANVILLE BUS CENT‚1652 W 7. Van 732-8850 wordPt-rfect Evcry Mon. Im. 9 VANCOUVER COMMUNITY COLLEGE 875-8200 Intro 1o Word Parfact, Dac5-l9 Intannad. WordPerfect. Dcc. 4-12 Intm. 1o MS Word. Das. l-22 Interm. MS Word. Da. 7 VANCOUVER SCHOOL BOARD 736-7241 Dlspiay Wrile 4 MSWord 4.0 Lev II, Muldmale Aelvfl. '

WordPcrkct l.

Word Perfeet II. Word Purfact.Tlps, Trlcks & Trips

589.00

G7 Bus Marne

849.00

2o MB 11m11mm

3285.00

3o MB11m1Drim

„wenn

TTL Monitors

399.00

Interna] Modems

0-333 1m B. m1 599.50

k„

EVERYTHING DISCOUNTED 1! FULL MFG WARRANTY N0 REASONABLE OFFERS REFUSED

S80

1440 KINGSWAY VANCOUVER

PmW-l Shoppirggongy. Opendaily 1 0 m m a m Infomunon uns Only: 872-32257215

JO-Uwüumpurer Pnper- Dasunha1988

Amlp User Group (PnNorAmA). BCIT. Rm l29AOenunl Maar: 2nd Wal 730: hograrmners 41h Wcd 7:30 1er Sodeiy [ a m 467-6062. Applll BC Apple II User Group Meeting BCApple Socicty. Bmnaby Rugby Club. regular rmefing Kiyo Mund: 437-9935 Apple III SIG Monthiy Kiyo Mund:437-9935 111mm Atari St. I51Tun. of 11101101 7:30 Hastings Comm.

Cancre. Mcmberxhip S15. Dava Wlullcy 942-8301. Beaver Valley Commodore Club Maar: frst Tue: every rncnth a1 Mormose Schooi ijbruy. Call Ich: Vink 367-6426 Bahnen Graphit Supp. 1.16.. 1016 S1... Van. 6817351. Preeerautisna on111e Mac. Das."Bidurd: 3.Ahbmsh Tsshniquu. Das. 10. 1988. User's Group man 4 tirnes a yaar. Call George Pajan 925-2555. 2545 Quaens Ave. Was: Van V7V 2Y9. Clipper Davalopers Asocintion lst Man SFU 873-0747 Commodore Club 1311115 51111531 Comm Cent 738-3311 Form Intern:Group Spalten md TumriaJs im Foul: 111111.. somit apphc. Meer: 7:30 1s!11111.18. BCIT mein bldg. 3700 Willingdon Rm. 1191-324 ICCA, 81c. 400. 1190 Meiville S1. Van. B.C. 682-2747. Ncxt rnaeting Tuesday. Nov.29. 1988. Shemmx Landmark Hotel. Robson Street. Coskmib: 5:30: Dinner: 6:30: Speakezs: 7:30. Connor ICCA 682-2747. Kaypro User Gmnp Vanouuver Portable Computer Club 3rd Monduy a1 Knypro (CPIM) 278-5776 Mm: User Grwoup Meeting BC Apple Sosiety. WCB Buiiding. 6951 Westmmsta- Hwy (Kiyn Masuds) 437-9935. Das. 14 Gen. Meeting; Das. 21 Execulive Meeting. Das. 22 Nawsleticr

Mumm-h Mac Rm115 Kwmtlen Cdllage, Surrey. 5743313. Ron Haidmgcr. Call for info

Mapie Rkige Computer User Group 467-2647 MR. Snsscondnry Schnoi 7:30 PM. New Apple Aiilance. May Chow 2771-9199. Freue NEC APC User: Gmup Bi-montifly 7.4:: 980-5815 Norm Am. Armer-ad User's Group. 65-13880 74th Avc. Surrey V3W 756 597-0881 R. Scou Noveil Netwnre Ulm‘: Pe1er Wtüwllw 669-8789 montlfly Puma: Information Exshunge. PO. Box 67366. Station O. '

Vansouver. VSW 3T1.

Port Coq. Computer Club Commodore Amiga 8'. IBM 151m8 3rd Tue: 7:30 Poco R01: Cen12100 Wilwn Ava 942-4286 Schwan 11.6. C-anami Maetings. 3rd Thurs ofmonth in Vmcouver. #400 1190 Melvilla 51.. Vmsouvar. 684-7432. Tandy 1000+ (Z111i) Meer: ZndMorI. 7pm Kwnnrlm College. Nawmn Campus. Rm209 or211. umBosmc574-5419 Sur-Tandy 1000+ Club Dec. meeüng date Wednesdny. Des.7. 1988 Kwmtlm Collage. Ncwlon Campus. Room 213. 13468 77111 Ave. Sxzrrey. The New Apple Alliance May Chow 435-7609 hat Snmdxy of monrh in Kißilano Ncighbourhood Hause. T1 Cnrnputer Club Central Richmnnd. Maar: 2nd Wad 0fach momh. Phon: Kam 11.1 261-2739 Tr l a (Rlclrmond Atari Club) Thmnpon Cmrun. Cmire Lima Lane Richmmnd. 272-5789 1:18: 2nd Monday 730-950 Vnncnuver Elacrronie PubL Assoe. Box 2.4776. Vnn 875-0677 Monthly rnaeiin Das. 5 Gen. mcet. BC Club. Cenl. 750 Pmific B1 S.

