Government Hindi Insti tute Unemployment Union (GHIUU) has threatened to shut down Government Hindi Institute Dimapur if the diploma holders were disallowed to appear in the entrance exam.
As per education department advertise ment theers.hindiwasthat“irrationalteacher,becomelishedhindireasons.ersundergraduateingbeenthe4/8/2022,No.NSSB/EXAM-theunionsaiddiplomaholdershaveexemptedfromappeartheexamforthepostofhinditeachwithoutanylegitimateSincethegovernmentinstitutewasestabtomakethetraineesprofessionalhinditheunionsaiditwasandshocking”theconcernedauthorityneglectinggovernmentinstitutediplomaholdTheunionclaimedthattraineeswereassuredthat
Meanwhile, talking to the media, NSCN (I-M) member collective leadership, Rh Raising made it clear that the ball was in the court of the Government of India and not CCoNPI or the NSCN (I-M).
NTC, ZCOs welcome ‘September Joint Accordant’
DIMAPUR, SEP 17 (NPN): As the DimapurImphal Transmission Line is scheduled to be energized anytime from September 12, deputy commissioner (DC) Kohima, Shanavas C, has advised the public to not climb on the tower or touch the live conductor, which could result in fatal injuries.
DIMAPUR, SEP 17 (NPN): Nagaland on Sat urday recorded four fresh Covid-19 positive cases, one each in Dimapur, Kohima, Mokokchung and Wokha, pushing the total caseload to 35,945.With the active cases surged to 12-- three admitted to Covid hospitals and nine under home isolation.
The transmission line passes through recently.thersionDimapur-Imphalofpackagembam-Imphal.Senapati-Kangpokpi-Yurema-Zubza-Kohima-Mao-Chumukedima-MedzipheLungwirm-Theworkof“Reconductoring132kVSingleCircuitTransmisLinewithI-ITLSPanConductor”completed
DIMAPUR, SEP 17 (NPN):
once the post of hindi teacher was out the they would be given first However,priority.after wait ing for decades, the union said the trainees were “dev astated” with the sudden change of norms and criteria. The union questioned as to why the government hindi institute diploma holders— trained professionally only for the purpose by the state government—were being exempted from appearing exam.GHIUU has, therefore, urged the responsible author ity to take immediate action and deliver justice to the government hindi institute diploma holders.
TR Zeliang and Rh. Raising
State logs 4 fresh Covid-19 cases
During the searches, ED covered six business and residential premises in Delhi, Ghaziabad, Mum bai, Lucknow and Gaya. Besides, 16 other locations of banks, payment gateway branches and offices in Del hi, Gurugram, Mumbai, Pune, Chennai, Hyderabad, Jaipur, Jodhpur and Benga luru were also searched.
Staff Reporter
PM policy,nationalunveilslogisticsaimstocuttransportcost
ED said the HPZ token was operated by Technocab Private Ltd and Shigoo Technology Private Limited. Shigoo Technol ogy Private Limited was also found linked to vari
NEW DELHI, SEP 17 (PTI): Prime Minister Na rendra Modi on Saturday unveiled the National Lo gistics Policy that seeks to address challenges facing the transport sector and bring down the logistics cost of businesses from 13-14 per cent to a single digit.
Faceless assessment has started in customs and e-way bills and FASTag are bringing efficiency to the logistics sector.
On drone policy, he said drones will improve the logistics sector. The gov ernment, he said, is using technology to strengthen the logistics sector. He said the capacity of ports has been increased and the container vessel turnaround time has been cut to 26 hours from 44 hours previously.
www.nagalandpost.com Nagaland Post MYK C MYK C Vol XXXII No. 284 DIMAPUR, SUNDAY, SEPTEMBER 18, 2022 Pages 12 ` 5.00 Biden warns Putin against tactical nuclear weapons INTERNATIONAL, PAGE 9 Jacob kicks off CDFA League SPORTS, PAGE 12 (Cont’d on p-8) FOLLOW US ON @Nagaland_Postnagalandpostofficial
development was a positive sign to the Naga political issue, which has been drag ging on without settlement for decades.Further, ZCOs said that the wisdom and the pledge of leaders of NPGs at this juncture was a right step. They said that the initiative of the people particularly FNR leaders, who played a pivotal role in bringing the political groups together, was praiseworthy.ZCOsalso hoped that the parties of the joint ac cordant would “surely abide and adhere to its pledge of commitment to usher in com plete peace and tranquillity in the region.”
In this regard, NSCN (IM) delegation will be leaving for Delhi on Monday and dis cuss some unresolved matters with the officials of the Gov ernment of India Tuesday.
(NPN): A day after the Enforcement Directorate had frozen Rs 46.67 crore funds of merchant entities kept in four online pay ment gateway accounts after it carried out raids earlier this week against a getmining.investmentpretextWhatsApptorandisources,hugemachinescryptoingindividualsbasedtionmemberStateandvidualsplaintnewspaper,Octoberbercrimethe16country-wideonkeninvestment“Chinese-controlled”app(HPZtoapp),NagalandpoliceSaturdaysaidthattheoperationsatlocationswasbasedoncomplaintlodgedatCypolice,Kohimain2021.Aspublishedinthisafterthecom(filedbythreeinditwolocalfemalesanon-Nagamale),thepoliceformedafive-SpecialInvestigaTeam.HPZisanapplication-tokenwhichluresintoinvestinbitcoinsandothercurrencyinminingbypromisinggains.AccordingtopolicethemodusopeofthefraudsterswaslurethevictimsthroughmessagesontheofdoublingtheirthroughBitcoinAfterthevictimstheirinitialprofits,they
After meet with CCoNPI, NSCN (I-M) to resume talks
This is it!
DIMAPUR, SEP 17
According to media re ports, a Central team was working on a new set of ‘formulation papers’ which would include both new and old set of offers so as to fa cilitate inking of a final peace pact at the Zeliangearliest.saidthe NSCN (I-M) delegation’s contention was that they were unhappy with Centre’s representative AK Mishra for “omitting some of the important politi cal points which was included in the formulation papers” earlier prepared by then In terlocutor RN Ravi.
“It is they (GoI) who are to decide. We have been waiting for their response,” RaisingWhenstated.asked to com ment on Government of India’s directive to CCoNPI to convince NSCN (I-M) on signing the final agreement, Raising said “It is in the pro cess. It has to be settled in the table between Government of India and the NSCN (I-M) not here.”The11-member NSCN (I-M) team included members of the collective leadership-Rh Raising, TT Among, Kraibo Chawang, K K An gami, VikiyeAwomi, Chuba Pongen, Kimong Lowang, ‘maj’. (Retd) Hutovi Chishi,
the “grace and love of the Al mighty God in whose Name such an instrument had been signed.”
Contrary to the stand that official negotiations had con cluded on October 31, 2019, the NSCN (I-M) has agreed to “resume talks” based on the “formulation of papers” submitted t o the Govern ment of India and based on the Framework Agreement signed on August 3, 2015.
This significant revela tion was made by UDA chair man and CCoNPI co-con venor TR Zeliang to media persons after the two-and-half hour closed door meeting held between Core Commit tee on Naga Political Issue (CCoNPI) and the NSCN (I-M) at Rhododendron Hall, Police Complex, Chümouke dima on ZeliangSaturday.said NSCN(IM) has agreed to resume talks after the CCoNPI had made the request. He said NSCN (I-M) agreed to resume talks on the condition that “the talks should be based on the Framework Agreement and the formulation papers sub mitted by both RN Ravi and AK Mishra altogether.”
and the feeling of government of India to the negotiators” adding they were in no way involved with the negotiation.
Last week, the Serious Fraud Investigation Office had arrested a “master mind” behind several Chi nese shell companies op erating in the country. On September 8, it had carried out a alsotheLimited,namedHyderabad-basedianly-ownedJillianandoperationsearch-cum-seizureattheGurugramBengaluruofficesofConsultants,awholsubsidiaryofJilHongKongLimited.AcompanyHusysConsultingearlierlistedonstockexchanges,wasprobed.
ZCOs: Zeliangrong Civil Organisations (ZCOs) comprising of Zeliangrong Baudi, Zeliangrong Youth Front and Zeliangrong Stu dent’s Union expressed hope that with the signing of the joint accordant the “violent ridden Naga society” would now onwards witness violentfree atmosphere in all the Naga areas irrespective of jurisdiction and territorial of States and ZCOsregions.through its media and publicity cell hailed the decision of the Naga political groups and said that the latest
In a press release, GHI UU convenor Njio Semp in formed that the decision was taken at a general meeting held at Government Hindi Institute Dimapur Septem ber 15, 2022 attended by the trainee alumni of Govern ment Hindi Institute Students Union, Government Hindi Institute principal and staffs cum officials of All Nagaland Hindi Teachers Union.
HPZ token fraud case spread across India
“Order
DIMAPUR, SEP 17 (NPN):
Police also found 58 Razor pay transactions and six merchants where vic tims had deposited money out of which eight ICICI accounts were associated with the virtual payment addresses where victims depositedNotingmoney.that the case involved the hand of for eign hands, the State police sough the assistance of the Central Financial Intel
At a grand launch event, he said the policy aims to expedite the lastmile delivery, helping busi nesses save time and money.
GHIUU threatens to shutdown Hindi institute
addressing the media. (NP)
While the new pol icy addresses challenges of the logistics sector, it together with the infrastruc ture augmentation plan PM GatiShakti will address gaps, he said. For Indian products to capture world markets, the country has to strengthen its support system. “National Logistics Policy helps in making the support system modern.”
It was also learnt that the NSCN (I-M) members were also given a copy of the July 16, 2022 resolution adopted by the Core Committee.
DC issuesKohimaadvisory
DIMAPUR, SEP 17 (NPN):
When asked whether solution can be expected be fore the upcoming Assembly elections, Zeliang said that would entirely depend on both the NSCN (I-M) and Government of India on whether they were ready to sign the final agreement be fore the elections. As for WC/ NNPGs, Zeliang said they are prepared to sign the final agreement any time.
your own dish. It’s home delivered food today. No more complaints.”
‘Ball in GoI’s court’
ous Chinese controlled companies. It was also revealed that various other companies were indulging in receiving funds from public on the pretext of operating various applica tions or websites for gam ing, loans and others. ED suspected involvement of Jilian Consultants India Pvt Ltd, Gurugram, be hind various companies involved in these frauds.
Staff Reporter/Agencies
are then asked to bring in more investors to get more incentives apart from their investments by down line commission.Themode of pay ment was through an app downloaded from the HPZ website in virtual payment addresses/UPIs.Duringthe investiga tion, police said 30 bank accounts of victims were scrutinized with total de posit of Rs. 33,15,990 and Rs. 19,26,954 received with a net loss of Rs. 13, 89, 042.
ligence Unit Accordingly,(FIU).ED took up the case and seized Rs. 46.67 crore lying in various bank and virtual ac counts in connection with a money laundering probe involving the HPZ Token app that allegedly promised its users large gains against investments in mining ma chines for bitcoin and other cryptocurrencies.Paymentswere re ceived through UPIs and various other gateways. Some amounts were paid back to the investors and the remaining diverted to various individual and company accounts, while a part of the funds was siphoned off in the form of digital/virtual currencies.
Nagaland Tribes Council (NTC) and Zeliangrong Civil Organisations (ZCOs) have welcomed and appreciated the signing of the “September Joint Accordant” between NSCN (I-M) and Working Committee, Naga National Political Groups (NNPGs) at Sovima on September 14, 2022 in the presence of Fo rum for Naga Reconciliation (FNR).NTC through its media cell stated that a declaration of agreement to cease hostil ity between Naga brothers was a welcome measure and should endure in all times to come. NTC hoped that Naga people uphold and sustain
He said no new issues were discussed at Saturday’s meeting except whatever was conveyed to the committee by Amit Shah on September 12 and that the same was conveyed to NSCN (I-M) members. Zeliang said the committee had planned to meet with the prime minister in Delhi but that he directed the Home minister to meet the Core “conveytothatfinalNSCNNPIShahUnioncomesSaturday’sCommittee.meetingbarelyaweekafterHomeministerAmithadadvisedtheCCotoimpressuponthe(I-M)onsigningtheagreement.ZeliangalsoclarifiedtheroleofCCoNPIwasactasfacilitatorsandtothefeelingofNagas
We, the bereaved family members of Late Temsuliba Ozüküm would like to express our sincere gratitude to each and every individual for supporting us physically, materially, financially and spiritually during many months of his illness and at the darkest hour.
We, the bereaved family of Shri. JOSHUA KEMP No1321 4BC, DEF, Tseminyu, S/o. Kenyuseng Kemp, express our heartfelt gratitude, for your support and help during his illness until his demise on 12.09.2022.
It is our humble prayer that the Almighty God bless you all abundantly. have fought the good fight have finished the race have kept the faith” 2nd Timothy 4:7 Mom, Brothers, Sisters Loved Ones.
LH welcomes new LYH team: Lotha Hoho (LH) welcomed the new team of Lotha Youth Hoho at a brief farewell & felicitation programme at Lotha Tribal Council conference hall on September 17. The new team of Lotha Youth Hoho for tenure 2022-2025 will be led by Limhathung N Yanthan as president and Oreno Ngullie as general secretary.
Acknowledgement -1055/22Bd 18th September 2009 Your memory has walked beside us for 12 years, and we are so grateful for your company. For those we love don’t go away. They walk beside us everyday. - Loving Husband, Daughter and Family
We, the bereaved family members of Late S. M Chemang Konyak would like to express our profound gratitude to various Organizations, Churches, Medical Institutions, Individuals and Well Wishers who stood Chuchuyimlang. Bethel Mission Chuchuyimlang.Board, Baptist Fellowship, Shokhuvi CTC Staff, friends, neighbours, relatives and well wishers, who supported us emotionally, materially, financially and spiritually at the sudden demise of our beloved son on 10.09.2022.
&
ACKNOWLEDGEMENT dp-4477/22
DIMAPUR: Industrial Training Institute (ITI) Phek, conducted its first convocation ceremony at ITI hall Phek with SDO (C) Phek, Tsenthungo E. Ngullie as special guest on September 17. According to a DIPR report, Tsenthungo congratulated the passedout trainees and spoke about prevailing governmentownlivelihoodoutskilledproblems.unemploymentHesaidthetraineescouldlookforworkandearntheirandstarttheirbusinessesbyavailingschemes.Tsenthungoreminded
IAS association elects members: IAS Association Nagaland held its general body meeting on September 15 wherein, a new team was elected with Abhijit Sinha as president, Y. Kikheto Sema as vice president, Kesonyu Yhome as general secretary, Sushil Kumar Patel as treasurer and Temsunaro Aier as joint secretary.
13th DEATh ANNivErsAry of Late Tosheli
7. Lotha
It is our prayer that Almighty God bless you all specially: DEF. Tseminyu. P.O/P.S. Tseminyu, Staff- Rank & File. Tseminyu Old Town Baptist Church. Tseminyu South Village. T.O.T. Home Cell No. Chogi Range Tseminyu. Baptist Church Relatives
He opined that inlaws were pride and asset for the Lotha community, therefore, he reminded of the scripture Proverbs 5:1519 and expressed hope that the fellowship will enhance God’s blessings and strength the ministry of Lotha churches.Thepastor encouraged the gathering to keep up and be agents of peace and harmony.Heencouraged the women to be like queen Esther by exhibiting wisdom and to possess a courage like Abigail (1 Sam offeredandbyaddress,S.whileofferedLibonthungKLBCchairedthroughtoeventKLBCmessagedKonyakGeisuoTsensaliElizabeth25).Ngullie,Sangma,MarcusandC.Lwngnyeialsodeliveredshortontheoccasion.Thespeakersthankedfororganisingtheandwasconfidentstrengthenthebondsthefellowship.TheprogrammewasbywomenleaderEthelShitio,pastorYanthaninvocationprayerpastorMhonchumoLothadeliveredwelcomeprayerforin-lawsRev.SankilumaKikonpastorT.Chenithungthebenediction.
DC Tuensang informs on fire safety inspection: Deputy commissioner Tuensang, Kumar Ramnikant has informed departments, schools, colleges, commercial buildings, private buildings and shopping complexes in Tuensang town that an inspection on fire safety will be held from September 19 onwards to ensure safety and avoid fire incidents. All concerned have been requested to extend cooperation to the department.
He stated that AR was not only providing internal security for NE but was also providing security at border areas.The Major General advised them to respect and honour their battalion and
2.
Mr. Temsuliba Ozüküm Born : 03/08/1963 – Died : 14/09/2022
DIMAPUR, SEP 17
MYK C MYK C STATE2 NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022
not to disregard the image and honour of the unit or battalion.Healso expressed happiness that the future of Assam Rifles was in safe hands because of the recently attested soldiers, whilst also sharing gratitude to ARTC&S for training themItwell.may be mentioned that the recruits underwent rigorous training on weapon, drill, conventional and CI/CT training.
k-2193/22
Assam Rifles officers along with newly passed out recruits at ARTC&S Shukhovi on Saturday. (NP)
We, the family members of Late B Sangki Rose Mary Konyak wish to acknowledge the many expressions of sympathy and gestures of kindness shown to us following the sad loss of our mother on 8th September 2022. Our heartfelt gratitude to the people of Totok Chingha and Changlangshu village, neighbours and well-wishers, who has helped us from the time of her illness till her last breathe, providing emotional and practical support for us at these difficult times. And to those who helped in any way, your contributions made our loss bearable and pray that our precious Heavenly Father reward your gestures and acts.
Cleanliness prog at GHSS Chozuba
“ I
I
In this regard, he said the battalions and jawans at CI area expected soldiers from this training centre and school to be trained in such a way they would be able to fulfil all responsibilities assigned to them.
WSSU 2nd union assembly: Western Sumi Students’ Union has convened its 2nd union assembly on September 24, 11 pm, at Western Sumi Hoho office, conference hall, Chekiye village. WSSU has informed three representatives from each constituent units, one representative from the sub-unit, executive council, members of advisory board and former presidents of WSSU to attend the assembly. Unit(s) seeking to place agenda for discussion at the assembly have been asked to do so in writing, in the respective unit’s official letterhead, a day prior to the assembly.
12.
dp-4457/22 25:12:1973
Awomi k-2206/22
I
14. 1986 Batch, St. John's School, Tuensang. 15. Bendangalir Mershiba Aso Kidong. 16. Mershiba Aso Chuchuyimlang.Kidong, 17. The Morung Express. 18. Churches, Ministries, Friends & Families Wife and Family -4251/22dp Born: 19.06.1989 Died: 10.09.2022 We, the bereaved family of Late Thepfusalie Medoze (Asalie) would like to express our heartfelt gratitude and appreciation to all the groups and individuals, CVBC,
Loving Wife, Daughters & Relatives
by us financially, physically and spiritually during his prolonged illness and ultimate demise on 7th September 2022. Special thanks to1. Doctors and Nurses, Eden Medical Centre Dimapur 2. Doctors and Nurses, Zion Hospital Dimapur 3. Doctors and Nurses, CIHSR Dimapur. 4. Doctors and Nurses, Nikos Hospital. 5. Tobu Area Union Dimapur 6. Pessao Union Dimapur 7. Pessao Village Students’ Union 8. Echushu Clan, Pessao 9. Students’ Union NU:SASRD 10. Eastern Naga Students’ Union NU:SASRD 11. Ethereals B.Sc (Ag) 4th Year SASRD 12. Konyak Union Dimapur 13. Konyak Baptist Fellowship Borlengri 14. Konyak Baptist Bumeinok Dimapur 15. Konyak Baptist Youth Dimapur 16. Konyak Baptist Bumeinok Sheko Khong, Dimapur. 17. Harvest Prayer Home Borlengri. 18. Konyak Union, Borlengri 19. Pessao Bumeinok 20. Yeangmong Club, Pessao Village 21. Shri. Nangba Konyak, Missionary 22. Shri. S Yeangba, Commandant 11 IR 23. Shri. K.S Anden, (IAS) Secretary DUDA 24. Shri. N Bongkhao Advisor, DUDA 25. Shri. K Naiba Konyak, Ex-Minister 26. Shri. K Moba SDO, DUDA 27. Shri. K Ngame, Kilonser GPRN/NSCN 28. Shri K. Anden Peter, (Finance Secretary) GPRN/NSCN. 29. Shri. SB Poangba, former President KU Tobu WeBranch.regret our inability to mention each and every individual for the kindness rendered to our family. We are humbled by your good deeds and shall remain ever grateful. It is our earnest prayer that our Almighty God bless you abundantly. -Loving Wife, Children and ACKNOWLEDGEMENTRelativesdp-4473/22 Pastor C. Temjenmeren Jamir left for his heavenly abode on August 13, 2022. We are overwhelmed and touched by the outpouring of love and affection for this humble servant of the Lord who touched many lives with his passion and eagerness to serve our Lord. We would like to convey our heartfelt gratitude to the doctors and staff at St. Stephens Hospital, Delhi, who cared for him during his last days. The activities following his sad demise such as completing the legal formalities and preparing the mortal remains for journey would not have been possible without the initiative of Pastor Bendang Lemtur and the timely assistance of the Delhi Ao Baptist Church, Delhi Ao Senso Telongjem, friends, relatives and well wishers who also gave him a solemn funeral in Delhi. We will be forever in your debt. We would like to acknowledge everyone who attended the main funeral service in Aoyimkum, Dimapur and honoured his memory with moving tributes and reminiscences from his short but impactful life. Though we are unable to name everyone in this message, we assure you of our deepest gratitude and it is our prayer that God bless you manifold for your kindness. In conclusion, we would like to specially acknowledge the following persons and organizations for their assistance. ACKNOWLEDGEMENT 1. Rev Dr Alemrenba, Delhi 2. The Lighthouse Church 3. Sinai Ministry 4. Asia Harvest Alliance 5. Aoyimkum Baptist Church 6 Aoyimkum Village Council 7. Aoyimkum Lanur Telongjem 8. Kacharigaon (Phevima) Baptist Church 9. Chuchuyimlang Baptist Church 10 Dimapur Area Chuchuyimlang Senso Tamang Telongjem 11. Riongsanger Tanabuba Sungbo Zunga,
5.