Vaneouver Nehme User's Group 1.:: ubbmt 275-8684.

Meer: ist Monoi’ 01a monrh.

—-

X1’ Motherboards from

Im:

USER GROUPS:

„i115.64***?’ 7%.,‘ ‚g:*

3350.00

‘

Intern. wordPerfact 5.0. Des. 8 lntro. t0 MuitiMate. Das. 9 Adv. WordPIrfcd 5.0. Dec. 13 1mm. 1o WordPerfect 5.0. Das. 14(Evc.) Adv. Dßplay Write 4. Das. 16Intro. 110 MSWord. Des. 12 hier. Mammuts. Das. 19 wondPerlect Das. 15 KWANFLEN COLLEGE. n0.n9: 9030. Surray 5334411. Mlcrumfi Word 1111m 5140

NETWARE

MONDAY DEC 5, 1988 MONDAY JAN 2. 1988 STANLEY PARK PAVILLION CALL 275-8684 for Information & Confirmation GUESTS: Bring thls coupon

to get-Member Discounti

Vanaouver PC Users Group Plnneurium 734-0060. 5205M: . membuship. 7:00 pm Das. 15 0"" Van. Sineiair Users (irnupsupports all Timex-Sinclnir -\‚ 2nd Fri. 49111 8: lülluncy ComrrLCenL. Rupert computers. Garde 931-5509 presrdml Vantnrl P.0. Box 3614 Main Post Officx. Vmcouver. BJC. V63 3Y6. Judy Harem 873-1941; Don Hauch 433-8055; Saoond Wednesdxy a: Hastings Communily ‘Centre. 3096 E. Hastings. Wang System User Amme. 736-8841 e111 227 1P. Doiron 99 Users Group Evary Thun. 7-10 1m. Cameronkes CenL. Bby. Rcn:522-2598. 131171111‘: Gamcs. 21d 771m5 General 3rd 1'111.03 Tutorials 411: 711m Ccpying Prog. _ V

Takbtage o!

‘

New Publlshfng. Tachfiölcogyrrt m‘

Ä-

sume 100—1O62Homer7 sevancouvu’

Profesalonai Iraining In VENTURA FUBLISHEFI Junior &Senior Levals: Learn the sacrets of Desktop Publlshing with professionell book designecs. Or attend one of our Design Cllnlss for Ventura Users: wewill soive your deslgn and fomnatting problams on the spot.

WQFIKSTATION RENTALS: Use our iow-cost Desktop Workstations t0 complate your own pubiishing projects. Professionell Advisors on hand, A FULL P BLISHING SERVICE: Let our Pubiishlng Professionals take your book, magazine. newsietter or report from concept to flnishad product

—painiessiy and Inexpensively.

681-9161-

7 V

fihe Secet is Oüt..... Teachers Gather For HyperCard Camp n

—

HELP Canadian Payroll

Sunsbbuc Coca, Nov. 10:11mHit A quiu evening m1 1h:Sunshinc Cogmbagins a cnabling feel that m1.: wchnnlogy providuffhcsc woekend ol’ leaming for Lhirlu-ciglnB‚C. Lcuchus projects includetl a commnmily profile a1 Galino und their Macs 111b;RockWood Lndgc workshup Elemcnlmy. a high school ym book projecl. und faciliryjn SochüLSpunsmcd by Apple Canadn 1h: a Hypercard projecz which will mnble blind stuCamp was staffedby EducalionConsullanls Bany dcnts 1o usc 1h:Macinlosh.111c pcmgrcss Lhzuauch ./Umlcrwood und M McTavish anal Systzms Engi- nf 1h: puücipmls mndc cmIhcir projcct ovcr the neer Tori langton. In addilion Folksmn: Design wcckcnd was imprcssivc. Non-lecluücal people provided ooltsultmg and Inining für 1h: partici- wilh liulc u: no pzcvious HypuCaxd experience a pams from w] moaningm In: imo lhccvming. Ich 1h: cmup wixh Animation: o! dinosaurs. T11: Rockw facilily providos a Ingo cmnnl visually streng tutorial on Japan. 8nd m01: Ihm. skyliglurocnn sturourxdod by slecping rooms. A: cnablc sludcnls to easily impon existing 1:311 into ucsulgwchamdthmpooplewarewowldxagto u auch ofthcirown. Graphjcsofmimm nboundcd u: u tlaroe in Lhe mming beim falling inln whilc othexs organized and madc Ivnilxble cxislbcd. ing Hypezcard rmluial somd for anrimlmn u was curly moming raponad inlnntin; mquhcmcatsmue htenction bannen-n 1h:panicithcuseofextmlnl spcak- pantswasvuyfidlhecmxeüneywuctalking axplorhg about 1h: subjecß rhey wer: dann; with man:

a lag: skylighl. cummon room

creued m informll clmnwm complele wich m1unduir: und a kodakovcflwad projecmr for the Mlcintosh. Shm classcs wen: presemod u. required 1o pmvid: asolid technicalbnsoot‘common knowlodgc f0: all lhc puniciparmfrhe Iopics includcd MacintoshBasics. Using HypmCard. Hypu-Cn-d Objccu. Objoct01iuubd ProgrmnnmmConcepu, l-lypuCazd Scripting Basics. Advanced HypnCaxdsuiplirxgjxtetnal Commmds. UsingSound, Sound Editing and Capmre. Animation Techniqum. Rcsmuca Editor. Graphics Cnpunc. Ind man. Thn cvenings pofiled pnnicipmu pmjccu which included m a n ] sophisxicned schon] managenwu systenm. 01h: parücipmu projucts included resourcs cenler mmlgemenl. lcxlbcmk. tracking. CAl for finden: und 1h: mebchavinx cf prixmtes ( a mulximedinpruject). Many pmticlpanu explored wnys f!!! sludenß l0 108111by helping them cum: lheir own HypcrCard malerialffhen: was cncilunmt about Ihn

HELP Software is 0 m : of Camdais best selling payroll packagcs. lt Icatuves a uscr tes wlth moet major aocnunting packagesincluding ACCPAC, frlendly lnterface, in: NewVieweL KIS und lient Strat 'st‚ und keeps yuur Revenue Canada nmuunt in balance. Flexibility isthc namc of l c gamc ‘mpayroll softwanc, ancl HELP can handle user definable com ny of eamings a5 well as up 1o ten diffenent 1 allowlngrten und 4 Slips at yaar end an you deductiona. lt print: your Recordsof Employment can wen changc you: own Covcnuncnt lax tablcs. This means N0 yearly update fee. 1alimited only by disk s ca so an nur mmpan Bes: of all the number of emlgloyees ELP. lfyou havc mws, ou won't out mw oompanics, LPcan handle multiElc usinesues llke your own for the t m a ‚HELP Cana lan Paymll has been servlng past fiva rs and has over 1,000 installed users so you can buy with the confidence that HEL will bc thcrc i! you nccd it. Thc prioc Ior this 1sonly 5349.95. Talk 1o your f-rlends. they are probably almady uaing HELP nad n Payroll. F01- more information call HELP Software at (604) 435-6268

chi:

5487 Kingsway, Bumaby, B.C. VSH 2G1

COMPUTERS ‘IN

APPLICATIONS

an onuuv ‚a an u GEMEALOOY umm „ u m : wann-man v o r ! " o 1M lfilfi l’!

EHEALOG

1 M 'A_Lv

N n ' % v W m“ w’ “m”

' "W :-—«-_-„‚--» Ü

n»

"mm _ 5.!‘„.‚...‚'l"'?.it“'...." u m m s t m w m g m w m g ‘

hnnumuumpnzuugwpqvun

—

F! II-OOI CPU I0 HIEIFACE cm bat-v I'M 909mm Modul pouloiruulv

Europa. CONTACI‘: CANADA SYSTEMS GROUP LTD..393 Univasity Ave.. Tamtam. 0:11. M56 2119. (416) 979-3900 The Educaüonal Testing Service, Now York, will includc oomputer simulations of clusroom Lcnching situnüons in a new rascher licensing c u m The cum is designed mhelp sutes eliminuIc inc0mpe1entteachers.'l11e exam is aimcd n1 bcgixmitlg leachers. n01 vcmran cducmors.

wnumunmnuanmu-Cmvu bog

“SAU EAV Q y n q q n g u

Minen

ungut Amtmann

"FIPÜIWÜVVU

y m g l m.

109mm:

C1 WORLD 9 1 m m man-Novum Ior n:

UMM h o w ol In n!!!

IHEIWAV n v n m Ivsmu (a an n Fan-nur NPM nimm» solltu-

“"00 v"4"“"'“‘“*“"‘"'“-" F IM I! 1 um!!! [J IN CONYRUL (I du! In!) "In w r n M a y a . „ u m “ , „gum m fl p w n n c 9' " w " ?"ü H" " ä fi - W ö " I: THONI’ OTFICE (J du w: A conlvu „um I n m w n p nur» um ‚um. '

man I

n u n n m d w w p :IflIDfIII

TOTAL N0 1"“

’

TINV Immun-cum um m1 M u m m : D u m m 1m rennen

90.95

0 4 H Entw- Mnmuo Oma

L z’: nEruNnAaLE =

u Loaogr m: gnoeggä»: mm uns, Gnom:

1F" um n lahmt! 841d

3 ‘1 r5 2 1 1 2 1 1 1 1 3:7."! :""....“"‚'..„E':..'Z"f.i “w? FC-KEV i!

D fl a w q i o a muvnuIC-AU

Opium

Pllßllß IIOIMIN SHFTWAIIE

m: 001.004 w e n n ? or um

um um

—

glvgonnnnmuy n cnonunra man: warum:

—

Endorsed . the Mnmstry cf Educahon!

GAME

g i w m w ü w ° w......7’‚.....‘.ß'-":‘.‘.::=

locnmnal an: umampann mn u n :

The Omario Mirxisuy cf TORONTO (NB) Edmation hat signed a wu-ycm cummcl l0 disIribulnClmicesJr‚sof1wu:ir11hcpruvincc'ssmior clemanuxy und seconduxy sclwols. Tim contrawt wizh Cmnda Syswms Group Ltd. '15 wonh CS456.000. Choicca J1. i: anxicxocomputar-basexi syslcm dcsipcd w inuoducc smdcnts agad 1D1o l5 locarcc: plmning. CSG. now in 1h:pmcass of bcing mcrgod imo STM Systems Corp. of Mark-

1 u

INS-BUS GBMPMIBLE

G‘ ‘NIE WOIILD OKMTIIED |1 um: an

Ministry Signs Contract For Career Software

Networking Service ü Ouaüty f! Excellence z’?