Phek
In a press release, GHSS Chozuba, NSS programme officer Angelo Pfithu stated that the speaker expressed hope that every student and teacher would create more awareness on harmful use of plastics.Atthe programme, cleanliness drive and poster campaign were conducted. The programme was chaired by Angelo Pfithu, opening prayer by PGT Augustine Phom while PGT Shekuto Rhakho read out “Swachhta pledge”.
3.
A CKNOWLEDG E MENT
13. Ao
KLBC ‘in-lawsorganisesfellowship’
We pray that our Almighty God will continue to bless you all abundantly.
NEWS IN BRIEF
T. T. Loving Parents, Wife, Children and
In his message, KLBC senior pastor, Rev. Dr. K. Benry Lotha thanked the in-laws for responding to the invitation and acknowledged them for trusting the daughters and sisters of Lothas, in spite of shortcomings.Rev.Dr. Benry said it was only a mother who would nourish, care and raise the children and will stand by the family till her last.
(NPN): Assam Rifles Training Centre and School (ARTC&S) Shukhovi conducted an attestation parade for 160 recruits here on Saturday.Thesoldiers were recruited as part of the “compassionate grounds” recruitment carried out by Assam Rifles (AR) for war widows and wards of fallen heroes.The attestation parade was reviewed by Major General, Vikas Lakhera, Sena Medal Inspector General Assam Rifles (North) in the presence of Brigadier SK Sheoran, Yudh Seva Medal, Sena Medal.Addressing the jawans, Major General Lakhera stated that the main objective of ARTC&S was to build strong and capable soldiers by providing
Correspondent
1.
Thank You
9 6.
Staff Reporter
KOHIMA, SEP 17 (NPN): Kohima Lotha Baptist Church (KLBC) organised an “in-laws dinner fellowship” in the church premises, here, on September 16.
ACKNOWLEDGEMENT
4.
"If we live, we live for the Lord; and if we die, we die for the Lord. So, whether we live or die, we belong to the Lord." Romans 14:8
DIMAPUR: GHSS Chozuba under the aegis of NSS Chozuba observed “Swachhata Pakhwada” with vice principal GHSS Chozuba, Vesuzo Swuro as speaker, on September 14.
ITI holds convocation ceremony
the passed-out trainees that the future was already in their hands and that whatever they have been trained for, would determine their Earlier,tomorrow.the special guest performed the convocation ceremony by lighting the lamp, handing certificates and felicitating meritorious trainees. At the programme, Government ITI Phek principal Er. N. Nyaksham Phom declared the convocation ceremony and delivered the welcome speech while ITI first year batch presented a folk song.
high quality training and disciplining the body and mind.He expressed happiness to see that the centre was playing its role by providing high-quality training.Lakhera said since independence, most battalions and range headquarters of Assam Rifles were “battling with militancy” and “disruptive forces in Counter Insurgency (CI) area”.
Loving Dad,
160 AR recruits pass out from ARTC&S
Loving Family Members and Relativesk-2199/22 – 7:9:2022
certification.Shesensitised the participants on the three key determinants that a facility must possess be fore pushing forward for certification which includ ed—good NHP,thankstochairedopeningmatuladucted.awereassessmentamongworkneedlowedproceduresaddedtion.andcommunityinfrastructure,participationproperdocumentaDr.Maongkalaalsothatprotocolsandshouldbefolaccordingtotheofthefacility.Shesaidaproductivedivisionwasvitalthestaffandself-onareaswhichofconcern.Attheprogramme,Q&AsessionwasconEarlier,CMODr.LiAierdeliveredtheremarks.TheprogrammewasbyNHP,PukhaWotsawhilevoteofwasproposedbyAchumPatton.
Minority morcha: Members of minority mor cha BJP Nagaland organised a blood donation camp at District Hospital, Dimapur.
DIMAPUR, SEP 17 (NPN): Livingstone Foun dation International (LFI) College, department of Education, organised a career talk on the theme “Reveles Optimum” (dis cover your best), in the school auditorium, here, on Saturday.Atthe programme, resource person, Assistant Commissioner of Police (ACP) Chümoukedima, Ninoto Zhimomi, spoke on the topic “identifying one’s true calling” and “steps to choosing a ca reer”.He stressed on the importance of focus and conscious effort with con centration, and encour aged the students to have an unbiased holistic at titude towards life.
DIMAPUR: Nagaland state Bharatiya Janata Party (BJP) began the 16-day “Seva Pak hwara” programme to mark prime minister Narendra Modi’s 72nd birthday cele bration on Saturday. During the fortnight, party work ers will render services in various activities including blood donation, organising free health camps, equip ment for handicapped per sons, vaccination drives, etc.
BJYM Nagaland: BJYM Nagaland along with the rest of the nation organ ised blood donation camps across the state in the dis tricts of Dimapur, Kohima and Mokokchung which are being overseen by the respective BJYM Nagaland district units.
certification under PHC category in the month of July 2022, held an NQAS knowledge exchange pro gramme, organised by Nagaland Health Project (NHP) with participants
In a press release, commis sioner of police (CP) Dimapur, Rothihu Tetseo acknowledged their outstanding contribution in the field of policing.
DIMAPUR: The District Development Coordi nation and Monitoring Committee (DISHA) of Zunheboto district held a coordination meeting, led by member of parlia ment (MP) Lok Sabha, Tokheho Yepthomi, in the conference hall of the deputy commissioner (DC) on September 16, under the chairmanship of DC Zunheboto Rahul Bhanu das Mali.
SEPTEMBERFORECASTWEATHER18
farewell to 19 officers
At the meeting, presentations.invitedEEtrolAIDSdepartment,PublicsourcesficerDistrictcultureEECivildepartments—FoodeightandSupplies(F&CS),PWD,DistrictAgriOfficer(DAO),HorticultureOf(DHO),LandRedepartment,EEHealthEngineeringDPODistrictPreventionandConUnit(DAPCU)andWaterResourceswereforPowerPoint
DIMAPUR: The Dimapur Police Commissionerate on Saturday, bade farewell to 19 outgoing of ficers on transfer/posting.
Zunheboto DISHA takes up implementation of schemes
In a press release, state BJYM general secretary, Imnaningkum Longkumer stated that this unique ini tiative was being done in close coordination with the ministry of Health and Fam
The outgoing officers in clude—ADCP Chümoukedima Tokavi Achumi, ACP (SB/crime) Ketoukhrielie Metha, ACP (traf fic) R. Randanbemo Ezong, ACP East Dimapur Seyiesezo Peseyie, ACP (Traffic) Chümoukedima T. Henthai Phom, ACP West DimapurJohnny M. Patton, ACP Ni uland K. Vekato Chishi, OC East Police Station R. Khondao Pat ton, OC GRPS UBI Zupenthung Lotha, OC Traffic Chümoukedima UBI Peter Shuya, OC SBN Police Station UBI Y. Picto Achumi, CI Dimapur UBI K. Lukhezhe Sumi, OC Traffic Dimapur UBI N. Mhao Ngullie, OC West Police Station UBI Chubaonen, UBI S. Bokato Sumi, OC Chümoukedima Police Station UBI Ngunietso Rio, OC Diphupar Police Station UBI Hi noto, IC Mobile Unit ABI Toviho Sema and M TI Er. Rhonbemo Kikon.
Dimapur CommissioneratePolicebids
Members of BYJM Dimapur at the blood donation camp on Saturday.
DIMAPUR, SEP 17 (NPN): With an objective to raise awareness among students on different career choices, Pilgrim Higher Secondary School (PHSS) Dimapur organised an “edu cational fest” at the school premises, here, on AddressingSaturday.the students, deputy commissioner (DC) Dimapur, Sachin Jaiswal lauded the school for organis ing an event that brought together an inspiring crowd of people for students. He encouraged the students to take in every drop of knowledge they acquire at the fest and not to be preju diced towards the career they choose.
LFI College organises career talk
PHSS organises educational fest
Staff Reporter
Speakers and guests at the educational fest organised by PHSS on Saturday. (NP)
Kumar led the donors along with other office bearers of the state & district units.
A total of 30 units were donated by the party mem bers.
NQAS knowledge exchange programme at Mongsenyimti
One of the speakers addressing the healthcare workers and participants at the programme.
FACworkshopnationalconducts
DIMAPUR: Research and Development Cell of Fazl Ali College (FAC) in col laboration with department of Sociology, Nagaland University, conducted a national workshop on “re search methodology” on September 14.
Faculty members of LFI College along with ACP Chümoukedima Ninoto Zhimomi on Saturday. (NP)
He stated that the officers have left an indelible mark towards public service and the vacuum of their service to the unit will be felt.
Targeted audiences at the edu cational fest included students from classes VIII and above. Students from neighboring schools were also invited to the fest.
He encouraged the students not to get carried away by what people will think and to do whatever inter ests them with honesty, sincerity and dedication.Nagaland has a very higher lit eracy rate compared to other states however, the problem of unemploy ment is high, DC said.
In a press release, FAC information and publicity cell stated that the work shop was divided into four technical sessions, wherein, the first session on “report writing in research method ology” was presided over by HoD, department of Soci ology NU, Prof. Athungo Ovung.Prof. Athungo high lighted basic tips on writing research report and spoke on “ethical con sideration in research” in the second session.
from Wokha, Longleng, Zunheboto, Tuensang and Mokokchung districts on September 16 at PHC Mongsenyimti.Inapressrelease, of fice of the chief medical
He stated that the Naga society must come out of the mindset of doing only comfortable jobs such as govern ment jobs or staying unemployed. At the fest, a total of 14 representatives from the field of education, music, hospitality & aviation, fashion, bank, business, Indian Air Force, sports, medical and NCC attended the event.
The representatives exhorted the students on prospects of choosing their careers through the right routes, depending on their calibers.
DC Zunheboto Rahul Bhanudas Mali and MP Lok Sabha Tokheho Yepthomi addressing the DISHA meeting on Saturday. (DIPR)
The unit conveyed its best wishes to the police officers and expressed hope that wisdom would continue to be the guiding force in their future assignments.
Staff Reporter
officer (CMO) Mokokc hung stated that deputy director, Health & Family Welfare (H&FW) Kohima, Dr. Thomas Keppen while speaking on “introduction to knowledge exchange on NQAS”, enlightened the participants on the definition of quality and why it was required at a healthHecentre.stated that the purpose of knowledge exchange programme was to create opportunities for gross learning and to im prove facilities throughout the state.During a presentation on the journey of PHC Mongsenyimti to NQAS, MO PHC Mongsenyimti, Dr. Maongkala said that the cooperation from staff, CMO, deputy CMO Mo kokchung, quality man ager, infrastructural devel opment funded by NHP, HCMC and community of Mongsenyimti village paved way towards NQAS
Tokheho took note of the grievances and reports presented and assured to help in every possible way. He stated that the next coordination meeting will be held in dour monthstime.
Pointing out that a person was the best judge of his capabilities, Sachin said parents were number one cheerleaders and guides, however, he stated that one should also have their own choices.
In a press release, Mi nority Morcha BJP Na galand media cell stated that morcha president Deep
In the third and the fourth sessions, professor and director, School of Social Sciences, KKH State Open University, Guwahati, Prof. Joydeep Baruah spoke on quantitative aspects of conducting research.
one’s own caliber inorder to pursue their career. The lecture was fol lowed with an interaction where students and faculty members asked questions on various career pros pects.The programme was chaired by BA first semes ter Taliwapang, invocation was offered by assistant professor, department of Education Nilovi, spe cial song by Aleminla of BA first semester and introductory note by Liv ingstone Foundation In ternational College vice principal Dr. Tainla Mar. The session ended with a vote of thanks from Lonjong Ngonyen of BA third semester.
Ninoto said one should inculcate perse verance, focus on goals and concentrate on how to achieveCitingthem.the example of the story the hare and the tortoise part-wise, the ACP encouraged the stu dents to work hard and smart, to be consistent in life and to avoid com parison.Further,
ily Welfare.Onthe first day, Dima pur District Hospital saw a total of 26 donors while Mokokchung registered a total of 16 nobleededOctobertionformedinformed.TBtheperiodofleastalsoacrossBJYMdonors.karyakartasthecountryhavebeenaskedtoadoptatoneTBpatientaspart“TBMuktBharat”foraofatleastoneyearasnationseekstoeliminateby2025,ImnaningkumBJYMNagalandinthattheblooddonacampswillculminateon2.Inthisregard,interestdonorshavebeenrequesttocontributetowardsthecause.
He spoke on “how to do sampling” and “how to generalise sample results”.
Altogether, 57 partici pants from various colleges along with research scholars attended the programme.
Nagaland state BJP kicks off 16-day ‘Seva Pakhwada’
Ninoto said since they (students) were at the best stage of their lives, they must take the advantage of knowing
MYK C MYK C dc-1057/22 3STATENAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022 Q.: Will the church continue with its Clean Election campaign? A Yes. 52% B No. 35% C Can’t Say. 13% 100%90%80%70%60%50%40%30%20%10%0% nagalandpost.com Poll A B C NEXT POLL Q: Has the death of Queen Elizabeth, made British people less attached to their monarchy? Yes. No. Can’t Say. (Temperature in ºC) Max Min Agartala A stray afternoon t-storm 32 26 Aizawl A p.m. t-storm in spots 28 21 Guwahati A t-storm around in the a.m. 34 26 Imphal Occasional morning rain 29 21 Itanagar A t-storm around in the a.m. 33 24 Shillong Cloudy with a thunderstorm 25 19 Kohima A thunderstorm in spots 26 19 Dimapur A stray morning thundershower 33 25 Mkg A stray afternoon t-storm 29 20 Tuensang A stray morning thunderstorm 23 17 Wokha A t-storm around in the a.m. 29 22 Zunheboto A p.m. t-storm in spots 26 18
Have an open mind and evaluate extensively to be sure of the career you want, DC stated.
According to a DIPR report, the members of the coordination commit tee headed by MP thor oughly deliberated various schemes and their imple mentations in the district.
DIMAPUR: Prima ry Health Care (PHC) Mongsenyimti, under Mokokchung district, which was awarded the National Quality Assur ance Standards (NQAS)
OFFICE OF THE YAONGYIMCHEN VILLAGE COUNCIL
During the period, party workers will arrange blood donation camps, free health check-ups, distribute equipment among differ ently abled persons and conduct vaccination drives.
pura, the prime mi nister and his cabinet colleagues have extended full sup port. They have been kind enough,” he said, adding that Delhi had always been keeping a close watch on the functioning of the state government.“Wedon’t have spare time at hand as minis ters are always on the run, working for the betterment of the poor,” Saha main tained. Seeking people’s
GANGTOK, SEP 17 (PTI): Five political parties of Si kim figure among 86 regis tered unrecognised political parties which were delisted recently by the Election Commission of India (ECI), the state’s Chief Electoral Officer (CEO)’s office said on Saturday.Thedelisted registered unrecognised political par ties from Sikkim are Sikkim Gorkha Prajatantrik Party, Sikkim Himali Rajya Pari shad Party, Sikkim Jan-Ekta Party, Sikkim Liberation Party and Sikkim Sangram Parishad, it said. The CEO’s office said that If any political party felt aggrieved with this de cision of the EC they may approach the Office of Chief Electoral Officer, Sikkim or the ECI within 30 days from the date of issue of the aforementioned order along with all evidence of existence, other legal and regulatory compliances in cluding year-wise annual audited accounts etc.
1. Miss Lipoklemla. Jamir, D/o Mr. & Mrs. Odinungsang for securing the post of Assistant Geologist, Class-I Gazetted, under Geology and Mining Department in the recently declared NPSC (CTSE) Exam.
NORTHEAST4 NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022
FELICITATION With immense pride and honour, we the Northern Angami Mere Yiemiako (NAMY) extend our heartiest congratulations to the following candidates who had successfully cleared recently the CTSENPSC Examination, 2021 & CESE-NPSC Examination, 2019. Ms. RUOPFÜNUO MEZHÜ D/o Mr. Medoletuo Mezhü & Mrs. Vizakie-ü Mezhü, Assistant Research Officer (Class II Gazetted) under Soil & Water Conservation Department. Mr. RUOVITSO MEZHÜ S/o Lt. Kiyawhezo Mezhü & Mrs. Khrieliebei Mezhü, Librarian (Class I Gazetted) under Higher Education Department through recently declared CESE-NPSC Examination, 2019. Dr. KEDUONEILHOU MERE S/o Mr. Sobou Mere & Mrs. Tuozoü Mere, Medical Officer (Class I Gazetted) under Health and Family Welfare Department. Er. VITSEIKUONUO MERE D/o Mr. Ketoulhouvi Mere & Mrs. Khriesetuoü Mere, Junior Engineer (Civil Engg.) (Class II Gazetted) under Power Department. k-2302/22
FELICITATION
k-2201/22
(YANGTHRIBA
ITANAGAR, SEP 17 (PTI):
“We, as Indians, are lucky to have Modi as our prime minister,” Khandu said. “Modi has brought about productive and peo
5 Sikkim political parties among 86 delisted by ECI
1.Examination.
Arunachal Pradesh Chief Minister Pema Khandu on Saturday heaped praise on Prime Minister Narendra Modi for his political acu men and leadership which “guided the country in general and this northeast ern state in particular to achieve several milestones”.
While the protest was in progress, a police team arrived and asked the par ticipants to cut short the event as told them they were organizing the event without prior permission from the competent au thority.When the MPYCC
SANGTAM) President Seyochung Village Union Kohima.dp-4452/22k-2205/22
“Whenever we have sought something for Tri
Kiyaselie
protest, the police stayed away and sent them free hand to do whatever they wanted.“This is not democ racy. The BJP is running a dictatorial form of govern ment. The BJP government in the state is more danger ous than that of Hitler’s rule,” he said.
President, CKTD Convenor, Edn. Trust Fund Committee Dimapur, CKTD, Dimapur, Lipoklemla Jamir Miss Alemmongla
The Forum wishes them good health and further wishes them the best in their new assignments.
The protest began with cutting a cake with Prime Minister Narendra Modi’s portrait on the cake.
Er.
Nagaland OFFICE OF THE CHUCHUYIMLANG STUDENTS' UNION Dimapur : Nagaland FELICITATION Miss
Congratulations!
The Manipur Pradesh Youth Congress Commit tee leader further accused the BJP government of targeting youths who raised their voice against the gov ernment.Hesaid youths who protested against a govern ment policy were targeted by government agencies.
OFFICE OF THE NORTHERN ANGAMI MERE YIEMIAKO
The transformation that came about in India under his leadership says it all,” the chief minister said. The BJP has organised fortnight-long Seva Pakhwada till October 2 across the country.
He alleged that since the BJP came to power
FELICITATION
With immense pride and honour, the Education Trust Fund Committee of Chuchuyimlang Students' Union, Dimapur would like to extend our heartiest congratulations to the following members for their achievements.
Correspondent
SHILLONG, SEP 17: The Comptroller and Auditor General (CAG) has found out that budget estimate prepared by the Meghalaya government was ‘not realistic”.