R|CHMOND_ B_C_ VEV 1 y 6

wuIwcip.

ham. (Maria. distributes 1h:sofLwarc worldwide. Choicu Jr. i: um!in schools across Canada. in man: 111m3!) U.S.su11cs und inscvexal countries in

z-fr

105-3850 JACOMBS HD.

EDUCATION

CAD/CAM labs ü Business Ed Labs

E D U c A T I O N

hy sann Bloackloy, Folkstono Design Inc.

278-511 5

111m1 111e taclumlogy lhcy wer: using. HypuCanl 1msshifuad 1h:balmc: so 11m1atlcxxtiuncm rcznnin man iznplcmcnlulion ofnudy ruhe: " technology. The mmnr: lcfl Satuxday umarmen f0: 1h: Khnxilmo rund 111:: cmSmday. und mnny 0111er: left Snnuday cvcning 131km: about organizixlg workshops in otha pms of Ihe province. Solid pmjecls m: undcrway und ooordination anal com-

mmicnion wer: boooming imponmt issuufrhe lasl. poople ich RockWood lodge Sunday momi115. fortified with hot baue: cxoissanxs creamd hy 1h: cm: Caf Piano! in Ihe RockWood ovms. lalkixxg. minking und planning. A5l acoompxnied Lhc last.five panicipanß with um: lond of Mac: 1o Lhc scaplme doch i1swned approyiriam max 1h: Maas shmnld fly. lmaginnion. aeaüvity und ccnunmfication providcd 1h: focus ior this sucocssful guthering und will fuzl Ihe lcaming potential of this teclmology a: 1h: panicipnnu und others Lncmduce this media 1o our childrcn.

Dazu-r inquirics er: urlconwd.

m: m a n m a n umI man; w

«mm9 n u n

um n! n i m m - I m m u n

DATABASE MANAGERS l J PC-DBNS: Minimal anm- "Ion-wman: nimm nun 90--30: m m 0 M3:- IM wenn lflhng rundum l PC-fllpnt auf» Imgrdfinno-m Daunen Mnnpn A wenn um am Iunsficlnwmnnnmlnuu mach-um " v 0 III-I'M Yw I h w ß uwvdv '8- IM ‘WINV v w m h

MEMBERSNP A

5UÜ‘ÜTM.

—

a—

a-c- aesmems A00 EH: I'M! „m9.“;

—

Im“

I. POWRITEI! an Wlüwnnvllnuuulv I.» uanuod wenn pvouuo- um 4 gnws, Iwon man wem-au unrnm hlunmu m1 an n nru sann m r m In: n umarm1 ; racw vom: wonomw will's-und a0 pvacauo- I'd cuonl nominalen um um um Ihllfln um ' mmqa man wnm am Mama

—

————

N0 COD! OHFUQCHASI 0 M ! “ I! H A N D ! " All. ü!!! HEIDE? DIJICYI IN MDLICAVIGI ALL BEI! UUAIAHVIID VII“! I X !

SHIP TD

" " " " " ’

—————

CHMGE „Y

e l » MAJERCÄRÜ

pROCE3S|NG

I!”

CTGUE

c m 0 N0 EXT‘ DATE ÜGNAHJRI’

__ ‚

“Eh

.._.—.—_—..—.—.._

OVEH 2000 DISKS

IN CATALOGUE

P0 SIG P.O. BOX 2053 SURREY, B.C. VSW 9x5 604-59741881 Compum Papst o Decembcr 1988 ‘Ü!’

compulerlnnd Learning Centres We have

ä;

‘ E i ’ und

Ihroughout an. and the

‘

PHODUGT: Cum Digitizov PUBLISHER: was! Gans! consunams. San Dlego. Gnlflomia. availnbla through ShamWare.

PRßE:Tho ngistorad Version Es58B US.W out thruugh SHAREWARE 1o:undor 520.00.

ownm. incrutingly popuhr umman}: in;Contpmn-AaismdmnflmgtubgänboconnPC und Ummfimonh‘ M“

Macintosh classrooms Iocated

restol-ezhfii

mzruusrnrflwmmmnom-oum propmmntIwonMrooanmuMisCURVE Dlüflfllmnnnisnlflmhhfiuinthfl

mwuldnsnnueitisacfigflängmpmßim fliumquiruldigitizingmbluormouewml).

courses am avallable I0!’ rnost popular buslness appllcatlons:

AlmaughyauemnsoflmsodcvioonmdüosefiDaher would. i: II n0! m“ “ u n d ” “Mama” ‘nur motcpncücalfufiteeuunluugcrhcfiuu. CURVE DIOITIZER i: a 2D(two dinncnlionll) Cndpockngn. l nndzmand um| 3D vmipn inin

Spreadsheets. ............ Lotus 1 2 3. Exoel. Supercalc 4; Sman;

au: Compum-Aßisnd

SYUUhCWY

Syrrphony

Desktop Publlshlna

Periect: Word; Smart

womprooossors: ........

‘sp-aywmekmu" N a w' sVmpm" _y

Paaemaker

Accounting: .................ACCPAC: Bedlord

Networks: ..................„User und Supervisor training

Album Bugmgn Campuuf symmt 13 Allwwld PIr-‘klaing Stipplies Lid ........7 Alpha Cotnpulu Auaolcnmlfioa

..............

_n:-_j:l-:::n mmmmxgcfi Blairhottsc Innovaüonm..... . . 13 m

1:44

_ kaum M?

Puma!Compmm Ltd 26 C m " !U0»

Bes: S 86cm: Multfl"o°'"°‘mnh Nwfltfi”?

‘

a n u p u 12 m Omni Prufenlonnl

compum Coucgc (hmhncomww u,‘ ______________ "32 Cenue ......... Onqoun

....

Ccmlnufimuhiwhmflufl

G ........................................ gütig: PLCS. Scrvion

RAMTeoh lunaüomlLld...........‚.38 R m m h m n m m fl m u " 32

cmmu..„......-__„_::::3

mssmz....„.„;::.„:::::u

cowc-n-d-„_„wmw»-s ....................................7 Computer

......„43 rmw.„‚„‚cg—g‚;m„m;‚„‚„‚—«ww smCom Services .„putzt ..................„-41

’ '

Coanpulcr Cocmgcfion „ ________ ________„__25

sehnt System: Ine .........................‚.25 Soulh Gruwfllo Business Caurc ....„.38 Specific lnsmnnenß Lu ..................„. 15

Comwahnd Hardware Sang:‚‚‚‚‚‚‚„.4 in Educat1mL„..................4l Computen Gansmann! Co zu „„„„„„„„„„„„„„„„ „32

SIÜNCoamxta: .....................__34_43

c°mP'-“-"ll'd“mül—«m-———m42

' Enorm ulaässoc

............„.„........„xo Ltd.............

_.?„':'.'.'..„-......„.--;

5F|HCoawaSyunuLnd„...__l6

Super sormm.......................uo44n43 Symal ..............................................„32 Cmndl lnc .......................-33 Access C --....................

‘n:Ccm

“ä (sulnctipiaa)...28 ......... scnioa

In. C m “ “"' "8"".“iälflü” h?" (o;‘F’ "' "m" “ a m “d ‘h’ °‘.’P°“ unclucla braut, mmn u: of eotnmtmds. These"".’“P“1“° m56-

chmgn

a u ; c m fl - ‚ g GnmgcgnpChfgo‚pnnanhmd In

all! '

3 '

lpecify hzejk

I}: d, Imngmtoxu m” wdualcompononnfiu

_ -

M'„°g"g°€"°°mm°%=m°'°ws°m

nnlion o! informuinn withoui Ihe cluner n! Ihn

dnwüig michlltaredfflüs i: o mljö? ulvnnnge CAD m a n , “ X0“ m‘); „ w , “ n h “ , fast yvtluuqme xvailable “ E ”9 1 m m “ h" "1lgym. m“ Wim“ m’ f" mm“ “w ‘WM W‘- TM” m“ Hncor an: oreanuu. symbol Ilbmios. ediüng. file wen. Funcüon aeoesstolhucmamsmlkßmwingwüh

‚

„f

ham1mynxnnd 1112m m am‘? - im“Pro8’ ’

boxcgclggxdnrccreanomzoomacalgmkm. " w h m m w?» mmmc-Iemm

am....az*:t..“...":.‚':.fr""“c...cm w“..‚....°;"=..„"m„.mm‘*mm wenn! ‘UWE“ G n m k

m ___________________ „1 CompmuConm ‘ Computer Em Colp „„„„„„„„„„„„m29 -„„...„....„...........3s Compuwr

olhcryouflaowplmxbing‚cnlxcaiug.ueloclrleal_ reqwunsnrs. Wim euch o! lbllll opdom boing‘ dxawn m apart»päeoes o!’ pupar (m- CAD layms),you Iuva the choioo of1ookingnnzycumbi—

_ __

‘

Nu-Tck c

Im’

„am

ultcrmuvc placemmt für Ihc Windows. un m.

libmifsueghoavülnhlefonvuiayof tmvumdstanaxYouchngeqnatkb-chnpyou Mammut: mdudmghomcdesigr». plmnling flflndufllooknmasacondopfimbymmhrg somc sheets. um! insening nthers. Text shoußbc‘ _ pdThc eleclrongcs. dnwmg serem has sunilmuu u:umnf plnoecl an upumo Iaycn so you cm u m ;n» AutoCAD und Ins axsnonüzablc man. Mann; b, „ m “ ,„m,m, „ a m m„c ‚h: a m “ dmnna» Qualm m Generic Sofrwuc.

m30

.... ............ ......;2

ompum; CDICmnpma-Dim-{mtionhc

PC 9 5 | “ 5593153033 Pfllßhlflcilümflchfimflflb 3PUflLISÜEH:G0t|0fIc3oflwwB0ü|n;.c' AT.nnda:oIpdbbe.512Knqurod.B40K uflmdu-uudClJRVEDlGIlflRisNUfa 1nd l math oo-pnocossor rooommondod. chclpprogrfln. onlym mupemivean. becsue Supports a rnoun und a varioty of dlgitlzors. i! is mmitcled thmsgh Ihl SHAREWARE 0un«p;which Java umm.middlanmn. aus da0 suppomd.

of compula-Lidcd dcsign and nllows yuu dnw Thc cnhmccIm": inugu in Im: maupoguns incrnde cm0 dimcnsiuning. dnftin; manchem. pogmns roallow you In conwert to und [mm olhcr CADD formm a: wcll u deskmp publishhg packagcs using FbslScdpt.