“Test check of the records on sale, trade etc., state excise, motor vehicles tax, forest receipts and other non-tax receipts
4. Mr. Merentoshi. Jamir, S/o Mr. & Mrs. Limawati. Jamir for ranking Toppers in the AISSC Examination (Class-XII)-2022 from Delhi Public School, Dimapur. The Committee wishes them greater success in their future endeavours. Sd/- Sd/(Mr. Imliakum) (Mr. L. Obangtemsu)
IMPHAL, SEP 17: Ma nipur Pradesh Youth Congress Committee (MPYCC) alleged that the BJP government in Manipur is more severe than that of Hitler’s rule when the police intervened to foil a protest by members of the MPYCC in Imphal on Saturday.Joining the nation wide observance of “Na tional Unemployment Day ‘’, members of the MPYCC today staged a protest in front of the state employ ment exchange office in Imphal’s Lamphelpat.
AG ARTALA, SEP 17 (PTI): With Tripura slated to go to polls in the first half of next year, Chief Minister Manik Saha on Saturday launched ‘Har ghar su shasan’ (good governance in every household) mis sion in the state, a public outreach programme of the BJP-IPFT government, coinciding it with Prime Minister Narendra Modi’s birthday.Saha, on the occasion, announced that social pen
Sd/DR. TINENLO JEMU DR. GWATHONLO TSELA President, TGOF General Secretary, TGOF
Asserting that “Naren dra Modi and development go hand in hand”, the CM said the country should be proud of the PM, “who only works for welfare of all sections of the people”.
OFFICE OF THE TESOPHENYU GROUP OFFICERS’ FORUM DIST. TSEMINYU, NAGALAND FELICITATION Shadrak Kath Dr. Hishalo Tsela Er. Sohyulo Seb
Mere President, NAMY General Secretary, NAMY
He cited the Agnee path scheme as an instance and claimed that VDF (Vil lage Defense Force) which the Congress government had introduced in the state was far better than the Ag nipathUnderscheme.the Agneepath scheme, the service period is only four years, while a VDF personnel is allowed in the service until he gets a more secure job, he said.
Meghalaya budget estimate
(Y. Renbonthung Lotha) (Nyanbemo Shitio) Chairman, kLLE Secretary, kLLE k-2204/22
MYK C MYK C We are extremely proud and delighted with your tremendous achievement and for bringing laurels to our NAMY. It is our prayer that our Lord will continue to bless you all with good health and more success in your future endeavors. Ruokuotuolie Mere
Dist: Longleng -798625, Nagaland
He urged upon his col leagues in the government, BJP workers and other stake holders to commit them selves to the service of the state and its people.
will continue till November 30. Action speaks louder than words and this initia tive will do just that – reach out to public with the bene fits of welfare schemes,” he said at a programme here.
The youth leader fur ther accused the Narendra Modi led BJP government at the Centre of destroying the youths of the country.
support for the ‘Har ghar sushasan’ mission, the chief minister underlined that a state won’t be able to pros per without support from the masses.Deputy Chief Min ister Jishnu Dev Verma, who was also present at the programme, said the government would present a report card of its perfor mance before people after completion of the outreach programme.
FELICITATION
Sd/- Sd/Likok Phom Teongliba Phom Chairman Secretary k-2187/22
Correspondent
The CAG report was tabled Chief Minister Conrad Sangma on the last day of the autumn session on Friday.
Sd/- Sd/- Sd/Nungsangwapang Ayimpongla Anokba Longkumer President, MSTK President, ATTK President, MALT
The Tesophenyu Group Officers’ Forum with immense delight and honor conveys its heartiest congratulations to the following individuals of Tesophenyu Group for their tremendous achievements and outstanding performances in the recently declared result of NPSC (CTSE)
The Mopungchuket Senso Telongjem (MSTK), Ao Temolungtsur Telongjem (ATTK) and Mopungchuket Ait Laishir Telongjem (MALT) Kohima , extend our heartiest congratulations to Dr. Imnajungla , D/o Mr. Yangersashi Jamir and Mrs. Bendangtula for her success in the Combined Technical Services Exam conducted by NPSC and securing the post of Medical Officer (Class-I Gazetted) under Health and Family Welfare Department.
Mr. Imkumrenba. Longkumer Mr. Merentoshi. Jamir
In its report for the revenue sector till March 31, 2020, the audit report also revealed that the state government has lost over Rs 1,160 crore in revenue owing to underassessments and other factors.
The Ekhung further wishes him the best and greater success in his future endeavours.
Tripura CM announces social pension hike of Rs 1K
k-2198/22
“India is such a diverse country; running it is not an easy job. I believe the right person became the prime minister at the right time.
at the Centre eight years ago, youths did not get job opportunities even though the party had promised to provide two crore jobs each Insteadyear. of offering jobs to youths, the BJP is destroying the future of the youths, he said.
On the occasion, Khan du also welcomed former minister from Tirap district, Tinkhap Taiju, into the BJP fold. Taiju, who was the state vice-president of the Congress, quit the grand old party recently.
1. Mr. Simon Sangsa Phom, S/o Shri. Akumba Phom for clearing the NPSC (CTSE) & securing the post of Agriculture Marketing Inspector under Agriculture Department.
Members of MPYCC cutting a cake with picture of PM Modi on it in Imphal on Saturday.
The Yaongyimchen Village Council extends our heartfelt congratulations to:
2. Miss Alemmongla, D/o Mr. & Mrs. Repatemjen for ranking first position (Departmental Topper June 2022) in Master of Technology in Computer Science and Engineering from National Institute of Technology Nagaland.
dp-4474/22 OFFICE OF THE SEYOCHUNG VILLAGE UNION KOHIMA KOHIMA : NAGALAND Ref. No : SVUK/ADV/222/ Date Kohima : 17th Sept’ 2022 FELICITATION Seyochung Village Union Kohima with great joy and honor extends our heartiest congratulations to Ms. Yanglikhumla Sangtam, D/o Shri. L. Kyurimong Sangtam for securing the post of Junior Engineer (Class-II Gazetted) under Works and Housing Department in the recently declared CTSE – NPSC examination 2021. Filled with wonder and delight with your achievements for bringing laurels to our Union and Village, the union further wishes you good health and greater success in your future endeavours.
In line with Modi’s call to make India tuberculosisfree by 2025, party workers will also adopt patients suf fering from the disease in their respective areas.
conducted during the year 2019-20 andpayment,controlsearningbut293levy/losshasEnvironment,Taxation,audittheofmanyunderassessment/short/non-levy/lossrevealedinasas498casesamountingtorevenueloss1,166.89crorewhichis48.19percentofstate’sowntaxrevenuefor2019-20,”thereportrevealed.ThedepartmentofMiningandGeology,ForestandStateExcise,andTransportacceptedunderassessment/short/non-ofrevenueofRs376.97croreincasespointedoutbyCAGin2019-20therecoverywasonlyRs12.81crore.Theauditalsonoticedthattherevenuedepartmentshadweakinternaltodetectunderassessment,shortevasionoftaxes,fees,royaltiesotherirregularities.
sion would be hiked from Rs 1,000 to Rs 2,000 start ing September, a promise made in the BJP’s vision document unveiled before the 2018 Assembly elec tions.A total of 3,89,439 people would be benefited from the “Thescheme.programme -‘Har ghar sushasan’ -- is aimed at generating aware ness among people about central and state govern ment’s welfare schemes. It
ple-friendly reforms in gov ernance. His dedication, political acumen and leader ship guided the country in general and Arunachal in particular to achieve several milestones.“Wehave always tried our best to follow his advice. And with much pride, we can say that we have effected several game-changing re forms. I dedicate whatever we, as a state government, have achieved in the last six years to our prime minister,” the CM maintained.
2. Er. Y. Manphen Phom, D/o Shri. Yangpong Phom for clearing the NPSC (CTSE) & securing the post of Junior Engineer (Electrical Engg.) under Power TheDepartment.Councilfurther expresses profound gratitude and wishes them unending blessings and greater success in all their future endeavours.
members continued the event, the police snatched the banner displayed and ordered members to leave the place which was fol lowed by a heated exchange of words.Talking to report ers covering the event, MPYCC leader N Pop pilal alleged that the police always disturbed peaceful and democratic forms of protests staged against the government.Hesaidwhen the BJP members indulged in vio lent activities during their
Er. Shadrak Kath, son of Mr. Thunyi Kath & Mrs. Cheniya Kath, SDO (Civil Engg.) (Class-I Gazetted) under Works & Housing Department.
The Kohima Lio Longidang Ekhung (KLLE), takes pride to honour and convey its heartiest congratulations to Dr. Wothungo L Jami, S/o Mr. Y. Limomo Jami and Mrs. Meribeny of Lio Longidang Village for clearing NpSC (CTSE-2021) and securing the post of Medical Officer (Class-I Gazetted) under Health & Family Welfare department.Yourhard work, determination and dedication have finally paid off with a rich dividend bringing laurels to our community and Lio Longidang Village in particular.
‘Modi guided Arunachal to achieve several milestones’
‘not realistic’: audit report reveals
3. Er. Sohyulo Seb Rengma, son of Mr. Ashenbu Seb & Mrs. Ashenle Seb, JE (Civil Engg.) (Class-II Gazetted) under PHE Department.
Khandu, on the opening cer emony of ‘Seva Pakhwada’ (service rendering for fort night) here, marking Modi’s 72nd birthday, said the PM has ensured the overall de velopment of Arunachal Pradesh and its people.
Mnp Cong observes ‘National Unemployment Day’
May your success be an inspiration to the youngsters and your service be a blessing to every Naga. Wishing you all success in your future endeavours.
3. Mr. Imkumrenba. Longkumer, S/o Mr. & Mrs. Puronen. Longkumer for ranking toppers (ST), NEET (UG)-2022 from Nagaland.
2. Dr. Hishalo Tsela, son of Mr. Lameshe Tsela & Mrs. Jvule Tsela, Veterinary Assistant Surgeon (Class-I Gazetted) under Animal Husbandry and Veterinary Department.
Pema Khandu
Nagaland
“Looks like they are suffering a lot in Gujarat,” Delhi Chief Minister Ar vind Kejriwal said in a tweet in Hindi in an apparent at tack on the BJP.
Youth Congress activists stage a protest over the issue of unemployment, outside party office in Bhopal, Saturday. (PTI)
Now, Amanatullah has been arrested. More MLAs will now be arrested,” the AAP national convenor said in his tweet. Reacting to Khan’s arrest, Delhi Deputy Chief Minister Manish Sisodia ac cused the BJP of continuing with its “Operation Lotus” to “break” AAP leaders away from the party.
failure and needed to be reviewed.Kishor, who has launched a campaign ‘Jan Suraaj’ as part of which he will be embarking on a 3,500 km-long state-wide ‘padayatra’ next month, had also claimed to have turned down a “specified” offer from Kumar who, he be lieves, has run out of steam.
(PTI): The Congress on Saturday claimed that in view of the “worrying” job situation in the country, the youth are marking Prime Minister Narendra Modi’s birthday as “National Un employment Day”, and demanded that he provide employment to them as promised.The opposition party also greeted Prime Minister Modi on his 72nd birthday and wished him good health and a long life.
special“Givendays. his love for children, Nehru Ji’s birth day is marked as Children’s Day, Indira Ji’s birthday is celebrated as Communal Harmony Day and Rajiv Gandhi Ji’s birthday is cel ebrated as ‘Sadbhavna Di was’.“In fact, even Atal Ji’s birthday in December is celebrated as Good Gover nance Day, which is why it worries and pains me that Mr. Modi’s birthday is be ing celebrated by the youth
NEW DELHI, SEP 17 (PTI): A 15-day blood do nation drive began on the occasion of Prime Minister Narendra Modi’s birthday on Saturday, with Union Health Minister Mansukh Mandaviya donating blood at a camp set up at Safdar jung Hospital here.
Lalan claimed, “It was Prashant Kishor who want ed to meet Nitish Kumar after the new political situ ation emerged in Bihar. He spoke to the CM who asked him to first have a word with the party president. So he came to meet me in New Delhi.” “I told him that his return to the party could be considered if he agreed to abide by party discipline. Thereafter he secured an appointment with the CM who agreed to meet him and gave an appointment. But, as part of his marketing strategy, he told the media that he has been called to the CM’s residence but he will not go,” claimed the JD(U) president.“Later, after Pavan
The drive aims to col lect close to one lakh units of blood in a day besides raising awareness about the need for regular non-remu nerated voluntary blood do nations. One unit translates to 350 ml of Stressingblood.on the im portance of voluntary blood donation, the Union health minister said, “Rak tdaan Amrit Mahotsav is part of bigger celebrations of the Azadi ka Amrit Mahostav”.The campaign aims to increase awareness about regular non-remuner ated voluntary blood dona tions and ensure that blood or its components (whole blood, packed red blood cells, plasma, platelets) are available, accessible, afford able and safe.
“Why is it that despite praising you in public, the private sector is not willing to invest and hence jobs are not being created? Because investment is an act of faith, isn’t it clear that they don’t believe in your policies? Also, is your excessive focus on just one or two billion aires, the ‘Hum Do, Humare Do’ model, leaving out the rest of the Indian industry to create jobs,” Shrinate asked.
have donated Mandaviyablood.urged citi zens to register on the Aaro gya Setu app or e-Raktkosh portal to donate blood as part of the ‘Raktdaan Amrit Mahotsav’, which will be held till October 1 -- Na tional Voluntary Blood Do nation“BloodDay. donation is a noble cause and given our rich culture and tradition of Seva and Sahyog, I urge and appeal to all citizens to come forward and donate blood
“Each time you men tion unemployment and price rise, they want to talk about unnecessary, irrel evant, distracting issues and they promote disinforma tion,” the Congress leader alleged.Shrinate also listed the Congress’ posers for the prime minister, asking where are the two crore annual jobs and why are 60 lakh central and state gov ernment posts lying vacant.
as part of the countrywide mega voluntary blood dona tion drive- Raktdaan Amrit Mahotsav. Donating blood not just fulfills the national requirement but is also a great service to society and humanity,” Mandaviya said.
The Aam Aadmi Party legislator from Okhla was arrested by the Anti-Cor ruption Branch on Friday in connection with alleged irregularities in Delhi Waqf Board recruitment, officials said. Khan is the chairman of Delhi Waqf Board.
“Our ideological and political battles against him continues. His personal ven detta against us intensifies. Even so, here is wishing and greeting our Prime Minister Narendra Modi on his 72nd birthday,” Congress general secretary in-charge commu nications Jairam Ramesh said in a Addressingtweet. a press conference at the AICC headquarters here, Congress spokesperson Supriya Shri nate said the birthdays of Indian prime ministers have always been celebrated as
N EW DELHI, SEP 17
NEW DELHI, SEP 17
“First, they arrested (Delhi health minister) Sa tyendar Jain. They are not able to present any evidence despite the court repeatedly asking for it. Then, Man ish’s residence was raided, nothing was found there.
JD(U) president Rajiv Ran jan Singh alias Lalan on Sat urday alleged that fetedprohibition,CM,plain-speaktowhichKumardaysremarkssucceed,”notButititconspiraciespresidentreferenceJD(U)checking,”lyagenttheKishor“marketing”businessman”“notcampaignLalantheMinisterdownclaimfirmitsingPrashantstrategist-turned-politicianpoliticalKishorwas“workfor”theBJP,aspartof“conspiracies”tofindafootholdinBihar.RubbishingKishor’sofhavingturnedan“offer”fromChiefNitishKumar,party’sdefactoleader,assertedthatthepollmanagerwasapoliticalworkerbutawhoreliedontactics.“WeknowPrashanthasbeenworkingforBJPforsometime.OneoftheBJPwasrecentcaughtduringmagistrateremarkedthechief,inanobvioustoformernationalRCPSingh.“TheBJPisrelyingoninBihar.FirstusedRCPSinghandnowisusingPrashantKishor.wearevigilant.WewillallowthesedesignstoLalansaid.TheJD(U)president’scomebarelyafewafterameetingbetweenandKishorafterthelatterclaimedhaveengagedinsomewiththeBiharhavingtoldhimthatoneofhismostmoves,wasacomplete
from his residence during a raid conducted by the ACB on Friday. The ACB had raided four premises, includ ing the residences of Ali and Khan, on Friday in connec tion with alleged irregulari ties in the recruitment to the Delhi Waqf AccordingBoard.to the po lice, three FIRs were regis tered after the ACB raid.
FIRs was registered against Ali (54), a resident of Jamia Nagar, the second FIR was registered against Kaushar Imam Siddique, a resident of Jogabai Extension, under the Arms Act after a coun try-made pistol and three live rounds were recovered from his premises as well, policeSiddiquesaid. is evading arrest, a police officer said.
“The latest unemploy ment rate of 8.3 per cent is a hugely worrying thing for our economy and popula tion,” the Congress leader said.
(PTI): The AAP on Satur day alleged that the arrest of its MLA Amanatullah Khan was part of BJP’s efforts to poach Arvind Kejriwal-led party’s legislators and topple its government in Delhi un der “Operation Lotus”.
No offer made to Prashant Kishor; he is working for BJP: JD(U) president
PATNA, SEP 17 (PTI):
NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022 NATIONAL 5 Dr Arindom Kakati MS, M.Ch (Neuro Surgery) (NIMHANS, Bangalore) On 23rd September 2022 From 11:00 AM- 4:00 PM Senior NeuroFromSurgeon Hayat Hospital, Guwahati For 8415055995,appointments:6909873928 NEURO SURGERY dc-1077/22 ADMISSION OPEN 2022 - 2023 COURSES OFFERED: UG, PG and Ph.D. GNMNURSING&BSc(NSG) OCCUPATIONALPHYSIOTHERAPYTHERAPY MEDICAL FOODTECHNOLOGYLABANDNUTRITIONOPTOMETRY ALLIED HEALTH SCIENCES OPERATION IMAGINGTECHNOLOGYTHEATREMEDICALTECHNOLOGY Quality Education at Affordable Fees SEPARATE HOSTEL FOR BOYS AND GIRLS Contact us: THEAPPLICATIONSdirectormedical@necu.ac.inAREINVITEDFORPOSTOFTEACHINGFACULTY healthscienceadmission@necu.ac.in9916159191 Campus@: Kuda (Half Nagarjan), Dimapur Admin ANCHORCampusCOMPLEXEASTBLOCK,BURMA CAMP, DIMAPUR, NAGALAND – 797112 www.necu.ac.in NORTH EAST CHRISTIAN UNIVERSITY Estd. Under the Government of Nagaland Act 2012 (Act No.4 of 2013) UGC Recognised and Accredited as PrCB for TCHPs by NABCB under ISO/IEC, 17024; 2012 dc-996/22 db-983/22 G. Rio School, Kohima (Affiliated to CBSE) ADMISSION NOTICE Application Forms for the next academic session (2023-24) are being issued for classes 9 and below. Entrance Test cum Interview will be held on 24th Sept 2022 For more details, you may visit our website at www.grskohima.com k-2174/22(b) G. Rio School, Kohima (Affiliated to CBSE) www.grskohima.com E-mail: grioschool@yahoo.in POST VACANCY Applications are invited for the following posts for the next academic session 2023-24: No.Sl. Post Qualifications 1 PGT Chemistry M.Sc in Chemistry with B.Ed 2 PGT Biology M.Sc in Zoology with B.Ed 3 PGT Physics M.Sc in Physics with B.Ed 4 PGT Economics M.A. in Economics with B.Ed 5 PGT Business Studies M.Com/MBA 6 TGT English B.A/M.A in English with B.Ed 7 TGT (Phonetics)English Degree/Diploma in Phonetics 8 Robotics Teacher B.Tech/B.E (Mechanical) OR Degree/Diploma in Robotics 9 Office Assistant Graduate with good communication skill and Computer knowledge Interested candidates may submit their detailed bio-data along with photocopies of marks sheets from HSLC onwards at the School’s office or through email on/before 26th Sept 2022. Last date of submission of application: 26th Sept 2022. Date of Interview will be informed through call after short listing of Forcandidates.anyquery, you may contact: 8416058589. k-2174/22(A) dc-1088/22 db-1066/22
So far, 5,980 camps have been approved across the country and around 1,50,000 donors have regis tered, an official said, add ing close to 45,000 people
of this country as National Unemployment Day,” Shri nate said.She said it is a huge cause of concern that de spite India being the young est country in the world, 60 per cent of the country’s working-age population is either unemployed or not looking for work.
“In fact, in the 20-24 age group, 42 per cent of the youth are unemployed. If this is not a worrying situation, I wonder what is. And the prime minister
Modi promised about two crore annual jobs but in stead only seven lakh people have been given employ ment in the last eight years, she claimed, adding that 22 crore people had applied for jobs.“In fact, this is a body blow because it affects wom en the most. Their participa tion in the labour market has come down from 26 per cent to 15 per cent. It is also a double whammy because this is coming on the back of high prices and no wages,” she said. Why is it that there are no national debates and the government doesn’t want to discuss the important issue of unem ployment, she asked.