Llu: worin 1nd will soon be availnbln u:regimrcd

PHODUOT: 60mm CADD Lnvol 3

PHOE:U.8.8199 Cukfißfiflflflkhniilßhyasotlcveh ’-avunuc. A lzye: oould umh: ducfibnd u n . g Onanie Software. Im. scllsGmcdc CADD. a dcrpioocddnwingpupu avcflayed mmam: ‚low-oost computcmidod dcsign program for PC; sheers. Normally. unlyone Iayezcnnbc wriucnon ma timc. lhlt being msACTIVE llycr (o: m:Inp fand oompuiblex. Unlikc most auch r Jmngine Idrawing(u: ahnumOn "Generic CADDi: mld hmodules, anablixxg us-crs a: an 1h: ( n u r : onepieoco p reqtnircd. mey nach: m:room. On anolhcr yo _ ic CADD i: compcüuve onmmy feannes rcvenai. On und»: you plane Äwith AutoCAD, yet il i: much lcn cxpenxivc. Level I. the hnsic progxum wache: 1h: rudimenm dann. On mothu piccc of papsr you

oporallng Systems: „DOS;' OS/2

‚

lll Plus; Paradox; Smart.

Database:

„„„„‚_sgrlg'fim„i„„„w‚„‚„cm wer.

— —

‘

upamvepoposmm(an

[Ibfllmüfll n

Ist-Mm» dnwmu wnhuptoßßlayas. und

hin-PR»!!!Aliznoolmwtdwmvflmludrawkp wie: digtizets. Thn stumm Ihn im a: im ummnfing opalfiuus min; Buch m

‘naeynpuacannntuuunfiniflacafllytou „ C A D m°'°’°“'"

"“"°'““*“ s’”dh”‘>’"m"" " ß ‘m

m‘ m"

w m

‘"53

" 3 "“ M !

PUB- 9 m m dinflmTI- MINI-l ‘Thf nur nunmal

‚

ü‘

wann:

symwh-

m08! dot-mntris minus.planen. diziüzing pudl

Indluicc.Aue-getaner 1sm:raquirad CURVE

mcn-zzzaiswziuubywmcomcoiuuxm " ' “ m ” ' SmDiegoCnlifmfiLfiunginuudv n9“5"""’°“°"' "’°““’“P'°8“‘“ "W8" SHAREWARE f" u m " S2000’

n“?!

| m“. minus! h N498.01501111. uunpla. _ und euy n an. Hauch und Fll ‘I'M hnchlfill mithin uniqus In du’: 535km. an! msl6hnnchpnnumflnnbfl1rybfiflwim

uqcolnnfmawcylonmmiecunnmiaadlulch

uxtedmon orword pmcunoumThuc pdlmu 1m

m Ehen”; L a u ‘ : Enge GT 14d. .....___..._______ „27 K3,

4'2—"‘m compu‘ lmtähpa Deomhfifis

110256 lmlypuudaviewsfccnntpnumflu ptnsanview a u s :an man 1o i: In:um.m: zum oommlnd.

. prosrm ‘I.’ “ ml-LMM“ C

Zuwm summa Coup

..................3;

allen

i: inoxpanxve. powcrhnl. arge "Eid “Ü” dm" 0 “ “

CgDDüvCyxmm-‚savqwenmuutmlylow FÄ-

äL

mu...„.„.

u..m_......

n n n — u — - _ vu-

„fl i i i j l fl ä fl r l

"""“""

°"'„:‚'‚‘.'„"‘_"'

‚m,

U35:m

ma.Spocidizaed in Sysnnms 8cDm Analysis

BBS BBS Atari 879-9871. Messaging and Online games. 300/1ZOWMLD Band (hobby syslun).

Catalyet 872-6968. Electroni: Couununity Cum: tun b3Pacific 1nformaäan Endung: Sociely (FIX) 24 1m. 31'121 2400 Band. On-linc Glmßi; Massage: Crash ST BBS Baus; We clmenfly havc scvcral nwssug: uxcas includirxg Hugxnmnm.Buy 115L 5:11. STTalk und more; Smvcya; Downloads; Lot: of pubiic domain popama. 111m: er: gumes. ooxmnunicaliom progznnu. music. npplicatimm; On-linc Music. 299-5111. CYVR 370-0510 RBBS-CYVII. EIGLA BBS——IBBS für meymmgalhcnt, 594-8151. EBENEZER CHRISTIAN BBS (cmnpulen i'm’ Christ I17) Syaop i5 Erling hausen 826-6607 0111381011. B.C. 300l1200HA00f9600 BAUD. Fido 153/508. 8:7W0l17. FANTASY PARADISE BBS 263-2682. 300f 12.00. Young people orientod. Grolmd Zero BBS Sysopßwvc Major 1200/

—

MOOZAHoNLRMnängonmIBMSystun W111: a uniquc BBS Softwue nllod Scuchlight locatedm Rlchmond. soalbhaveOn-Lixzc games und File ‘Taufen Call now!

(6010271-0137 Kaypro User’: Group Opus 271-5934 CPM t MS-DOS Sofiwro froe.

A-

ßPhoneLiles 300-12004400 Band Rates Feamrehcked

Dünen H1. Basic. Redford. Accpac. Lama 1-2-3.

Symphony. Cobol. Dibol. Ouia. MCBA, BCS. NewAge Software and Opm Systems. C111 Ed In 275-8351.

HARDWARE Brother Modcl 1509 D01M1111! Printcr with cut sheet Feeder. A5new. 5500.00 ootnplele.

DATABASE Advmced dBue 111+ Progmning dBnso 111+ Pro3‘; Referenz: Guide Undu-mnding dBuoIIH DESKTOP PUBLISHING lnoking Good in Print heile Xemx Venmra Publiahu WordPetfect 5.0 Desktop Publishing Publiahirxg wilh WcrdPcrfect 5 _ DOS ' M5 DOS 311l Edition R DOS 1d: E-Z MS DOS Users Guido BAR!)DISK MANAGEMENT Your Hand Disk ' Mnnagmui 11ml Mannen! PCIMS DOS Quick RaLGde. In Hnrd D151: Mgru. NTEGRATED SOFTWARE Pranßwon: 111: An kumdacfim Ufing Symphony 2nd Edition MS-Wmh for Ihn PC

C1111 26€»1277.

TwoVIcWrSIDOOIOMEG HDatSSOOu. Compat. Centronics 5300. Compt. Okidam 5250. Don Picho. Box 100. Rosslnnd. B.C. V06 1Y0. (604) 362-7371. Fast (3-65 für sale with lurbo and hypucimrgod 8 bitaüaooIu-l M111Heully Heada andaalnifl on Ihe 110er. Will ucrifioe far S1l00Tom o1 C64 games for nie. Jason 536-9272 H a l t Packard HNICX calculator. w-ilh MalhlSlat-pack. Ind Advanng: pad. am‘! m pock. Also Physic: pxoblems boolt. S500 030. W111 Scll _ 275-1016. sczo umormssoo. Apple Braun-Im 15Dalsy Wbecl nur Sysdyne CD1343 Color (RGB) Monlaar

C1111224-1119

I I

um;nnsimccmm 1m. m. o1‘ charge

7.1.1:, um, wbeol prlnur. Moawowp

.‘

23O.w11h1raeia'feed|eoeaio1y.1fl1cnew.5O% r 1/ all‘. asldng 83500110. Ph. 669-8036.

nnwuesssom Cuseuecable 55322-5924

SPREADSHEETS 5.,; Using 123 Special Edition Conrplene Reben:Qualm: Qoanro Made Boy WORD PROCESSING Using WowdPerfoct Vasioo 5 Manning WmflPafia Venion 5 Tempialc Kit WordPafoa 5.0 '

EMPLOYMENT WANTED

Oflce Bann; pwhge mm u S300.

526-3212

‚Sat‘

DMDTedmology.

WANTED

Cnaflvc Phyiu/Electflcel Englneer noch nenne: wilh 0111H! inlnealed in Alfificial Intelligenz: ü. Relevant wmpuler Amhilecnne. Call Paul 694m8. Don anyone own a 20+ haxd driv: 1.11:)’ would like 1o urflod? Iaaon a1 590-2017 1151:1’ 6 Waahd 256K SIMM bolrda hol: an Macllltuhel. Need Ibem In feine: needed. 27S 1016

Pcach P11 Vemnrm

Woivcflon Sehilt Devoney

Microsofi Press MoGnw

Benannt Sheldon

Q1:

Quc

Wolvcrmn

MeGraw-Hill Microsoft

LeBIorfiJEwing Cowan

Que MoGraw-Hill

Goodman

Baum

Cobb

CobbGroup

Purbhoomorel

Adfion-Welley Abacus

Dome:

Haydcn ‚_

‘

‚i?all

Qne büßen-Hin

Coup Blow

Merken-Hin

Stewart

‘Qoe

Sybex Mictoref

Kclly _Lfiaomf

Thls L15: B sponsond b; 11.0‘: 11mm rctalleraofcaaputer Boote lt I11ennpllail noultlyly Conpullt Distrllnmn 111e.

Managemcn Software.

podmlc exccmnictopascd. n1110181501115: offa. Telehpone 322-5924.

New Riders

Wein Kemfgüm

MAC sßvllhßßflAcchretorl-"Ullvolntfiurlal HD+BagS7.m0. x-ssa-aoao Computer l0 Karat Gold Neeleharne850.00 (Einladen m: 8: pomgeYA ‘POUCH 0P GOLIT-Bo: #3335 Llnfllcy. B.C. V3A 4117

‚30cm:IGV

Vemana Pmß

Swnn

SOFTWARE Phoanlx BBS 520-6112. Rßßsüluüllmmhgmlfliencwkflas Conheala. F11:X-fcl. On-line Gamea. Meaaage ßaaeaMuchMoxePayBonilweckfrcen-ial. Syaupfleflßailey 931-8868 Ca11Today1 SUNSHINE BBS Macintosh. fiypetouü sharewueffechsuppon. A11 111e:checkedfor vimaea Call Advantage Compulen a1. 430-3113 und n1: In: Bob o: Derrick. BBS 943-1612. Sinus o! Callfolnla, 300B Commodore. 876637. Social BordTeem. 800 Uaa. The Shonllm BBS Multi User S-line 300-2400 Band 51201'111’. 736-2197. Vaocouvar Online Systems 1200/2400Band Multi-Ihn Suppen. IBM Software 11c Contercmlrxg. 5211-2440 WONDERWORIJ 937-7542 300 381.111

Parken"

Skala

Samuel: 3.andolhc: schwere 1nd accessodes. 81.001 obo. Almfiiionl cnse tot same S100 ab 581-3335

MoGraw-Hnll Sybcx Sybex

Hmison

I I

Liskin Simpoon Simpaon

Bars! Will Hania Park:

Aprlcot X1Nun-IBM Compaflble. MS-DOS 3 5811-720 K3.5 110171?)- 768. K 9" high 1::monilor. V-30chip.