15-day ‘Raktdaan Amrit Mahotsav’ begins on PM Narendra Modi’s birthday
Cong observes Modi’s b’day as ‘Unemployment Day’
Rajiv Ranjan Singh
JP Nadda during inauguration of a 15-day blood donation drive ‘Raktdaan Amrit Mahotsav’, in New Delhi, Saturday. (PTI)
He also anticipated the arrest of more MLAs of his party in the coming days.
While one of the three
“First, they arrested Satyendar Jain but there is no evidence against him in court. They raided my residence. Nothing was found. Then they initiated a fake probe against Kai lash Gahlot, and now they have arrested Amanatullah Khan. Operation Lotus con tinues to break each leader of AAP,” Sisodia said in a tweet in SaurabhChiefHindi.spokespersonBharadwajlashed
AAP MLA’s aide arrested; weapon, Rs 12 lakh seized
Why is it that MSMEs, which employ the maxi mum number of people, are at the receiving end of the prime minister’s flawed policies, she asked.
Arms, ammunition and cash recovered from AAP MLA Amanatullah Khan’s associates.
out at the BJP over Khan’s arrest and accused the An ti-Corruption Branch of “planting” misleading news in the media about the Waqf Board chairman at the be hest of the saffron party. He said Khan has been arrested in a case registered in January“Probe2020.agencies are only batting for the BJP so that the saffron party trolls can spread lies (on social media), showing wads of currencies and firearms. This is what the ACB is preparing for. This is what the CBI and ED does,” he charged.The Delhi Police on Saturday said it has arrested Khan’s close aide Hamid Ali following recovery of Rs 12 lakh in cash, one unlicensed weapon and some cartridges
Kishor shot to fame in 2014 when his company IPAC handled the spectacularly successful campaign of Prime Minister Narendra Modi, who was then the Gujarat CM and the BJP’s Prime Ministe rial candidate for Lok Sabha polls. Kumar, whose party was drubbed, hired Kishor a year later when assembly polls were held in Bihar. Ku mar’s alliance with arch rival Lalu Prasad and Congress trounced the BJP despite an intensive campaign by the PM.Kishor was subsequent ly appointed as an advisor to the Bihar CM, a post of cabi net minister rank, though he continued to work in profes sional capacity for other political figures. In 2018, Kumar, who was then the JD(U) national president, inducted Kishor into the party and elevated him to the post of national vice presi dent within weeks. How ever, Kishor’s outspokenness against CAA-NPR-NRC led to his expulsion from the party in 2020, which was then an NDA ally.
can neither hide behind Co vid, nor the Russia-Ukraine war because unemployment peaked at a 45-year high even before the first case of Covid was reported.
Varma met Nitish Ku mar, the former also had a word with Kishor whom he knows. Kishor again expressed the wish to meet the CM and they met. But why will anybody give him any offer? Who is he?” said Lalan.Notably,
“Everyone who asks receives…” (Matthew 7:8). We pray religious nonsense without even involving our will, and then we say that God did not answer— but in reality we have never asked for anything. Jesus said, “…you will ask what you desire…” (John 15:7). Asking means that our will must be involved. Whenever Jesus talked about prayer, He spoke with wonderful childlike simplicity. Then we respond with our critical attitude, saying, “Yes, but even Jesus said that we must ask.” But remember that we have to ask things of God that are in keeping with the God whom Jesus Christ revealed.
The Founder of the Legal Initiative for Forest and Environment, Ritwick Dutta says that the Joint Parliamentary Committee does not really address any of the significant issues raised by critics when the amendment bill was introduced by the government.Neither does it address the issues raised by civil society groups, nor the concerns raised by the state biodiversity boards. On many issues, these state biodiversity boards have taken a strong stand against dilution. But the Joint Parliamentary Committee does not change any of the major provisions, he adds. The Legal Initiative for Forest and Environment is a national-level public interest law group.Ever since the draft of the Biological Diversity (Amendment) Bill, 2021, came into the public domain, many stakeholders have opposed it. The main criticism was based on the line that the proposed amendment leaves several loopholes in the law which can be misused and defeat the purpose of the Convention on Biological Diversity.Thenew bill has made one major amendment to exclude codified traditional knowledge from the purview of benefit claims. It defines the benefit claimers as the conservers of biological resources, their by-products, creators, or holders of associated traditional knowledge thereto (excluding codified traditional knowledge only for Indians).Thisexclusion has received huge criticism. The stakeholders feel that it will take the majority of the traditional knowledge from the kitty where the community can put its claim for benefit sharing. Eight state biodiversity boards
Goa, Bihar, Chhattisgarh, Tripura, Maharashtra, Assam, Andhra Pradesh, Madhya Pradesh and Uttarakhand have opposed this change arguing that most of the traditional knowledge being used in the Ayush – Ayurveda, Yoga and Naturopathy, Unani, Siddha and Homeopathy – systems of medicines, is codified.
and Development in Brazil. In 1994, India signed a Convention on Biological Diversity agreement that aims to recognise sovereign rights over biological resources. As a commitment to the Convention on Biological Diversity, India passed the Biological Diversity Bill in 2002. Since the beginning of the effort, the government has been blamed for a casual approach toward the bigger aim.
achieve excellence and prevent maladministration.Therightsof minorities were discussed for the first time by the Hungarian parliament in 1849. Later, in the backdrop of genocide of selected ethnic groups during the Second World War, the Universal Declaration of Human Rights (1948) attracted the attention of the international community towards protection of minorities. The framers of the Indian Constitution appear to have been inspired by the declaration. Subsequently, the International Convention on Civil and Political Rights (1966) and the UN Declaration on Minorities (1992) sought indulgence of the member states to protect the rights of persons belonging to national or ethnic, religious and linguistic minorities.Identification of minorities is crucial in order to confer upon them certain religious and cultural rights. The National Minorities Commission Act, 1992, defines minorities as a community notified as such by the Central Government. Initially, five religious communities, namely Muslims, Christians, Sikhs, Buddhists and Parsis, were recognised as minorities. Subsequently in 2014, the Jain community was also accorded the minority status.In the Patrani A Maria vs Keshavan case (1965), the Supreme Court held that minority means a community which is less than 50 per cent of the population of the state concerned where the law is applied.Inthe DAV College case (1971), the apex court clarified that in case of a state law, a minority community of the state would be considered and not a minority in relation to the whole of India.
Aren Meghalaya,JamirShillong
Our youngsters should decide what they want to do in this life. Right from our childhood, we are constantly chained by the thought of careers, or what we want to be and, in that process, we forget some of the finer aspects that life has to offer. A precursor to do anything in life is to have confidence in the self.
Importance of helping youths rise to top
New brand of politics
Reader’s note: Articles or letters published in any of the columns do not reflect the view of this nor that of the in any manner.
The primary thought in the area of religion is— keep your eyes on God, not on people. Your motivation should not be the desire to be known as a praying person. Find an inner room in which to pray where no one even knows you are praying, shut the door, and talk to God in secret. Have no motivation other than to know your Father in heaven. It is impossible to carry on your life as a disciple without definite times of secret prayer.
convention, biological diversity was considered as a global commons resource.
How the endorsed changes will affect biodiversity
Post-mortem
“When you pray, do not use vain repetitions…” (Matthew 6:7). God does not hear us because we pray earnestly— He hears us solely on the basis of redemption. God is never impressed by our earnestness. Prayer is not simply getting things from God— that is only the most elementary kind of prayer. Prayer is coming into perfect fellowship and oneness with God. If the Son of God has been formed in us through regeneration (see Galatians 4:19), then He will continue to press on beyond our common sense and will change our attitude about the things for which we pray.
Certainly, the term “minority” deserves a properly worded definition. The Centre and state governments must be busy in finalising their response on the identification of minorities. It goes without saying that their stand should be based on empirical and doctrinal research, suggesting discrimination, suppression and persecution based on ethnicity, religion and language rather than substantiating it merely on the proportion of those communities in the total population of the state.
Nagaland Post
VOL. XXXII NO. 284 DIMAPUR, SUNDAY, SEPTEMBER 18, 2022 NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022
Explanation 1 to Article 25 of the Constitution declares that “carrying of kirpans shall be deemed to be included in the profession of the Sikh religion.” Article 25 confers on every person the right to freedom of conscience and free profession, practice and propagation of religion, subject to public order, morality and health and to other provisions related to fundamental rights.
Developing entrepreneurial skills in young people can also be a multifaceted and sophisticated response to the problem of youth people unemployment and creative urge.
In the TMA Pai Foundation
The argument by appellants in the SC in comparing the practice of wearing the hijab with that of Sikhs carrying the kirpan is misplaced.
W hen the ofwasoccurringtheSummitdevelopedknowledge.andlookedinternationalinmarkedBiologicalitsofuse,knowledge,andofaimsBiologicalNationsitsDiversitytraditionaldiversitytheaearliestitsitboardsfromreceivedParliamentarysectioninfringementorofknowledgeexemptioncontroversialagreeingsubmittedParliamentarydeliberation.Committeebilltheexploitation.resourcesupit(2002)BiologicalamendmentsproposedGovernmentUniontotheDiversityActinDecember2021,wascriticisedforopeningthecountry’sbiodiversitytoincreasedSubsequently,governmentreferredthetoaJointParliamentaryforfurtherTheJointCommitteeitsreportrecently,tomostoftheprovisions.Whetheritisanofcodifyingandcultivationmedicinalplantsdecriminalisingtheofanyofthelaw,theJointCommitteeastrongobjectionseveralstatediversityandcivilsociety.Butstillmovedaheadandgavenodtothesechanges.Indiawasoneofthecountriestoenactlegislationtoconservecountry’sbiologicalanditsassociatedknowledge.TheBiologicalAct(2002)hasrootsintheUnitedConventiononDiversitywhichtopushconservationbiologicaldiversityassociatedtraditionalitssustainableandequitablesharingbenefitsarisingoutofuse.TheConventiononDiversityalsoaparadigmshiftthewayinwhichthecommunityatbiologicaldiversityitsassociatedtraditionalTheConvention,attheRioof1992,declaredbiologicaldiversitywithinacountrythesovereignpropertythecountry.Beforethe
T
in the People’s Biodiversity Registers, he markettoBusinessescultivationtothepretextprovidingbenefitsingleAct,evenhowever,thescheduledcomplicatedreportParliamentarytheCRdemocraticononresearcherbiodiversityandManagementtoandwithGreenfiledprepared.biodiversityandCommitteesBiodiversityNationalafter18CommitteesBiodiversityButPeopleisManagementCommittees.BiodiversityBiodiversityAuthority,themechanismdecentralisedDiversitySimilarly,adds.theBiologicalActprovidesforathree-tieredcomprisingNationalBiodiversitytheStateBoardandtheManagementEveryBiodiversityCommitteesupposedtoprepareaBiodiversityRegister.theformationofManagementtookaroundyears,thattoohappenedtheinterventionoftheGreenTribunal.In2016,merely9,700Managementwereconstitutedonly1,388people’sregisterswereAgainstapetitionin2016,theNationalTribunalcameupaseriesofdirectionsforcedgovernmentsconstituteBiodiversityCommitteespreparepeople’sregisters.Anindependentworkingpeople’sinitiativeresourcerightsandgovernance,Bijoysaysthatneither2021billnortheJointCommitteehavedealtwiththenatureofareas.Itshowsleveloftheirseriousness.DrRajanfromATREEbelievesthatafter20yearsofthethereisnotevenasuccessfulcaseofsharing.“Insteadof‘freebies’ontheofbenefitsharing,localcommunitiesneedbecapacitatedfortheofusefulplants.shouldbebuiltmaketheproductsandthose,”heconcludes. published in Mongabay India)
In Ahmedabad St Xavier’s College case (1974), the SC held that it was not reasonable to claim complete autonomy under Article Closure30.of minority institutions is permissible if being run against public interest or national integration. In the Sindhi Education Society case (2010), the apex court held that the government has power to regulate minority institutions to
The number does not matter if the community is economically prosperous and socially strong. Research is also needed to fix the threshold percentage of a community in the total population to qualify for minority status; the number of less than 50 per cent appears to beMinorityillogical. status to a community should infer either a threat to its existence or vulnerability to suppression and persecution. It should not be allowed to become a tool to earn privileges and autonomy in opening educational institutions and managing religious establishments.
newspaper
he Supreme Court has given six weeks to the Centre to spell out its stand on the identification of minorities in various states on a plea seeking minority status for Hindus as they are numerically less in number in nine states and unionAnotherterritories.Bench of the SC is seized of the matter in an appeal against the verdict of the Karnataka High Court related to wearing of the hijab by Muslim women in educational institutions. Secularism based on state neutrality in matters of religion is part of the basic structure of the Indian Constitution, but it does not mean irreligion; it only signifies no state or preferred religion. Therefore, the mist around rights of religious minorities and identification of other minorities needs to be cleared logically.Religion is a belief which binds spiritual nature of a human being to super natural being and it is not necessarily theistic. It includes worship, belief, faith, devotion etc and extends to rituals. Sometimes, people fail to differentiate between religion and culture. Culture encompasses within it the food habits, dress and the general way of life of people, which subscribe more to geography and societal norms rather than to prescriptions by religious and theocratic exponents.
Former
he future seems to depend on the youth, which may be a wonderful thing considering the immense potential they possess, and so, the need of the hour is to effectively tap this potential. While the so called “millennials” are the more educated and diverse than previous generations, they are also notoriously restless, job-hoppers, dislike authority and distrust traditional bureaucratic processes. Majority of them get burnt out sooner than expected and quite a few do not realise their potential.
In a written response, noted ecologist and founder of the Centre for Ecological Sciences at the Indian Institute of Science, Madhav Gadgil explains that the Convention on Biological Diversity is guided by six principles of ecosystem management – the objectives of management of land, water and living resources are a matter of societal choice; management should be decentralised to the lowest appropriate level; ecosystem managers should consider the effects (actual or potential) of their activities on adjacent and other ecosystems; recognising potential gains from management, there is usually a need to understand and manage the ecosystem in an economic context; conservation of ecosystem structure and functioning, in order to maintain ecosystem services, should be a priority target of the ecosystem approach, and ecosystems must be managed within the limits of their toCommitteesBiodiversitymanagement.CommitteesBiodiversityrulesDiversityConventionittwotherulesHowever,functioning.whenthewereformulatedbyGovernmentofIndiayearslaterin2004,didnotadheretotheonBiologicalguidelines.ThenullifiedanyroleofManagementinecosystemAllthattheManagementarenowaskeddoistorecordinformation
Article 29 guarantees cultural and educational rights to every citizen, though the common thread in this Article is language, script or culture and not religion.Article 30 recognises linguistic and religious minorities and guarantees to them the right to establish and administer educational institutions of their choice.
~ John Irving
Editor
An analytical report from a New Delhi-Based political and electoral reform and nonprofit body, the Association for Democratic Reforms (ADR), showed that a total of 219 MLAs and MPs from other political parties have joined the BJP between 2014 and 2022. The latest was when eight out of the 11 Congress MLAs defected to the BJP in Goa on September 14. Days earlier on September 2, five of the six JD(U) MLAs defected to BJP in Manipur. On the other hand only 60 elected members, MLAs and MPs defected from the BJP to join other parties during the corresponding period.
In response to these objections, the Joint Parliamentary Committee has asked the ministry to incorporate “Codified traditional knowledge” means the knowledge derived from authoritative books specified in the First Schedule to the Drugs and Cosmetics Act (DCA), 1940. India is one of the first movers when it comes to making legislation to protect its biodiversity. This was a result of the Convention on Biological Diversity organised in 1992 at the United Nations Conference on Environment
(As
In fact, religion is a subset of culture. In a country governed by the rule of law, theocracy may not be allowed to monopolise culture, though both may co-exist for the betterment of humanity.Thepractice of wearing the hijab may be understood more in cultural and social context and as a matter of personal choice and convenience rather than a purely religious matter.
In contrast, Webster’s Dictionary defines minority as a population differing from others in some characteristics and often subjected to differential treatment. Sociologists recognise minorities as a group of people who have distinct physical or cultural characteristics and are often subjected to suffer inequalities or discrimination based on their unique identity.
If you are lucky enough to find a way of life you love, you have to find the courage to live it.
Quotes
(As published in The Tribune)
OPINION/EDITORIAL6
The demand to allow
An analysis of data shows that the Congress lost the most MLAs and MPs- 185 from 2014 to 2022. The BJP has vowed to rid India of Congress (Congress Mukht Bharat) and therefore, it is not surprising that the grand old party is facing the brunt. The BJP is trying to wrest Congress-ruled Chhattisgarh including Rajasthan in the forthcoming elections. The BJP’s job has been made easier since state leaders in the Congress are stricken with internal bickering. Take the case of Madhya Pradesh where then chief minister Kamal Nath resisted in appointing party colleague and young leader Jyotiraditya Scindia as state party chief and also accommodate the latter’s loyalists to key government posts. Kamal Nath was not keen to give Scindia space because he was promoting his son Nakul Nath as his political heir. As a consequence 22 MLAs loyal to Scindia switched sides to BJP and brought the Kamal Nath government down. Similarly in Rajasthan, chief minister Ashok Gehlot has been making life difficult for another young Congress leader Sachin Pilot and that nearly brought the Gehlot government down but only because Pilot chose to remain loyal to his party. The other is that Congress does not have the humility and magnanimity to get along with its allies. The inability of the Congress to not bad mouth its ally, the JDS resulted in 16 MLAs ditching the alliance and ended up in the toppling of the Congress-JDS coalition in Karnataka in 2019. The other factor that has destabilised Congress governments is the misuse of government agencies such as ED,CBI and NIA by the Central (read BJP) government. Congress spokesperson M.V. Rajeev Gowda- a former MP in Rajya Sabha alleged that the BJP is actively engaged in mission ‘Operation Lotus’ to destabilise opposition parties and governments by using central probe agencies against opposition members. Gowda alleged that BJP not only misused central probe agencies to subvert people’s mandate but also spend enormous amounts of money to entice opposition members. The BJP has become the dominant political party in the country after having dislodged opposition-ruled states either through defections or misusing central agencies against opposition members. In the forthcoming assembly elections to 11 states from December 2022 to 2023, the BJP is determined to wrest power in four opposition-ruled states. By 2024 the BJP hopes to be in power in most states and aims to win at least 400-plus seats in the Lok Sabha. The goal is not unachievable for the BJP, which continues to be on poll-mode on a 24x7 basis. It has changed the political narrative and the way in which Indian politics used to be played in the past.
When you pray, go into your room, and when you have shut your door, pray to your Father who is in the secret place… —Matthew 6:6
wearing of the hijab in educational institutions appears to be motivated by fossilised thinking to monopolise the choice of women in their exclusive personal domain. Moreover, every educational institution has its own rules and regulations, which constitute its sub-culture. Everyone who chooses to be part of that sub-culture cannot be allowed to violate it in the name of religious freedom.
No matter where they are employed, the youth needs to be motivated appropriately so that they may take our nation to greater heights. There are reasons for the behaviour and thought process of these youngsters which need to be identified, isolated and proactively acted upon. To motivate the youngsters, the society and its people need to think in sync with them and counter the negatives.It’svital to establish contact with the younger generation and transfer ideas and issues to the seamlessly rather than giving only pep-talks. One must involve the youth in planning to bring out the best inProvidingthem. ambiance at work place conducive to the mind-set of youngsters and giving them the flexibility to operate as per their life styles results in productivity and positive motivation. Work-life balance is one of the most significant drivers which detests sitting at desks for 12 hrs a day in today’s world on internet and constant connectivity.
Praying to God in Secret
DailyDevotion
T
If this codified knowledge gets excluded from claiming benefits, the majority of local traditional knowledge holders will not get the benefits.Senior fellow and Program Leader (Ecosystems and Global Change) at Ashoka Trust for Research in Ecology and Environment Dr Priyadarsanan Dharma Rajan says that the codification of traditional knowledge is ambiguous and gives total exemption to Ayurvedic pharmaceutical companies.Traditional knowledge needs to be codified to protect them. And the new provision is basically saying as long as the traditional knowledge is not codified, you will get the benefit. But the moment you codify it, you will not get it, he adds.
Clear the air around rights of minorities
case (2003), the Supreme Court held that since states were reorganised on the basis of language, minorities should be identified state-wise.
have raised their concern against this with the Joint Parliamentary Committee.