SUNSET BLVD. 298-3530.

r----..-..I.

9 languages includirxg und 1.01115 &«R.Baso. 5031m Wort. Reliablc & motivalad. Plans: call uigh 595-5421. Experleneed prngrammer sechs work wilh

-DOPPLE COMPUTER _. ENTREM

o—

.-.‘-"‘

Books on ei/ery subleci

— fi-

ore

TDaysaWeok asaDaysaYoar 1o1w.5thAva.

—

21.25.1235:... ...::.::.:*:..‚=°::.

1113115290014:

M u m m

Experlemed Desktop Publiaher 1.005113 for fieelalw: work will also d0 Mining: Inka mMnc-Xpress-MS Werks

35-2737 PC Prag-neuer sechs wert Ncw in ‘Jammer. 1001:1113 im programming wozkftilllpm timc. o1’ "bry 1h:Job." Specialize in rundum-File intensive HYBRlD(cmmed and custom wmkmg togethur) business softwue fot 111e PCAutlm of DATAMAGE dala mmageman:System. 517 per 110m" mnsuluüon, 522 pro hourprogmunhg/desipmgcusmm syslems. Ctrt Ward a: 875-1130. WORK WANTED: Micro Cortrpuler Program-

Nova Wal Ouay: 1110 Fron! 81.

Classified Ads!

New Wenlmlnem 526-0850 Waltraud Ilall:

Pfllflll] ade an free Buaineaa ad: Ire S20

10x25 wordsorlessplusßfi/wordslsfor e boxed aus Mail 1o The Computer Papcr 3205 Wßth Avm, Vancouver VGK 2V6 or Call FAX 732-4280 BBS: Mlndllnl: 533-2312 Name: Computer Paper

2-3000 Loughad Hwy coqultlam

484-5515 '

62011 Llnlvarelly Blvd, Vaneouvor 8.0. 228-4741

Thegomppm Pxpe: c December 1,900 543

"51?

1COMPUTERBÜÜKSÜCSÜHWÄRE g

‚V:

Ashton -Tatc

Wordwam

Haydcn

Microsoft Sybex Cobb Tab Weslcy Bamam Prcmicc Hall Quc McGmw-Hill Scott Mcrnorox Forcsman Sams Rycrson und Morc! Compun: Illustmwd WordPcrfect 5.0 529.95 517.95 i i‘ "1 Rclay Crold 3.0 Comm Software &%99:99-Sl99.00 Addisaon-

’

Easy

<2»

All Stock on sale at 20% oft‘ Publisher List (Cenadtnn). um February 1521939.

Selemüt

_-.

Computer Boo

- -

Woheve 1001 tltles tor IBM, Applet! aerjos and Commodore 64 and 128 Users. Pr uns by PFS Microsoft Lotus MIcroPro W er-tect o Mlgent and many more, plus thousands ot Games

w’

VanoouvmBC _ V6B3K4 Tel: (604) 682-7842 Fax: (604) 682-7849

k‘

L._

For Hardware Seletctior-t...

The Ideal computer systems tor Business, Education and Entertainment-are waltlng tor you at Frlendlyware Computers. IBM Compatlble Systems by AST o Toshtba o Comtex NEC etc.

For Book Selection...

One ot Vancouvefls best selectlons ot magazlnes and books on computers.

FRIENDLYWARE COMPUTERS INC.

437-311 3 3499 Kingsway (3 Blocks West of Boundary) Vancouver, V5R 5L5

“Ifiiefumputerhpuvflecflnbu 1988

,_ zu _ ‘1 "

‘

UNPHALL COMPUTER BOOKS LTD.‚ 628 Seymour S836i,{Omen}: Th: Boy Dept. Start!)

‚w‘

- -

OPENING SPECIALS

WeMake It For Software Selectlon...

(whilc slo-ck luts)

—— —

t ‘

’

—

' 0O

Hmdrodsoftttomostreoemcomputerbooks‚allpricedat eittterzofißoffcanadian Iist orUSllst plus 10%. Great daals. greatbooksattttelowermalnlmflsmostexctfingbookshopsl List OurPries Simple Prlces: WordPerfact V.5.0 330.75 524.15 Mastering 331.95 324.15 Using123 PCDOS Power Tools 854.95 843.95

G32 VI. BROADWAY, VANOGJVER 872-5711

1150 HD8301, VANOOUVEH E6711 N0. 3 HD. AT 000K. HCHXND 273-5711 OPEN 10AM-10PM 7 DAYS AWEEK the online‘: atways onusl

—

um‘

0 I