When the Union Government introduced the Biological Diversity (Amendment) Bill, 2021, in Parliament on December 16, 2021, it was met with much resistance. Environment Minister Bhupender Yadav referred it to the Joint Parliamentary Committee within four days of the introduction of the Bill, thus, managing to calm down benefits.andforespeciallytoCommitteePradesh.UttarakhandMaharashtra,Gujarat,Assam,Delhi,Tripura,Himachalincludeparticipated.stakeAllandhadParliamentarysessionitsTheandfromJanataCongress,fromMunetraCongress,frommemberspartyitsJanatacoalition(United),andthe16CommitteeJointTheopposition.31-memberParliamentaryhasatotalofparliamentariansfromBharatiyaJanataPartytwofromJanataDalalong-termpartner.TheDal(United)brokealliancewiththerulingonlyinJune.TheothercommitteeincludethreeIndianNationaltwofromDravidaKazhagam,twoAllIndiaTrinamooltwofromBijuDalandoneeachSamajwadiPartyBahujanSamajParty.Committeesubmittedreportinthemonsoonoftheparliament.TheJointCommitteeorganised15sittingsheard47stakeholders.majorstateshavingainbiodiversity,alsoThesestatesGoa,Haryana,Pradesh,Odisha,WestBengal,AndhraPradesh,Bihar,Chhattisgarh,Karnataka,Kerala,Meghalaya,andMadhyaTheJointParliamentaryhasfailedpacifystakeholders,thoseworkingbiodiversityconservationequitablesharingof
KP Singh DGP, Haryana
look of curiosity mixed with bafflement, but soon they found their bearing and be gan to amble around.
society. Hitobo S.
OFFIce OF THe Akuk ekHuNg DIMApuR DIMApuR : NAgAlAND FelIcITATION
in
We wish you all the very best in your future endeavours.
1.
A crude bomb exploded on the roof of a school building in West Bengal’s North 24 Parganas district on Satur day when classes were in progress, a senior police official
Heartiest congratulations to Dr. Maongtola Jamir , daughter of Dr. R. Imtimeren Jamir (Longjang) and Mrs. Temsüinla Lkr for securing the post of Medical Officer (Class I - Gazetted), Health and Family Welfare Department, Nagaland in the recently conducted NPSC exam.We wish you the best and may Almighty God continue to guide and bless you abundantly on your new journey.
“It is right that when nature and environment are conserved, our future be comes secure. It also opens up vistas for development and progress,” the prime ministerIndiasaid.istrying to revive the population of cheetahs as per international guide lines and there is a need to ensure that these efforts do not go in vain, he added.
Theresaid.was no casualty in the incident as students and teachers were in rooms located on the first two floors of the three-storied building, he said.
(cHeNISAO pATTON)
Sd/- Sd/-
17 (PTI): Seven decades after they became extinct in India, eight Cheetahs from Namibia arrived in India by a special cargo flight on Saturday morning as part of an ambitious project to rein troduce them in the country, and three of them were released into a special en closure at Madhya Pradesh’s Kuno National Park (KNP) by Prime Minister Narendra Modi.Stating that `Project Cheetah’ was his govern ment’s endeavour towards environment and wildlife conservation, Modi, who turned 72 on Saturday, la mented that no “construc tive efforts” were made by the previous governments to revive the population of the world’s fastest animal in India.The transcontinental journey of more than 8,000 km of the eight cheetahs -- five female and three male and aged between 30 to 66 months -- from Namibia began on Friday night.
The cheetahs hesitated a little as they took in the new environment with a
KNP Divisional For est Officer P K Verma told PTI that the remaining five animals were released by other dignitaries into other enclosures.“Itis unfortunate that
LAKHIMPUR KHERI, SEP 17 (PTI): Commu nal tension gripped a vil lage here after a 20-year-old woman succumbed to her injuries sustained in an at tack on Monday allegedly by two men during a moles tation attempt. She died on Friday at her home, police said.
Khevito Zhimo Vikuto Achumi Chairman Secretary Chishilimi Welfare Chishilimi Welfare Dimapur/Chumoukedima Dimapur/Chumoukedima
DP-4465/22
a sharp edged weapon after their molestation attempt. After the incident on September 12, an FIR was filed against the two youths on the complaint of the vic tim’s Themother.two were booked under sections 323 (punish ment for voluntarily caus ing hurt), 504 (intentional insult with intent to provoke breach of the peace), and 506 (punishment for crimi nal intimidation) of the In dian Penal Code.
-4486/22DP
PM Narendra Modi after releasing cheetahs inside a special enclosure of the Kuno National Park in Madhya Pradesh, Saturday. (PTI)
warranted and is yet another diversion from pressing na tional issues and Bharat Jodo Yatra,” he said. When tigers were first translocated to Panna and Sariska during 2009-11, there were many prophets of doom, Ramesh said, add ing that they were proved wrong. “Similar predic tions are being made on the Cheetah project. The profes sionals involved are first-rate and I wish the project the very best!” he said.
A top official of Bar rackpore Police Commis sionerate told reporters after visiting the spot that the blast was caused by a single crudeHebomb.said that it would be investigated whether the bomb was hurled from a nearby building or it had been kept there and sud denly went Barrackporeoff.
“I thank our friendly nation Namibia and the government there for their help to reintroduce cheetahs in Indian soil after decades,’’ he said, adding that only three cheetahs were left in the wild in India in 1947 which were unfortunately hunted.The last cheetah died in the country in 1947 in Korea district in present-day Chhattisgarh, earlier part of Madhya Pradesh, and the species was declared extinct from India in 1952.
“The tamasha orches trated by PM today is un
The woman was al legedly attacked by two Muslim youths with sharp edged weapons. After her death, police added charges of culpable homicide to the original FIR, which was filed after the incident.
NEW DELHI, SEP 17 (PTI): The Congress on Sat urday called Prime Minister Narendra Modi’s releasing of Cheetahs in a Madhya Pradesh national park a “tamasha,” orchestrated by him as another diversion from pressing national is sues and the ‘Bharat Jodo Yatra’.Congress general sec retary and in-charge com munications Jairam Ramesh also alleged that the prime minister “hardly ever ac knowledges continuity in governance” and the Chee tah project was the latest example of that.
Modi on Saturday re leased cheetahs flown in from Namibia into a spe cial enclosure at the Kuno National Park (KNP) in Madhya Pradesh.He also clicked some pictures of the cheetahs on a professional camera after releasing them.
Eight cheetahs were brought to Gwalior from Namibia in a special plane on Saturday morning as part of the cheetah reintroduc tion programme.
FELICITATION
“PM hardly ever ac knowledges continuity in governance. Cheetah project going back to my visit to Ca petown on 25.04.2010 is the latest example,” Ramesh, who was the Environment and Forest minister during 2009-11, said in a tweet.
The Union further wishes them bright and prosperous future exercising their duties for the welfare and upliftment of the Zhimo Atohovi Zhimo President General Secretary
6. Dr. chiben kithan, S/o Late Shanbemo Kithan on being promoted to DPO (CD-II) Kohima, Department of H& FW, Govt. of Nagaland. The Ekhung wishes all the very best in their endeavours towards a bright purposeful and illustrious career ahead.
The students got pan icked hearing the sound of the explosion and left the premises helter-skelter, while teachers went upstairs to find bomb splinters close to the roof, according to a managing committee member of the state-aided institute at Titagarh in the industrial belt of the district.
The Dimapur Chungliyimsen Students' Union with immense pride and honour extends our heartiest congratulations to Er. Tsuktilong Jamir, S/o Mr. Alemwati Jamir for his achievement in the recently declared NPSC (CTSE) examination to the post of Junior Engineer (Mechanical) Class II Gazetted under Works and Housing Department.TheDCSU is immensely proud of his achievement and wishes good health and success in all his future endeavours.
on upsurge, dangerous to country: KCR
3. er. Yanbothung p. kithan, S/o Late Er. Pikhamo Kithan for securing the post of Junior Engineer under Power Department (NPSC CTSE -2021).
A police outpost in-
M. Taka Longchar Lemasashi Ozukum Chairman President Sungratsü Village Council Sungratsü Senso Mungdang
(N. BeNTHuNgO ODYuO) Chairman (AED) General Secretary (AED) DP-4475/22
Crude bomb explodes on school roof in
to know about the “distor tion” in the FIR after a video of the family members alleg
K Chandrashekar Rao
HYDERABAD, SEP. 17 (PTI): Communal forces in the country and Telan gana are trying to divide the society and spread hatred among people, Chief Min ister K Chandrashekar Rao alleged on AddressingSaturday.agathering after unfurling the national flag on ‘Telangana Jateeya Samaikyata Dinotsavam’ (Telangana National In tegration Day) here, Rao said if religious fanaticism grows, it will destroy the very life of the nation and result in deterioration of human celebratedinLiberationebrationsgroundstheMinisterminutesfied.”peoplekindvenomousamongTheyforthornssurge,fanaticismNotingrelationships.thatreligiouswasontheupRaosaid,“Theyplantinsocietalrelationstheirnarrowinterests.arespreadinghatredpeoplewiththeircomments.ThisofdivisionbetweenisinnowayjustiRao’scommentscameafterUnionHomeAmitShahhoistednationalflagatparademarkingthecelof‘HyderabadDay’elsewherethecity.ThestategovernmentSeptember17as
With immense pride and honour, we the Chishilimi Welfare Dimapur/Chumoukedima would like to extend our heartiest congratulations to Mr. ABel g AcHuMI S/o Ghonito and Bendangla Achumi for bringing laurels to the Welfare in particular and Chishilimi in general by securing the post of Demonstrator (Chemistry) under Higher and Technical Education Department through the recently declared NPSC Examination 2022.
4. er. Merijan Y. Tsopoe, S/o Dr. Yisao Tsopoe for securing the post of Junior Engineer conducted by Nagaland University.
Around 11.30 am, As the prime minister oper ated a lever from the high dais, the sliding door of the special cage below opened and the first of the cheetahs stepped into the special en closure at the KNP, located in the Sheopur district of Madhya Pradesh, as Modi proceeded to click their pictures with his DSLR
ect in India’ was conceived in 2009, the plan to bring the big cat to the KNP by November last year suffered a setback due to the CO VID-19“Projectpandemic.Cheetah, un der which the cheetahs were reintroduced in the country after they became extinct seven decades ago, is our endeavour towards environ ment and wildlife conser vation. Cheetahs are our guests; we should give them a few months to make Kuno National Park their home,” ModiHesaid.asked people to wait for some time to give time to cheetahs to make their territory in KNP.
Additional SP Arun Kumar Singh along with other officials interacts with the family members of the victim. (PTI)
The Akuk Ekhung Dimapur with immense pride and honour extend our heartiest congratulations to the following : er. Bonjamo J. kithan, S/o Dr. Jonsuthung Kithan for securing the post of Junior Engineer under Works & Housing Department (NPSC CTSE -2021).
While the ‘African Cheetah Introduction Proj
OFFICE OF THE SUNGRATSÜ SENSO MUNGDANG & SUNGRATSÜ VILLAGE COUNCIL SUNGRATSÜ : MOKOKCHUNG : NAGALAND
With immense pride and honour, the Sungratsü Senso Mungdang & Sungratsü Village Council, extends its appreciation and congratulations to : Dr. TOSHIMONGLA AIER, D/o Mr & Mrs. Mangyangsashi Aier for clearing the NPSC exam for the post of Assistant Veterinary Surgeon.May our Heavenly Father bless you abundantly.
They said that the in vestigation of the case has been assigned to Additional Superintendent of Police Arun Kumar Singh.
charge has also been sus pended for not heeding to the family’s complaint, in which it had alleged that the woman was “Sectionmolested.324of IPC (voluntarily causing hurt by dangerous weapons or means) and 304 of IPC (Punishment for culpable homicide not amounting to murder) have been added following the police inves tigations into the case and girl’s death on Friday, and that the two accused have been arrested,” Kheri police said in a press statement on Saturday.Police said they came
Telangana Jateeya Samai kyata Dinotsavam (Telan gana National Integration Day) while the Centre named it as Hyderabad Lib eration Day’.
The mother and the elder brother of the dead girl had on Friday accused two youths of attacking her with
MP Ar jun Singh told reporters at the spot that whoever was responsible for the blast would have to be arrested and punished.
OFFICE OF THE KhuKIyE LuKhAI STuDENTS' uNION Satakha – 798620, Zunheboto : Nagaland FelIcITATION DP-4421/22
2. Miss Vino N. Tuccu, Daughter of Mr. Nitovi Tuccu and Mrs. Ghotoli Tuccu, for clearing NPSC (CTSE) and securing the post of Assistant Conservator of Forest (Class-1 Gazetted) under the Department of Environment, Forest & Climate Change, Government of Nagaland.
ReligiousBengalfanaticism
DP-4466/22
OFFICE OF THE DIMAPuR ChuNGLIyIMSEN STuDENTS' uNION DIMAPUR : NAGALAND FELICITATION -4476/22DP NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022 NATIONAL 7
Cheetah release ‘tamasha’ to avoid national issues: Congress
FelIcITATION
2. er. chichanbeni patton, D/o Shri. Yanrhonthung Patton for securing the post of Junior Engineer under Power Department (NPSC CTSE -2021).
Tension grips Lakhimpur Kheri after molestation victim dies
KOLKATA, SEP 17 (PTI):
Modi releases cheetahs brought from Namibia on his birthday
SHEOPUR (MP), SEP
Cousins & In-laws.
FELICITaTION
ing so surfaced on the social media.“Through social me
dia on Saturday, it came to their notice that the family members alleged distortion of their complaint, follow ing which the concerned outpost in-charge has been suspended,” police said.
camera.Madhya Pradesh Chief Minister Shivraj Singh Chouhan and Union Min ister for Environment and Forest Bhupendra Yadav were also present on the dais.
Sd/- Sd/Talisashi, President Nukshitula Jamir, G/Secy DCSU DCSU
5. Mrs. R. emilo Humtsoe, W/o Mr. Renthungo Humtsoe on being promoted to CDPO Department of Social Welfare, Govt. of Nagaland.
we declared cheetahs extinct in 1952, but for decades no constructive efforts were made to reintroduce them in India.Now, with new strength and vigour, the country has embarked on the project of reviving the population of cheetahs during this ‘amrit kaal’,” Modi said in his speech as he kicked off the cheetah introduction proj ect conceived by the then United Progressive Alliance (UPA) government in 2009.
OFFICE OF THE NAKI TETSO SOCIETY Jakhama Village, Kohima FELICITATION With thanksgiving and glory to God, we the Naki Tetsonuomia with immense pride and joy extend our heartiest congratulations and appreciation to Mr. ZHAPUVIZO TETSO, son of Mr. Vikezo-o Tetso and Mrs.Keyiekhono Tetso for successfully qualifying the 6th rank SDO (Civil Engg.) – NPSC (CTSE) 2021, under Works and Housing Department.TheNaki Tetsonuomia further express our happiness for bringing laurels to the society through this achievement and wishes him all the very best in his future endeavors. Avio Tetso Kezhodeho Tetso Chairman Secretary Naki Tetsonuomia Naki Tetsonuomia k-2189/22 CIVIL ENGINEER’S ASSOCIATION OF NAGALAND (CEAN) ‘TOWARDS TRUTH, JUSTICE & Regd.No.R.S.1467.Dt.13/12/90EXCELLENCE’H.Q.Kohima:Nagaland Ref. NoCEAN/09/22/5 Date18/09/2022F ELICITATION The Civil Engineers' Association Nagaland with immense pride and joy would like to extend our heartiest congratulations to the following members for their achievements in the recently declared NPSC Combined Technical Services Examination 2021. The Association further wishes them all the very best in performing their duties with sincerity and integrity. May our Almighty God continue to bless and guide them to greater heights in the future. SDO (Works and Housing Department) 1. Imtisunep 2. Shadrak Kath 3. Moalila Y Sangtam 4. Hitoito A Sumi 5. Choimei Moileen Semdok 6. Khongtsathvu Peri 7. Nikavi K Tsuipu 8. Lankonthung C Jami 9. Tinuwati Longkumer 10. A Lumtsala Sangtam 11. Lemnyei Y Konyak 12. Tonen A Chang 13. Shanyu S Phom SDO (PHED) 1. Yekiho Sumi Junior Engineer (PHED) 1. Khengo Khiamniungan 2. Chingkong Chongbou Junior (WorksEngineerandHousing Department) 1. Jula Kajiri 2. Kitoka V Chishi 3. C Mercy Konyak 4. Mayangchila Jamir 5. Wachisie 6. Suiyi Liegise 7. Avolu 8. Ngangshimenla Pongen 9. Hito G Chishi 10. Mutsilu Kezo 11. Hekato Assumi 12. Wawe-u Wetsah 13. Kughali Zhimomi 14. Siden Kath 15. Limhachan O Kikon 16. Vekrolu 17. Anthea N Chishi 18. Imlitemjen Jamir 19. Manching A Konyak 20. Neke W Konyak 21. Kaboto H Sumi 22. Yanglikhumla Sangtam 23. Pesho Khiamniungan 24. Tangrila Thonger Sd/(CHOICE PIELIE) PRESIDENT Sd/(DOVILI SWU) GENERAL SECRETARY k-2197/22 UNITY COLLEGE INFORMATION This is to inform all the Backlog (Repeaters) Students of B.A / B. Com- 1st, 3rd & 5th Semester that the date for filling up of N.U Exam forms is from 19th to 30th of September ’22 on all working days. No form will be accepted after the above mentioned date. Following documents are required for filling up the form; 1. Original Mark Sheet (Last Exam.) 2. Admit Card03862-248279UnityPrincipal(Photocopy)CollegeDP-4491/22 With immense pride and honor, the Khukiye Lukhai Students' Union would like to convey our heartfelt congratulations to the following for successfully clearing the NPSC-1/CTSE/2021. 1. Dr. K. Pulopu Wilson Zhimomi, Son of Lt. Kughavi Zhimo and Late Keluongu-ii Helena Khruomo, for clearing NPSC (CTSE) and securing the post of Medical Officer (Class-1 Gazetted) under the Department of Health & Family Welfare, Government of Nagaland.
India first imposed windfall profit taxes on July 1, joining a growing number of nations that tax super normal profits of energy companies. But international oil prices have cooled since then, eroding the profit margins of both oil producers and refiners.
(IANS): Interest rate hikes by central banks around the world could trigger a global recession in 2023, the World Bank has warned, media reports
ACROSS 4 Mars (6) 7 Languages expert (8) 8 Card game (6) 10 Crevice (5) 13 Repast (4) 14 Cab (4) 15 High (4) 16 Thickness (3) 17 Destroy (4) 19 Off (4) 21 Vital (9) 23 Course (4) 24 Direction (4) 26 Make a mistake (3) 27 Deserve (4) 29 Cot (4) 32 Limbs (4) 33 Scold (5) 34 Nevertheless (4,2) 35 Emery board (8) 36 Succession (6) DOWN 1 Vote in (5) 2 Alphabetical list (5) 3 Kick (4) 4 Iron alloy (5) 5 Egg-shaped (4) 6 Recently (6) 9 French port (6) 11 Stripling (3) 12 Earliest (5) 13 Social conduct (7) 15 Draw (3) 16 Mate (3) 18 Escorts (6) 20 Spectate (5) 21 Wheat spike (3) 22 Brown (3) 23 Shrub used for hedges (6) 25 Cover (3) 28 Amid (5) 30 Stiff (5) 31 To father (5) 32 Opposed to (4) 33 Not hot (4) Crossword No. 10397 Yesterday’s solution No. 10396 Su doku No. 5017 Yesterday’s solution No. 5016 KAKURO No. 4042 Yesterday’s solution No. 4041 8 NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022BUSINESS/STATE LAND AND BUILDING FOR IMMEDIATE SALE AT SUGAR MILL 5TH MILE DIMAPUR RCC BUILDING HAVING 3 STOREY BUILDING TOTAL AREA -22,769 SQ. FT. NO BROKERS INVOLVEMENT CONTACT : 9930891886 db-978/22 FOR SALE LandBuildingwith at Industrial Village Ward-5, AreaNearDimapurRazuphe,D.COffice:00B-03K-00Ls(802.67sq.mt.) Contact No. : 6909645500 P-4468/22d Land For SaLe 2½ Mile 5665 sq. ft. Rs. 24,90,000/(Slightly Negotiable) Contact : 9856956747 P-4469/22d Urgently Wanted 1. Two Female Managers 2. Four Female Ground Staff 3. One Chef Helper For a renowned restaurant in main location in Dimapur. Picking and dropping free along with free fooding and lodging. Contact : 8056766804 Call Timing : 10 am – 5 pm P-4481/22d LOST NOTICE I, Kangpila C. Sangtam am applying for duplicate copy of M.A. Admit Card as I have lost Nameit. : Kangpila C Sangtam F/Name : B. Chohose Sangtam Roll No. : 14ENG009 College : Patkai Christian College (Autonomous) P-4480/22d To LeT 2 BHK & 1 Single Room with Kitchen and Toilet attached available. NEZCC Road, Diphupar (A). Contact : 9862767587 P-4493/22d LAND FOR SALE Town area, ½ km from Dimapur Government College. Accessible to various institutions and hospitals. 1. 1bigha @ 780/-sq ft (Negotiable) 2. 40x40 @ Rs. 1350000/Contact : 9362619411 -1025/22db LAND FOR SALE Location : Bamunpukhuri-B (5 kms from Zion Hospital) 78 x 45 : Rs. 7.70 Lakhs 67 x 50 : Rs. 7.00 Lakhs 70 x 50 : Rs. 7.35 Lakhs Call : 94026156488595878323dP-4459/22 LAND FOR SALE at Vihokhu just 1 minute drive from Foothill Road any size at Rs. 45 per/ sq. ft. (Slightly Negotiable) Contact No : 60090942256009530632dP-4349/22 l and For Urgent Sale 1 4 Lane Touched, Area : 4 Bighas 2. Kushiabill Sec-IV : 1 Bigha 3. Indisen (Ao’s only) Area-5500 sq. ft. Contact No. : 7005424879 P-4471/22d DecLaraTion Regd. No. 723/22 Date 13.06.2022 I, Miss Vichulu Begum @ Vichülu Denyh, daughter of Samsul Uddin, permanent resident of Dhalibeel Village, Block-I, Ramkrishna Nagar, Karimganj, Assam and presently residing at Circuit House Colony, Dimapur, Nagaland do hereby solemnly affirm on oath and declare as under :1. That I am a bonafide citizen of India and a resident of the above mentioned address. 2. That in my Aadhaar, Card bearing No. 619435234278, my name was entered as Vichulu Begum, where as in all my educational documents, my name is recorded as Vichülu Denyh. 3. That the names Vichulu Begum and Vichülu Denyh is the one and same person and that is me. 4. That henceforth as and when the names Vichulu Begum and Vichülu appears, it should be read and understood as Vichulu Begum for all official as well as practical purposes. 5. That the statements made in this declaration are true and correct to the best of my knowledge and nothing material is concealed thereof. In witness whereof, I signed this declaration on this the th day of June, 2022 at IdentifiedDimapur.by: DECLARANT Sworn before me NOTARY PUBLICdP-4484/22 aFFiDaViT deCLaraTIon Reg. No. 54/2019 Dated 21/05/2019 I, Shri. Elvis Konyak, son of Shri. Peyak Konyak, presently residing at Walo Ward Mon Town, Mon District H.Q. and permanent resident of Ukha Village, Mon Nagaland do hereby solemnly affirm and declare an oath as follows: 1. That I am a Bonafide citizen of India, belonging to Konyak Tribe. 2. That my correct and official name is Elvis Konyak. 3. That however due to oversight/inadvertent error in my Appointment Letter my name has been entered as P. Elevis only instead of Elvis Konyak and in G.P.F Account my name is entered as P. Elvis Konyak instead of Elvis Konyak. 4. That the above-mentioned names are one and same person i.e. me and it is indistinguishable. 5. That this affidavit shall stand as piece of evidence and shall be kept in record for any future rectification/correction if any complication that may arise with regard to the entry of my name and in all official documents and records. 6. That this affidavit is signed and sworn before the competent authority declaring that my correct official name is Elvis Konyak henceforth it shall be used for all my official records, future reference and correspondence. That the above statement made in Para1-6 are true to the best of my knowledge and nothing material has been concealed herein and I signed this affidavit before the competent authority on 21st May 2019 at Mon. DEPONENT CHIEF JUDICIAL MAGISTRATE MON : NAGALANDdb-1063/22
Gross Domestic Product (GDP) growth for the April-June quarter (Q1FY23) came in at 13.5 percent, lower than esti mates of the Reserve Bank of India and independent analysts, and prompting a slew of FY23 GDP forecast cuts by various banks and agencies. However, India is still poised to be the fastest
Speaking as the special invitee, the Employment Skill Development and En trepreneurship (ESDE) di rector, Chiden Yaden, urged the graduates to work hard and focus on their vision. He also encouraged them to accept the challenges ahead and not wait for “white col lar jobs”.ESDE director also lauded the faculty and the staff of ITI for their dedica tion.
He reminded the grad uates that the key for tran sitioning from undeveloped into a developed society was in their hands. Er.Alongse informed that the prime minister would also be ad dressing the Ministry of Skill Development and En trepreneurship’s (MSDE) convocation ceremony at
that “the world’s three larg est economies - the US, China and the euro areahave been slowing sharply”.
After meet with...
Thetax. basket of crude
growing major economy this year.India’s retail inflation rate reversed its three-month downward trend in August, rising to 7 per cent from 6.7 per cent in the previous month, driven by a surge in food prices. This could put pressure on the central bank to further hike policy rates later this month.
Raising rates makes borrowing more expensive to try to bring down the pace of price rises. But it also makes loans more costly, which can slow economic growth.The warning from the World Bank came ahead of the monetary policy meetings of the US Federal Reserve and Bank of Eng land, which are expected to increase key interest rates next Onweek.Thursday, the World Bank had said that the global economy is in its steepest slowdown since 1970, BBC reported.
Healthy revenue buoyancy expected for rest of the year: Finance Ministry
Reliance Industries Ltd and Rosneft-based Nayara Energy are the exporters of fuels like diesel and ATF, the windfall levy on domes tic crude targets producers like state-owned Oil and Natural Gas Corporation (ONGC) and Vedanta Ltd.
The World Bank also called on central banks to coordinate their actions and “communicate policy decisions clearly” to “reduce the degree of tightening needed”.Inflation, which is the rate at which prices rise, hit a 40-year-high in the US and the UK in recent months. This was driven by higher demand as pandemic restric tions eased, and as the war in Ukraine boosted energy, fuel and food prices.
NEW DELHI, SEP 17 (PTI): The Union Com merce ministry on Friday allowed invoicing, payment, and settlement of exports and imports in the Indian rupee, a move aimed at facilitating trade in the do mesticIncurrency.July,the Reserve Bank of India (RBI) had asked banks to put in place additional arrangements for export and import transac tions in Indian rupees in view of the increasing in terest of the global trading community in the domestic currency.
Correspondent
WASHINGTON, SEP 17
In response, central bank policymakers have raised interest rates to cool demand from households and businesses. However, big rate hikes increase the risk of recession as it can cause an economy to slow, BBC reported.
The levy on the export of diesel was reduced to Rs 10 per litre from Rs 13.5. Also, the tax on Aviation Turbine Fuel (ATF) exports was cut to Rs 5 a litre from Rs 9 with effect from Sep tember 17, according to a fi nance ministry notification issued late Friday night.
“Under the circum stances, even a moderate hit to the global economy over the next year could tip it into recession,” it said.
DGFT is an arm of the ministry that deals with export and import-related matters. “Para 2.52 (d) is notified to permit invoicing, payment, and settlement of exports and imports in INR (Indian rupee) in sync with RBI’s ...circular dated July 11, 2022. This shall come into force with immediate effect,” DGFT said in a notification.
Accordingly, it said, settlement of trade transac tions in INR may also take place through special rupee vostro accounts opened by authorised dealer banks in India.Indian importers un dertaking imports through this mechanism will make payment in INR which will be credited into the spe cial vostro account of the correspondent bank of the partner country, against the invoices for the supply of goods or services from the overseas seller/supplier.
“In these uncertain times, it may not be possible to remain satisfied and sit back for long periods. Eter nal macroeconomic vigi lance is the price for stability and sustained growth,” it said.
ITI Kohima holds 1st convocation ceremony
oil that India buys has aver aged USD 92.67 per barrel in September as against USD 97.40 in the previous month.While private refiners
the AICTE auditorium New Delhi.This is the first time in 75 years a convocation ceremony of this magnitude is being arranged and con ducted in India. More than 10 lakh students and trainees from various institutions around the country like JSS (Jan Shikshan Sansthan), PMKVY (Pradhan Mantri Kaushal Vikas Yojana) etc. would also be facilitated for their accomplishment in skill training.
These are the key takeaways from the latest Monthly Economic Report (for August), released by the Finance Ministry on Saturday.“Downside risks to growth will persist insofar as India is integrated with the rest of the world. Nor is there room for complacency on the inflation front as lower crops-sowing for the Kharif season calls for deft management of stocks of agricultural commodities and market prices without unduly jeopardising farm
The First convocation cer emony of Industrial Train ing Institute (ITI) was held at Government ITI, Kohima Complex here on Saturday.
Government cuts windfall profit tax on crude oil
Akhah Konyak; IndoNaga Peace Talk coordina tor and Naga army chief Anthony Ningkhan Shim ray and secretary Indo-Naga Peace Talk Wungmaring Zimik.
Trade invoicing, payment, settlement of trade can be done in Rupee: DGFT
NEW DELHI, SEP 17
Global economy in its steepest slowdown since 1970: World Bank
KOHIMA, SEP 17(NPN):
The outgoing trainees along with the special guest and officials. (NP)
bagged the top list in the country for trainees passed in National Council for Vo cational Training (NCVT) examination with 88.70%.
CCoNPIThe delegation comprising of 20 mem bers led by convenor and chief minister Neiphiu Rio included co-convenors-deputy CM Y Patton, UDA chairman T.R. Zeliang and UDA co-chairman & NPF legislature party leader Ku zholuzo (Azo) Neinu, mem ber secretary Neiba Kronu and members-- S. Pangnyu Phom, G Kaito Aye, Met subo Jamir, KashihoSang tam, Paiwang Konyak, Ja cob Zhimomi, Mmhonlumo Kikon, H Haiying, Imkong L Imchen, Chotisuh Sazo, Dr. K Ngangshi, Kezhie nyiKhalo, Muthingnyuba Sangtam, Yitachu and Rajya Sabha MP S Phangnon Konyak.
As Russia cuts off en ergy supply to mainland Europe ahead of winter, heightened international focus on energy security in advanced nations could elevate geopolitical ten sions, testing India’s astute handling of its energy needs so far, the report, drafted by the economic division of the ministry, said.
(From p-1)
(PTI): The government on Friday cut the wind fall profit tax on locallyproduced crude oil in line with a fall in international rates, and reduced the levy on export of diesel and jet fuel (ATF) with effect from September 17.
exports,” the report stated.
Export duties of Rs 6 per litre (USD 12 per barrel) were levied on petrol and aviation turbine fuel and Rs 13 a litre (USD 26 a barrel) on diesel.
Centralsaid. banks have raised rates “with a degree of synchronicity not seen over the past five decades” to tackle soaring prices, World Bank said, BBC reported.
NEW DELHI, SEP 17 (AGENCIES): India is in a better position to calibrate its liquidity levels without abruptly stalling growth, even as healthy revenue buoyancy is expected to continue for the rest of the year and the touch services sectors rebound. However, downside risks will persist as the coming winter in Europe may lead to more geopolitical flare-ups, Busi ness Standard reported.
The MER stressed that there are a lot of positives to be taken from the year so far, including the fact that India has overtaken the United Kingdom to become the world’s fifthlargest“Theeconomy.real GDP in Q1FY23 is now nearly 4 per cent ahead of its corre sponding level of 2019-20, marking a strong beginning to India’s growth revival in the post-pandemic phase. The contact-intensive ser vices sector is likely to drive growth in 2022-23 building on the release of pent-up de mand and near universaliza tion of vaccination,” it said.
To align the Foreign Trade Policy (FTP) with this decision of the RBI, the Di rectorate General of Foreign Trade (DGFT) added a new paragraph to the FTP.
It said a study found
Delivering keynote ad dress, government ITI i/c principal & deputy director, Er H Alongse, said that it a ‘proud moment’ for the whole institute as Nagaland
The dedication prayer was said by SBLK pastor Thsadongse Sangtam and the ceremony was chaired by Molumenla Esther. A speech from the faculty was delivered by Konyi Seb.
International oil prices have fallen to six-month lows this month, leading to a reduction in the windfall profit
Response from the trainee was delivered by Tovi Achumi (draughtsman civil) and vote of thanks was proposed by Ruokuohezo Suohu (foreman). On the occasion, the institution also presented awards to the toppers.
At the fifth fortnightly review, the government re duced tax on domesticallyproduced crude oil to Rs 10,500 per tonne from Rs 13,300 per tonne.
17 killed in Nepal landslides
The queen’s death on September 8 aged 96, after a record-breaking 70 years on the throne, has sparked an outpouring of emotion.
H. James Leangen P. Metchai GENERAL SECY. PRESIDENT TVSU TVSU b-1061/22D With much happiness and pride the Sumi Community Ekranipathar congratulates: 1) Smt. V. KAVILI SEMA , W/o. Shri HOTOSHE OnZHIMOMIherpromotion
2. er. Y. manphen phom, D/o Shri. Yangpong Phom for clearing the
In a statement, Abdullah Fadil, who recently concluded a two-day visit to the flood-affected areas of Sindh, said the situation was
LONDON, SEP 17 (AFP):
MYK C MYK C NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022 INTERNATIONAL 9
extremely grim in flood-hit areas with malnourished children battling diarrhoea, dengue fever and several painful skin diseases, Dawn reported. Fadil said floods had now claimed the lives of at least 528 children and each and every one of these deaths was a tragedy which could have been averted.
The
province, which has been badly affected by floods caused by incessant rainfall for the last few Accordingdays.to acting Chief District Officer Dipesh Rijal, at least 17 people have been confirmed dead in landslips in the district, which is
continues to guarantee their nationalRussiasecurity.isestimated to have around 5,977 nuclear warheads, according to the Federation of American Scientists. It, however, remains unlikely that it intends to use such weapons.
Large crowds in Cardiff chanted “God save the king” as he shook hands with well-wishers following a multi-faith service in Llandaff Cathedral, and at CardiffCharlesCastle.met Welsh
The Yaongyimchen Students’ Union with profound delight and pride extends its heartiest congratulations to : 1. mr. Simon Sangsa phom, S/o Shri. Akumba Phom for clearing the NPSC (CTSE) & securing the post of Agriculture Marketing Inspector under Agriculture Department.
KATHMANDU, SEP 17
Dr.
Over 90,000 people were treated for infectious and waterborne diseases in a day in Pakistan’s Sindh.
Nuclear weapons have existed for almost 80 years and many countries see them as a deterrent that
With utmost pride and honour, the Kuhuboto Ghakhu Students’ Union, would like to express our heartiest congratulations to Engineer Pitoshe Sumi, S/o Hevito Sumi on successfully clearing the recently NPSC examination and being appointed to the post of Assistant Mining Engineer, Geology and Mining Department.
They stood, eyes lowered and silent, while members of the public filed past.
The union further wishes him success in all his future endeavours.
ISLAMABAD, SEP 17 (IANS): A Unicef representative in Pakistan said that an estimated 16 million children have been impacted by the “super floods” and at least 3.4 million girls and boys remain in need of immediate, lifesaving support.
Members of the public braved waits that at one point were estimated to be up to 24 hours and chilly night-time temperatures to view her Linescoffin.have snaked for miles along the River Thames since Wednesday when her coffin was brought to the UK parliament complex to lie in state.Police are mounting Britain’s biggest-ever security operation for Monday’s funeral, as hundreds of dignitaries including US President Joe Biden are set to jet in.
As the magnitude of flood disaster continues to unfold, international aid continues to trickle in.
16 mn children in Pak affected by floods
In an interview with CBS’ 60 Minutes correspondent Scott Pelley in the White House, President Biden was asked what he would say to President Putin if he was considering using weapons of mass destruction in Ukraine.“Don’t, don’t, don’t,” was President Biden’s response.Biden was then asked what the consequences would be for Putin if such a line was“Youcrossed.thinkI would tell you if I knew exactly what it would be? Of course, I’m not gonna tell you. It’ll be consequential,” Biden responded.“They’ll become more of a pariah in the world than they ever have been. And depending on the extent of what they do will determine what response would occur.”
World leaders begin gathering in UK for Queen’s funeral
Andrew -- stripped this year of his royal titles over a sex assault scandal -- was allowed to wear military uniform for the only time during the 11-day mourning period.
about 450 km (281 miles) west of the capital city of Kathmandu.11 people, who sustained injuries in the incidents were airlifted to the Surkhet district for treatment. Three persons have gone missing in the landslips, according to the
Sd/(P. TEMJENMONGBA PHOM) (K TEYONG PHOM) President General Secretary Yaongyimchen Students’ Union Yaongyimchen Students’ Union Office Of the YAONGYIMCHEN STUDENTS’ UNION lOnGlenG : naGaland FELICITATION k-2186/22 OFFICE OF THE HEKHOZEN SOCIETY HQ.
Office Of the KuhubOtO GhaKhu StudentS’ uniOn h.Q. KuhubOtO tOwn. affiliated tO wSSu dimapur – 797112 : naGaland Motto : “Labour & Honour” FELICITATIOn DP-4467/22
FELICITATION
But Drakeford said questions over the future of the monarchy were “a footnote to the dominant feelings of the day”.
NEW YORK, SEP 17 (IANS): Amid warming ties between Pakistan and the US, Prime Minister Shehbaz Sharif may have a meeting with President Joe Biden during his upcoming visit to New York to attend the 77th session of the UN General Assembly, a media report said on AccordingSaturday.to the report by The News, the premier will reach the US on September 19 for a hectic five-day visit during which he will also hold meetings with the heads of the IMF and World Sharif,Bank.who will be accompanied by key members of his federal cabinet is scheduled to address the UNGA on September 23.Though the schedule of the premier’s meetings in the US is not known yet, Sharif, along with Foreign Minister Bilawal Bhutto, will attend a dinner reception hosted by Biden
Drakeford, an avowed republican, and there was isolated booing on the streets after the new monarch was quick to declare his son William the new Prince of Wales.
would like to extend our
(AGENCIES): US President Joe Biden has warned Russia not to use chemical or tactical nuclear weapons in the war in Ukraine.According to BBC report, speaking during an interview with CBS News, Biden said such action would “change the face of war unlike anything since World War Two”.
People file past the coffin of Queen Elizabeth II as it lies in state on the catafalque in Westminster Hall, Saturday. (AP/PTI)
The queen’s successor, King Charles III, will
Tactical nuclear weapons are those which can be used at relatively short distances, as opposed to “strategic” nuclear weapons which can be launched over much longer distances and raise the spectre of all-out nuclear war.
Sd/DIMAPUR, the Tobu Village Students’ Union with pride joy heartiest congratulations to Haku Anshau, S/o Shri. Late Ngome, for achieving first Medical Officer (Class-1 Gazetted) among the Tobu Village Citizens under Health and Family Department in the recently declared NPSC (CTSE) Exam. Union wishes him greater success in all his future endeavours. to Dy. Director/Sr. SDEO and an additional charge of DEO Phek. Er. HEKATO ASSUMI, S/o. IVULHO & HONILI ASSUMI for clearing NPSC (CTSE) 2021 and being selected to the post of Junior Engineer (W&H). Wishing you a life full of exciting, adventurous and dreams come Chairman, SCE Secretary, SCE Smt. V. Kavili Sema er. hekato assumi
Charles on Friday wrapped up his maiden tour as monarch to the four nations of the United Kingdom with a visit to Wales, part of an operation dubbed “Spring Tide” to launch him in his new role.
NPSC (CTSE) & securing the post of Junior Engineer (Electrical Engg.) rank 31st under Power Department. We are delighted with your achievement for bringing laurels to the community and setting an example for the younger generation in days to come. May your sincerity, determination and integrity lead you to greater achievements in your future endeavours. The union further wishes them good health and wisdom in exercising their duties for the welfare and upliftment of the people of our society.
LONDON, SEP 17
Joe Biden
KIYETO L. CHISHI KAVITOLI AWOMI KGSU Media Secretary, KGSU
immense
President,
Sharif likely to meet Biden during his UNGA visit
and
Sd/-true. Sd/-
2)
First Minister Mark
He would not say what response the US would make to the use of such weapons. Russian President Vladimir Putin put the country’s nuclear forces on “special” alert following its invasion of Ukraine in February.Hetold defence chiefs it was because of “aggressive statements” by the West.
meet on Saturday with the prime ministers of the Commonwealth realms -- the 14 former colonies over which he now reigns in addition to Britain. From Australia and New Zealand to Canada, they have formally proclaimed him their new sovereign.But hiswillthemground,movementsrepublicanaregainingandeffortstokeepallintheroyalfoldlikelybeafeatureofreign.
(IANS): At least 17 people have been killed in landslips triggered by heavy rains in western Nepal in the past 24 hours, an official said on Saturday. The landslips occurred in different parts of the Achham district of the Sudurpaschim
Back in London, Charles held a 15-minute vigil with his siblings -Princess Anne, Prince Andrew and Prince Edward -- around their mother’s casket on Friday night.
b-1064/22D -4463/22DP For Sale BugforPuppiesSale at ContactKohima:98623719167005817618k-2194/22
official.The number of casualties could increase, said the official, adding that Bhimdutta Highway connecting seven districts in the province was also disrupted due to the disaster.
The Duke of York, as he is also known, flew Royal Navy helicopters during the 1982 Falklands War with Argentina.
NAGALAND FELICITATION With thanksgiving to God, we convey our joy and appreciation to Smt. Imcharenla IPS, Deputy Inspector General of Police (NAP/Range) Kohima on being awarded:1) Presidents' Police Medal for Distinguished Service on the occasion of Independence Day, 2022. 2) Police (Antrik Suraksha Seva) Padak Medal, May2022.the Lord Almighty guide and bless you in the service of our people. Sd/(Alila Wai Jamir) General SecretaryDP-4479/22 With immense pride and joy, the Office of the Shutheivongangla d imapur extends its heartiest congratulations to the following individuals for successfully clearing the NPSC, CTSE exam:1. er. manphe K. phom D/o O Kongyan Phom, Rdt CMO for securing the post of Je civil (Class II Gazetted) under Works and Housing Dept. 2. er. Shanyu S. phom S/o O. Shijang Phom, for securing the post of SdO civil (Class I Gazetted) under Works and Housing Dept. 3. er. l chingshak paulong phom S/o T. Longshak Phom, Rtd Jt. GM (NST) for securing the post of SdO, agri (Class I Gazetted) under Water Resources Dept. FELICITATION DP-4314/22 The union wishes them grand success in all their future endeavours.President Gen. Secretary L. Lokshang Phom O. Tiazungla Phom Office of the TOBU VILLAGE STUDENTS’ UNION dist: mon, nagaland Motto- “Hüngsih-Thak” FELICITATION The Office of
mr. Simon Sangsa phom er. Y. manphen phom
Biden warns Putin against tactical nuclear weapons
World leaders begin gathering in London from Saturday for the funeral of Queen Elizabeth II, as princes William and Harry are set to lead a vigil of her grandchildren at her coffin.
(MUkHICHO) (T.CHOHOSE) president General Secretary LCEU LCEU db-1057/22
Sinsi Chung 29 Years
Sd/- Sd/(Zayiechütuo Yore) (Keneise Thol) President General Secretary k-2203/22
But,long.while thousands of Brits wait patiently in the huge line, some people have slammed celebs and accused them of “queue jumping” or using “VIP passes” to
OFFICE OF THE AO STUDENTS' UNION DIPhUPAr FELICITATION
FELICITATION
With immense pride and honour, the office of the Ao Students' Union Diphupar (ASUD) extends heartiest congratulations to:
db-1059/22
Sd/- Sd/Resen Longkumer Imtinaro President, ASUD Gen. Secy., ASUD
M
Meghan, Harry won’t attend palace reception
both. Adapted from the DC comics, John Constantine is an exorcist trying to tip the scales in the battle between good and evil in his favor. Able to see the demons and angels influencing regular folks, Constantine is driven to send every last demon to hell thus solidifying his place in heaven because, “What would you do if you were sentenced to a prison where half the inmates were put there by you?” This sequel has long been whispered about among fans, especially after the big 15-year reunion both Reeves and Lawrence attended at Comic-Con. Plus the star himself has openly expressed interest in returning to the holy war raging on the streets of Los Angeles.
The Kitami Union Dimapur (KUD) extends our heartiest congratulations to Rev. Dr. Toniho Kiho, S/o Shri. Hotoi Kiho of Kitami Village on being conferred Doctor of Ministry (Ph.D) from Hindustan Bible Institute and College, Chennai.
The Union further wishes her success in all her future
rtificial sweeteners are a popular way to try to keep slim, but French researchers sug gest they may also increase your risk for a heart attack or stroke.Thefinding stems from tracking heart health among more than 103,000 men and women in France for close to a decade.“Weobserved that a higher intake of artificial sweeteners was associated with an increased risk of cardiovascular diseases,” said study author Mathilde Touvier. She is director of the nutritional epidemiology research team at the French National Institute for Health and Medical Research and Sorbonne Paris Nord Uni versity, both in France.
General Secretary K. Thuba C. Chemang Simon p.V.S.U. p.V.S.U.
Lead author Charlotte Debras, a doctoral candi date at both the French National Institute for Health and Medical Research and Sorbonne Paris Nord Uni versity, suggested a number of possibilities.One,she said, is the promotion of metabolic syn drome, which encompasses an array of conditions that raise the risk for heart attack and stroke. Among those are high blood pressure, high blood sugar, excess waist fat and high
PEOPLE understands that while the Duke and Duchess of Sussex were initially invited to the event on Sunday, the palace now says the reception is “for
endeavourspresident
early talks with an actor for the lead role before the new movie came together. Four scripts were written for the new adaptation set in contemporary London.
Sd/-
P
thethatderminethatdoesstressedrequestdustry,theCouncil,withtheresearchersagainstsweetenerAfter(angioplasty).stackingartificialconsumptionuphearttrouble,theconcludedthatformerwasassociatedtheriskforthelatter.TheCalorieControlwhichrepresentsartificialsweetenerindidnotrespondtoaforcomment.Touvierandherteamthattheirworknotdefinitivelyprovesweetenersdirectlyunhearthealth,onlythere’salinkbetweentwo.Andthatshouldgive
eghan Markle and Prince Harry will not join other members of the royal fam ily at a Buckingham Palace reception for world leaders traveling to London for Queen Elizabeth’s funeral.
T
then rationalize indulging in a bowl of ice cream. That, Diekman said, is why “the whole diet is what must be assessed.” While the authors said they took such factors into account when determining risk, Diekman had reservations. “Can we really determine how one single variable impacted the health of the body?” she asked. “The answer is no.” Still, if artificial sweet eners do pose trouble for the heart, why might that be?
The Dimapur Area Chuchuyimlang Senso Telongjem with immense pride and honour extends our heartiest congratulations to : (1) Ms. Lipoklemla Jamir, D/o. Mr. Odinungsang Jamir and Mrs. Takorenla for her success in the recently conducted NPSC (CTSE 2021) Examination for the post of Assistant Geologist (Class-1 Gazetted) under Geology and Mining Department.
Osbourne was spotted in the queue in London, sur rounded by others who were waiting to get to the Palace. She was dressed all in black and held out her hands in a praying symbol, as she smiled to fellow mourners.
(LANUZULU AIER) (MARCHITEN JAMIR) President General Secretary
Felicitation
1. I Alangla Walling, D/o Mr. Imtilepden Walling & Mrs. Imkongchila for her success in the recently conducted NPSC (CTSE) Examination for the post of Junior Engineer (Civil Engg.) Class-II Gazetted under Works & Housing Department, Govt. of Nagaland.
With immense pride and honour, we the p essao Village Students' Union would like to extend our heartiest congratulations to Miss Neke W. Konyak, d/o Shri C. Wanmei konyak & Mrs. Mongoi for securing the post of Junior Engineer (Class II Gazetted) under Works & Housing d epartment, Govt. of Nagaland in the recently declared NpSC (CTSE) Examination 2022.
“The challenge with most of the studies, and that is true here, is that studies have yet to provide a causeand-effect outcome,” Diek man said. “When looking at non-nutritive sweeteners it is hard to tease out how much the overall health of the subjects is a factor in the disease
By Alan Mozes HealthDay Reporter
db-1062/22 As you look to God with thanksgiving for your hard-earned achievement, the Tsaphimi Union Dimapur also extends our happiness and congratulates Er. Hekato Assumi, S/o Ivulho & Honili Assumi on being selected as Junior Engineer (Works & Housing) through the recently conducted NPSC CTSE 2021. We humbly pray that God will support you while facing your own determination and challenges in the days to come. Sd/- Sd/Hezheto Achumi Abeto Assumi Chairman, TUD Secretary, TUD Office Of the tSAPhiMi UNiON DiMAPUR eStD 1995 DiMAPUR : NAGALAND -1065/22db
The Union is immensely proud of his achievement and sincerely wishes him the best for his future endeavours.
Members of the public in the queue at Potters Fields Park, central London.
Last seen at BOC Bamboo Market, Kohima
We are overwhelmed and honored for his outstanding performance by securing the prestigious position and bringing laurels to the family in particular and community in general. We wish him a very successful career ahead.
The Virhatso Khathitso Society Kidima with profound delight and pride extends its heartiest congratulations to Dr. Keyolenu Yore, D/o Dr. Viral Yore for successfully clearing the CTSE, 2022 conducted by NPSC to the post of Assistant Surgeon (Class1 Gazetted) under Animal Husbandry and Veterinary Department, Govt. of Nagaland.
The Krotho is immensely proud of his achievement and wishes that Almighty God continues to bless him in his future endeavours.
(Variety)
Queen’s lying-in-state: Celebs, MPs slammed for ‘jumping queue’
Once again the Union thank our Almighty God for her great achievement and wishes her success in all her future endeavours.
OFFICE OF THE LANGKOK CITIZEN EMPLOYEES UNION Kiphire : Nagaland
The Union further wishes success in their future endeavors.
(2) Mr. Imkumrenba Longkumer , S/o. Mr. Puronen Longkumer and Mrs. Akala for securing the top position with 487 out of 720 marks among the Nagas, in the recently conducted NEET Exam (2021 -22).
MIssINg
he only soul Satan himself would come up to collect is getting a follow-up film. “Constan tine” is Varietyback. can confirm that Warner Bros. will make a sequel to the 2005 super natural action film “Con stantine” starring Keanu Reeves. The blockbuster star will reunite with original director Francis Lawrence, best known for taking over the “Hunger Games” fran chise after the first “Constantine”film.has been a hot property in Hol lywood, sparking a NBC series created by Daniel Cerone and David S. Goyer, and was even more recently being developed into a new series for HBO Max by J.J. Abrams’ Bad Robot Produc tions. However, sources tell Variety that the HBO Max series is now dead, although the streamer had been in
get into Westminster Hall. A live stream of the queue has shown a number of celebrities waiting patiently to pay their respects to Her Majesty.With ITV’s This Morn ing cancelled today, present ers Holly Willoughby and Phillip Schofield were seen on camera, queueing to visit the Queen. Dressed in black and looking thoughtful and sombre, the presenting duo were both wearing blue and purple lanyards around their neck.It is understood that the lanyards signify that they are in the queue for work purposes and the pair came together to pay their respects using a separate entrance for journalists.However, not every celebrity that has joined the queue has been doing so for official purposes. Sharon
Finder may kindly contact +8794816372 / 7005121202
people pause before draw ing firm conclusions, said Connie Diekman, a St. Louis food and nutrition consultant who is former president of the Academy of Nutrition and Dietetics.
Roughly 80% of par ticipants in the NutriNetSanté cohort were women (average age: 42). The study began in 2009 to investigate links between nutrition and health. At the outset, nearly four out of 10 participants reported they regularly used artificial sweeteners, includ ing Nutrasweet (aspartame), Splenda (sucraclose) and Sunett or Sweet One (ace sulfame potassium). They added them to food or bev erages and also consumed them in processed products.
The KUD is immensely proud of your achievement, we pray that Almighty God bless and guide you to greater heights, congratulations on your incredible achievement.ISAKSWU
A
With immense joy and pride, the Langkok Citizen Employees Union (LCEU) would like to extend our heartiest congratulations to Mr. Suliba. T., S/o Shri. Tsalito Mongzar for successfully clearing the NpSC Combined Technical Services Examination and securing the post of Assistant programmer under Election department.
(Ms. Lipoklemla Jamir) (Mr. Imkumrenba Lkr.)
dp-4483/22
VIBEILIE METHA KEVINEISA METHA President, MTKC Gen. Secretary, MTKC
2. Sugjemmen L Tzudir, S/o Late Lanunochet Tzudir & Mrs. Sakurenla for his success in the recently conducted NPSC (CTSE) Examination for the post of Assistant Mechanical Engineer (Mechanical) Class-I Gazetted under Works & Housing Department, Govt. of Nagaland. The Union sincerely acknowledges their accomplishments and wishes them the very best for all their future endeavours.
David Beckham said he queued for 12 hours to see the Queen lying in state and Good Morning Britain presenter, Susanna Reid, has also been spotted in the queue as she revealed that she and her mum queued for
JOHN SUMI PRESIDENT, KUD GEN. SECRETARY, KUD dp-4478/22
Those who said they used such sweeteners were generally younger; less ac tive; more likely to be over weight or obese; more likely to smoke; and more likely to be dieting. They also tended to consume more red meat,
Sd/I. Sunget Lkr. (Nukshitemjen) elicitation
President Asst. Gen. Secretary DACST DACST F
OFFICE OF THE PESSAO vILLAGE STUDENTS' UNION PO Tobu, Pin - 798624, Dist: Mon, Nagaland FELICITATION
dairy, salt, and sugar-free drinks. They drank less alcohol and ate fewer fruits and vegetables, less carbs and fats, and fewer calo ries overall, dietary records showed.Participants’ heart health was then tracked and compared for an aver age nine years. During that time, more than 1,500 heart problems occurred, includ ing heart attacks, strokes, severe chest tightness or pain (angina), and/or the need for surgery to widen blocked arteries
Are artificial sweeteners bad for your heart?
seven hours and 20 minutes. She took to Twitter to share her experience and provide some tips for anyone else considering making the trip. Other familiar faces that have been spotted queueing to pay their re spects to Her Majesty in clude former prime minister, Theresa May, and her hus band. Jacob Rees-Mogg and his family were also seen in the Palace of Westminster, as was Labour leader, Keir Starmer. (YorkShireLive)
added.vascularinflammationgut,ofmayDebraslevelswhichnalsweetenersinteractionpathway“Anothercholesterol.potentialcouldinvolvetheofartificialwithintestisweettastereceptors,”canaffectbothinsulinandsugarabsorption,said.Artificialsweetenersalsoalterthemakeupmicrobesfoundinthedriveupsystemwideandtriggermalfunction,she
working members of the royalHostedfamily.” by King Charles and Queen Ca milla, the reception will welcome heads of state and official overseas guests who have traveled to London for Queen Elizabeth’s state funeral on Monday. About 2,000 people are expected to gather at Westminster Abbey for the event. (PEOPLE)
Another Justice League Dark project that is also be ing put to the side is the “Madame X” series pro duced by Angela Robinson. But this doesn’t mean both series can’t be resurrected somewhere else. Sources say that both Warner Bros. Television and Bad Robot remain extremely high on both projects and expect to find a new home for them
FELICITATION
Sd/Obu Ayimniken Semchirtem
KITAMI UNION (FELICITATION)DIMAPUR
The Krotho with immense pride extends our heartiest congratulations to Shri AVILIE METHA, S/o Kelhouphilie Metha and Lokyonglo Metha for successfully clearing the NPSC Examination 2021 for the post of Junior Engineer under Power Deptt., Government of Nagaland.
FELICITATION
db-1058/22
k-2195/22
The Society with utmost sincerity, acknowledges her for bringing laurels to the community through her success and also wishes her the very best for her future endeavours.
db-4492/22
Today, the queue was closed to newcomers as it had “reached capacity” and people are being warned not to attempt to join - as they will be turned away. Some people had been prepared to queue for more than 12 hours, as the queue reached lengths of more than five miles
MYK C MYK C 10 INFOTAINMENT NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022
METHA THINUO KROTHO, CHIECHAMA KOHIMA : NAGALAND
eople have slammed celebs and MPs for allegedly “jumping the queue” to see Queen Elizabeth II, as she lies in state ahead of her fu neral on Monday. Since it opened, hundreds of thou sands of people have joined the queue, which snakes for miles through London.
Keanu Returns for ‘Constantine’ Sequel
The descendants of Obu Ayimniken, Nokpu Village, takes immense pride to congratulate Mr. Tinuwati Longkumer, S/o Er. Chuba Longkumer & Mrs. Asangla Imchen for securing SDO (Class 1 Gazetted) under Works & Housing Department, Govt. of Nagaland in the recently conducted NPSC Combined Technical Services Examination 2021.
FELICITATION
With immense pride & honour and thanks giving to our Almighty God , we the Dimapur Süngratsü Senso Telongjem, Dimapur Ao Temolung Süngratsülar Telongjem and Dimapur Süngratsü Students' Union would like to convey our heartiest congratulations to Dr. TOSHIMONGLA AIER, D/o Mr & Mrs. Mayangsashi Aier & Arenla Walling for bringing laurels to the villagers in particular and the community in general for being selected to the post of Veterinary Assistant Surgeon (Class-1 Gazetted) under Animal Husbandry & Veterinary Department in the 1st Rank in the recently declared Combined Technical Services Examination conducted under NPSC 2021.
Foroutcome.”example,she point ed to study participants’ own description of their diet and health habits. “The authors state that higher consumers of non-nutritive sweeteners had higher BMI’s [a measure of body fat based on height and weight], smoked more, had less physical activity, and ate more sodium and red meats, with fewer fruits and vegetables,” Diekman noted. She also stressed the importance of accounting for the “trade-off” factor, in which someone who uses a no-calorie sweetener for an iced tea, for example, might
FEliCiTaTiOn
3. Er. Sohyulo Seb Rengma, S/o Mr. Ashenbu Seb for securing the post of JE (Civil Engg.) (Class-ll Gazetted) under PHE Dept.
Chhetri and BFC eye Durand milestone
dp-4490/22
Sunil Chhetri
their resolute best so far, especially after the inclu sion of Senegalese defender MourtadaTheyFall.also have the highest scorer of the tourna ment Lallianzuala Chhang te (seven goals) in their ranks and someone of the quality of Greg Stewart marshalling the midfield with authority.
He said that the event was all about the fitness community promoting each other, which also was a get together of fitness lovers from across the state.
The member also applauds the State PHED Minister Shri. Jacob Zhimomi for his good initiatives, active supervision and in making sure that all the JJM / SBM (G) works were carried out as per central guidelines.
was one of the judges for the Best Physique contest said that it was motivating to see many fitness enthu siasts turn up for the event. Following the pan demic, he said that fitness had become a necessity for everyone and that it was no longer a luxury but a priority.In the women’s squats category, Peiheitele emerged as the winner
In the tug-of-war (strongest gym competi tion among seven gyms), Battleground Unisex Gym emerged as the champions while Star gym secured the second position.
is making its comeback after seven years and hope the national selectors will be present to pick new talents for the national camp,” the 54-year-old was quoted as saying by the organisers.
Nath said the race is not possible without the support of government and he is thankful to both the state and centre for their help in getting the event to India.
OFFICE OF THE CHANG STUDENTS' UNION DIPHUPAR 'B' VILLAGE
7th Nagaland Street fitness in Kohima
The Member, State Development Co-ordination and Monitoring Committee (DISHA) GoI visited PHED Mokokchung, Tuensang, Phek and Zunheboto Divisions for two days each in the month of July and August, 2022; for Monitoring & Evaluation and Vigilance as also inspecting actual work progress at the ground level, of the implementation of various works under National Flagship Programs GoI i.e. Jal Jeevan Mission (JJM) and Swachh Bharat Mission, NLCPR/NEC etc.
One of the best hockey players ever produced by the country, Dhanraj Pil lay, who was picked for the national camp after excel ling in the 1987 National
The member too acknowledges the two Chief Engineers, Er. Repangyangba Longkumer, HOD and Er. N. Thsathrichem Sangtam, WSSO, PHED Nagaland, for technically guiding the PHE Department in an excellent fashion and also motivating the PHED officials for such an remarkable accomplishment.
As for the men’s arm wrestling Vethozo Lohe emerged as the winner of both right hand and left hand categories while Kuvumerü emerged as the runner up in left hand while Huluyi was the run ner-up in the right hand category.Inthe Women arm wrestling category, Ra zucilu Lohe emerged as the winner while Loreni Tsanglao secured the sec ond position.IntheBest Physique competition Talimoa from Star gym was adjudged the winner followed by Solo mon from Wolves gym.
PTI. “We have taken all the precautionary steps for the India round. We have taken all the steps to ensure we can race in India for a long period. We are looking at a winter round for India next year.”Akbar Ebrahim, presi dent of Indian motorsports federation FMSCI, wel comed the development.
The member also ‘positively viewed and appreciates’ the PHED Commissioner and Secretary Mr. Mhombemo Patton for his constant, inspiring and diligent efforts for departmental progress and advancement.
Chiveyi phesao nyekha Cisato ringa President, CWUD Gen. Secy. -4488/22dp
36th National Games in Gujarat, from September 29 to October 12, will similarly throw up fresh talents who will then go on to wear the tricolor with distinction.
In the push-up (wom en), Merenla emerged as the champion while Pete heile secured the second position.Inthe men’s catego ry, Atsi with 93 push-ups emerged as the winner fol lowed by Medovizo Belho (91).
FEliCiTaTiOn
Indian talisman Sunil Chhe tri will be desperate to add the coveted Durand Cup title to his illustrious career when he leads Bengaluru FC against Mumbai City FC in the summit clash here on Sunday.For38-year-old Chhe tri, who is in the twilight of his career, the Durand Cup is missing from his trophy cabinet. It’s also the same for Bengaluru FC, who have won all major Indian competitions since coming into existence in 2013, but not the Durand Cup. BFC were the ISL 2018-19 champions, and also have six other top do mestic titles to their name, and will be vying for their seventh. “It’s very, very spe cial. It is one of the oldest tournaments which in itself is very big. As a club we have not won it,” Chhetri said of Bengaluru FC who have won the I-League twice, In dian Super League once and the Federation Cup/Super Cup thrice. “More so for me... Individually too, I’ve not won the Durand Cup at all. I’ve been fortunate to win a lot of tournaments, almost all the tournaments that one can in India and the Durand Cup is missing,” Chhetri said in the build-up to the“Sotournament.formeit’s an add
WASENMO MAGH MICHAEL KEMP President, TGSU General Secy., TGSU k-2188/22
tion of the track will be done only after the agree ment is signed between MotoGP rights owner and race promoters.Speakingto PTI, Fair street Sports COO Pushkar Nath said they have done their homework for the organisation of the highprofile race, taking into consideration what went wrong with Formula 1 nine years ago. “India is the larg est two-wheeler market in the world. Everyone has a connect with bikes. It has aspirational value. MotoGP is one of the most watched sporting events,” Nath told
2. Dr. Hishalo Tsela, S/o Mr. Lameshe Tsela for securing the post of Veterinary Assistant Surgeon (Class-l Gazetted) under Animal Husbandry & Veterinary Dept.
-4487/22dp
The member on his official tour covered many of the villages under four PHED Divisions. Under Tuensang Division, Ngoungchung, Noksen, Tuensang Village and Yangpi Villages were covered. During the site inspections, the member was particularly impress with the level of ‘Exceptional and Excellent’ technical workmanship executed by PHED Tuensang Division especially in New and Old Mangakhi villages.
Rongsentemsu
OFFiCE OF ThE
Mangakhi Old Village, Tuensang District (One of the Best Performance in Implementation of Jal Jeevan Mission) in the State of Nagaland
WeDeptt.extend
Aier who won the men’s free squats category, re called how he started his fitness journey way back in 2016 when he was in the final year of college.
“ I am happy the event
OFFiCE OF ThE MOkOkChung SEnSO TElOngJEM DiMapur
The union highly appreciates their phenomenal feat and further prays and wishes them the best in their future endeavours. Sd/- Sd/-
With immense pride and honour would like to extend our heartiest congratulations to :
“I had mentioned in our AGM recently that talks were on between both the parties and we have been kept in the loop. I have also had a meeting with the race promoters. They know what they are doing and what is
while Julia Khing secured the runner up position. In men’s squats, Imliyanger Aier won the category fol lowed by Atsi Viyie.
NEW DELHI, SEP 17 (PTI): MotoGP, the pin nacle of two-wheel racing, could come to India in the winter of 2023 if all goes ahead as planned, provid ing a massive boost to the stagnant motorsport scene in theThecountry.master agreement between MotoGP commer cial rights owner Dorna and Noida-based race promoters Fairstreet Sports could be signed as early as next week.
Kikon hoped to con tinue inspiring and moti vating the youth of Na galand to live a healthy lifestyle through the event.
Ntl Games will set the stage for hosting intl sports: Pillay
The three finalists of the Best Physique flexing before the final result. (NP)
While there was no age or weight category, competitions included arm wrestling, free squats, tug of war, and 28-yearpush-ups.oldImliyanger
FELICITATION
MotoGP likely to make India debut in 2023
Since then, he said, there was no turning back for him. Following his dreams so far, he said that he started a gym at his na
A resolute, gritty per formance aided by an own goal from Hyderabad FC’s Odei Onaindia took Ben galuru FC to their first-ever Durand Cup final here on Thursday. MCFC, on the other hand, ousted local heavyweights Mohammed an Sporting in the other semifinal, to set up a clash between two former ISL champions.Thelikes of Javier Her nandez, Roy Krishna and Chhetri up front will have their task cut out, with Des Buckingham’s MCFC at
ChOzubaMi WElFarE uniOn DiMapur FEliCiTaTiOn
ed motivation. We as a club will try our best. Last year our young boys gave a good account of themselves, we want to better that,” he said of their last edition’s show where a young Blues side were eliminated in sudden death by eventual champi ons FC Goa.
The Chozubami Welfare Union Dimapur takes immense pride and joy to convey its heartiest congratulations to Dr. krusato keyho, S/o Dr. Mudozo Keyho on being selected to the post of Veterinary Assistant Surgeon (VAS) Class 1 Gazetted in the recently declared NPSC (CTSE) exam.The union wishes him very best in his future endeavours.
for their untiring and brilliant efforts in reaching out to each and every households in Nagaland under the JJM/ SBM (G) GOI schemes. Finally the official tour report has been sent to the higher ups and concerned(HAYITHUNGofficials.BILL LOTHA) MEMBER State Development Coordination & Monitoring (DISHA) Govt. of India Nominee (Representative) To Govt. of Nagaland
The Office of the Chang Students' Union, Diphupar 'B' Village would like to extend our heartiest congratulations to Mr. Chingkong Chongbou , S/o Mr. L. Ongmang for successfully clearing the NPSC Examination and securing the post of Junior Engineer (Civil Engineer) Class II Gazetted under PHE Department.
Sd/- Sd/-
As being fit has helped her, she said that she would continue to follow the fit ness lifestyle even in the days to Bodycome.builder Kenei lelie Sorünuo, popularly known as Kenei Sorü, who
Sd/On behalf of Tebou Semchirtemdp-4470/22
Games in Kerala, says the 36th edition of the Games is a perfect platform for India’s promising sportspersons to graduate to the international level.Pillay hopes that the
1. Er. Tongpangnokdang Longkumer , S/o Mr. Lt. Akum Longkumer and Mrs. Thungjapeni on being selected to the post of Sub-Divisional Officer (Civil Engg.) Class-1 Gazetted Power Department, Govt. of Nagaland in the recently declared NPSC.
OFFICE OF THE TESOPHENYU GROUP STUDENTS’ UNION
Dorna MD Carlos Ez peleta and CEO Carmelo Ezpeleta will be in the na tional capital on Wednesday and they are expected to make an official announce ment on the ‘Grand Prix of Bharat’.The round is most like ly to be held at the Buddh International Circuit, once home of the Formula I Indian Grand Prix, which was discontinued due to financial, tax and bureau craticThehurdles.FIM h omologa
needed to pull off an event of this“Iscale.hope the master agreement between Dorna and Fairstreet is signed soon and then we can move on to track homologation and the organisation of the race. The support of the govern ment will be key here,” said Ebrahim.Around 5000 people work on a MotoGP week end which incudes races in junior classes Moto 2 and Moto 3. The race will not only put Uttar Pradesh on the global map but is expected to boost tourism.
The 7th edition of the Na galand Street Fitness was held at Sokhriezie Park, BOC, here on SpeakingSaturday.toreport ers, one of the organizers, Yanpvuo Kikon said this edition had witnessed more participation in compari son to the previous years as over hundred attended the one-day sporting event.
dp-4485/22
Correspondent
Most importantly, the member thank and highly appreciates the Hon’ble Chief Minister and Respected Chairman, SDC & MC (DISHA) Shri. Neiphiu Rio for extending his whole hearted support to the PHE Department for streamlining the departmental activities on a timely manner and positive outlook.
MYK C MYK C NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022 SPORTS 11 dc-1087/22 k-2097b Dated: 17/09/2022 Member, SDC & MC (DISHA) Govt. of India, lauds the commendable and appreciable works being executed under Nagaland PHE Department:
Y. Yongthang Sentisangla President General Secy.
KOHIMA, SEP 17 (NPN):
The Union is immensely proud of his achievement and sincerely wishes him the best for his future.
PUNE, SEP 17 (IANS):
Lastly the member extends his sincere and special thanks to Mokokchung EE Er. Hebo Zhimomi, Tuensang EE Er. Kedolhuto, Zunheboto EE Er. Kitoshe Aye and Phek EE Er. Vikuosa
Purnungsang President, MSTD Secretary, MSTD
May our Almighty God bless and lead them in all their future endeavours.Sd/-
tive village earlier this year. Speaking about the importance of fitness, he said “After starting my fitness routines, I have realised that both in my personal and public life, working out has given me peace of mind. And I be lieve that working out gives you, not just good physi cal health but also your mental well-being too”. 51 year old Merenla, win
FELICITATION
2. Dr. N. Lipok Jamir, Pastor Diphupar, S/o Mr. L. Ngangshi Jamir and Mrs. P. Alila for completing his PhD on the Dissertation “The Liberative Motifs of Creation: Towards a Creation Centered Theology from Tribal Perspective” under San Higginbottom University of Agriculture Technology & Science Gospel Plough Institute of Technology.
KOLKATA, SEP 17 (PTI):
“Look I think we have to play as a team tomorrow,” Simon Grayson, BFC’s Eng lish coach said on the eve of the final. “They play a lot of passes. We have to be good tomorrow to stop the opposition. We have to be careful and make sure we play better. “We don’t have any injuries. Our target will be to win the trophy without any injuries. We are in the final and we will make sure that we win the trophy be cause we have the mentality to win,” he added.
With immense pride and honour, the office of the Tesophenyu Group Students’ Union conveys it’s heartiest congratulations to the following members of Tesophenyu Group who have cracked NPSC CTSE 2021.
Tebou Shilunokdang Semchirtem, Chungliyimsen would like to honour and congratulate Er. Tsuktilong Jamir , Son of Mr & Mrs Alemwati Jamir, for successfully clearing the NPSC Examination for the post of Junior Engineer (Mechanical) under Works and Housing our best wishes and may our God Almighty bless you in your future career.
1. Er. Shadrak Kath, S/o Mr. Thunyi Kath for securing the post of SDO (Civil Engg.) (Class -l Gazetted) under Works & Housing Dept.
ner of push ups (women) also said that fitness was important. Daughter of a body builder, the mother of two recalled following her father’s footsteps in fitness.
At least Collins knows what he is dealing with, though.Wolves paid a club record £38m initial fee for Matheus Nunes. The former Sporting Lisbon man is struggling to make an impact.Atone point in the first half, the midfielder lost possession near the halfway line, then chased after three City players who completed a neat triangle of passes and moved the ball out towards the touch line without Nunes getting near enough to make a tackle.As good a talent as he is, Nunes is finding out what an unforgiving envi ronment he is operating in, which is why Costa could not be risked, even for a 10-minute cameo off the bench, given how short of fitness he is.
No, the substituted player can take no further part in the game - not even as a substitute fielder. But if a player suffers an injury while fielding in the middle of an over, the current play ing conditions, as enumer ated under MCC Law 24.1 - substitute fielders, will be in effect. However, if the injured player is replaced by the Impact Player, then he can no longer take part in the match. Otherwise, Impact Player can only be introduced after the comple tion of the over for the field ing side. If an Impact Player is used by a team and an injury occurs, MCC Law 24 - Fielder’s absence; substi tutes - will come into effect.
He said even Neithon gunuo Rio Achumi won gold at the 3rd NPC national Bodybuilding and Physique Championship this year fro which NPC India was interested in knowing about Nagaland and to give oppor tunity to every body builder and fitness enthusiasts.
He also spoke on the empowerment of women
World no. 1 Alcaraz loses to Auger-Aliassime in Davis Cup
Bruyne’s low cross midway through the second half.
MYK C MYK C Printed, Published and Edited by Geoffrey Yaden at G.M. Printers, Circular Rd. Dimapur-797112. Ph: Desk 248489, e-mail-npdesk@gmail.com. Adm.& Advertisement :248267,8798162009 e-mail-npostadvt@gmail.com, R.N. 40978/90 RN/NE 707 SPORTS12 NAGALAND POST, DIMAPUR SUNDAY, SEPTEMBER 18, 2022
The 19-year-old Span iard, who became the youngest player to top the ATP rankings when he claimed the title at Flush ing Meadows on Sunday, joined Sergi Bruguera’s squad on Tuesday and did not play in their opening 3-0 victory over Serbia.
The championship will be judged by India NPC Head, Hemant Angrish and National manager, Ankur as well as the international judges including IFBB pro judge Som Tugnait who will the head judge of the contest.Agapeto therefore urged the fitness enthusiast to avail this opportunity.
LONDON, SEP 17
The World under-20 bronze medallist will take on Yones Aliakbar Emami choghaei of Iran in the bronze medal match later in theInday.the 97kg event, Vicky lost his qualifica tion round bout to Samuel Scherrer of Switzerland 2-2. He was out of medal contention along with Pan kaj (61kg), who also made an opening round exit after going down to Assyl Aita kyn of Kazakhstan.
While there is too much time left in the season to make concrete judgements, on current evidence it is hard to see how Haaland, or champi ons City, can be stopped in terms of the title.
An already tough as signment for Wolves was made impossible after bare ly half an hour.
fivestatehead,NofficersAlliance/thatFourholdliveteurolympiaindia.comsiquealliance.in/www.amawebsiteandbeasanwasgalandThatalwithcomfortathleteseratewhiletheofwasthinglkralliance/Nagalandenthusiasts.PhysiqueNPCBendanglibareiteratedthatthebestaboutNPCNagalandthattherewillbelotsbrandsthatwillsponsorsathletesandgroomthemNPCwaslikeacoopsector.Heurgedthetogobeyondtheirzoneandcompetethebest.StatementorPushpasaidthatNPCNastatechampionshipnotonlyformalebutopportunityforwomenwell.RegistrationfeewillRs.2000perparticipantsopenontheofficialwww.indianphyandregistrationwillalsobedaybeforetheeventatSeasonsHotel.ItmaybementionedNagalandPhysiqueNPCNagalandbearerscomprisesofPhutoluAchumiasstateKimiyetoAgapetoasmanageralongwithothermembers.
a big effort, so we have to pay him respect for fly ing across the Atlantic and coming here to play... credit for that. “I think I showed at the end I was a bit better in the third set and I gave it all.”
VALENCIA, SEPT 16 (REUTERS): U.S. Open champion Carlos Alcaraz crashed to defeat on his debut as world number one, losing 6-7(3) 6-4 6-2 to Canada’s Felix AugerAliassime in their Davis Cup Finals group-stage clash on Friday.
BendangWelcomeImsong.address was delivered by general secre tary, CDFA, Shiyeto Wotsa and special number per formed by Kekhrie Ringa. Altogether eight teams are participating in the tourna ment. Meanwhile, in the opening match, Medzi phema United and Sovima FC played out to a goalless draw.
DIMAPUR, SEP 17
Jacob kicks off CDFA League
Dimapur to host body building & fitness championship
BCCI to introduce ‘Impact Player’ rule in Syed Mushtaq Ali Trophy
SURAT, SEP 17 (IANS):
all over the country, cit ing an example of having an elected President as a woman.Helater
Some of the country’s top shuttlers will be seen in ac tion here from September 20 to 24, with Tamil Nadu’s Sharath Kamal and Sathi yan G. and Delhi’s Manika Batra leading the star pa rade, at the 36th National Games.The table tennis will begin nine days before the official start on September 29 with the Opening Cer emony.Gujarat’s fans are even more excited as their own stars, Harmeet Desai and Manav Thakkar will lead their state’s challenge. The duo joined the squad on Friday after completing their international commitments and are raring to go.
Jacob Zhimomi kicks off the CDFA League on Saturday. (NP)
Staff
four occasions after seven games. Haaland’s latest ef fort was unusual in that he scored it from outside the penaltyReceivingarea. possession inside the Wolves half, Haaland was allowed to turn and run before drilling a low shot past Jose Sa.
Taking to the court after Roberto Bautista Agut beat Vasek Pospisil to put Spain up 1-0, Al caraz sealed a tight opening set in the tiebreak, before his 13th-ranked opponent switched gears.
The game had barely started before Grealish scored. Although the for mer Aston Villa man was the subject of home fans’ ire after Collins’ dismissal,
the blame lay squarely with the home defender, a £20m summer signing fromCollinsBurnley.is still finding his feet at Molineux and a three-match ban that will rule the Welshman out of league matches against West Ham, Chelsea and Nottingham Forest will not help that process.
The Impact Player can replace any player in the starting XI before the 14th over of an innings. The captain, the head coach or the manager has to notify the on-field or the fourth umpire before the end of the current over. A batting team can introduce an Impact Player at the fall of a wicket or during the innings break. After the introduction of an Impact Player in a match, the player can bat and may bowl his full quota of four overs in an uninterrupted in nings. In case a player retires hurt, Impact Player can be introduced only at the end of the over in progress and is
Yes, but not if a de layed start shortens the match to fewer than 10 overs per side.
The 22-year-old Au ger-Aliassime’s first win over a world number one dragged his team back into the tie at 1-1 and he then teamed up with Pospisil to face Marcel Granollers and Pedro Martinez in the doubles decider.
“It’s a big win for me and for the team,” AugerAliassime said. “For me, because Carlos is the new number one. But he made
Thevictory.victory took Can ada to the top of group B with Spain, in second spot, Serbia and South Korea all with a chance to qualify for the knockout stages in Mal aga from Nov. 22-27. Two teams from each of the four groups will advance to the next stage.
If umpires are satisfied that
Felix Auger Aliassime in action during his match against Spain’s Carlos Alcaraz (Reuters/Pablo Morano)
Haaland scores again as Man City beat Wolves 3-0
They will get ample home support to boost the chances of the home team and are hoping to bag at least 3-4 medals from TT. Their haul will help Gujarat begin on a positive note to be on course for their dream of finishing in the Top Five.
In the men’s 74kg quarterfinal bout, India’s Sagar Jaglan lost to threetime world champion win ner Kyle Dake of the USA. Vicky lost his first round bout to Poland’s Radoslaw Marcinkiewicz 4-3.
chance to compete in Ama teur Olympia in Mumbai on October 28, 29 and 30.
DIMAPUR, SEP 17 (NPN): For the first time, Dimapur is all set to host the first amateur body building and fitness championship on OctoberThe18.championship is organized by Nagaland Physique Alliance/NPC Nagaland.Addressing a press con ference here on Saturday, NPC Nagaland state man ager Kimiyeto Agapeto said that the contest will be held on October 18, from 3 p.m. to 8 p.m. at covenant hall, Christian Higher Secondary School,TheDimapur.competition will be held in four categoriesmen’s body building, men’s physique, classic body build ing, women in bikini accord ing to the weight and height.
Members of the NPC Nagaland during the press meet on Saturday. (NP)
intention to motivate the physique
The competition will not only be limited to locals but will be opened to anyone who is an Indian citizen.
(NPN): Minister of PHED, Jacob Zhimomi on Sat urday kicked off the first District Football League 2022 of son,providedspecialofwithmenttry,stateimpactcommunitiesintramanyedportanceassignedcapableinformed,thebehaviouratitscapitalgreatesting,tionDistrictnizedTheChümoukedima.leagueisorgabyChümoukedimaFootballAssocia(CDFA).AddressingthegatherJacobstatedthatthestrength,assetandofthecountrywasyouths.Hesaidbylookingthecharacteristicsandofyouthsinstate,theywerewelldynamicandtotakeonanytasktothem.Speakingontheimofsports,henotthatsportshavebroughtcountries,societies,andinterstateandtogether.HealsospokeontheofDr.TAointheandtheentirecounwherebythegovernofIndiahadcomeupaStampinthenameDr.T.Ao.Jacobalsorecalledthestatusandschemestothesportsperundertheleadership
AssociateRinoAkhogrammefootballcessfullyChümoukedimacongratulatedonforsucconductingtheLeague.Earlier,theprowaschairedbyKezoandVisakoandinvocationbyPastor,CABA,
It may be noted that all the premier and most suc cessful bodybuilders were all part of NPC and hosting the contest will provide an opportunity for the Naga fitness enthusiasts who have talent in building bodybuild ing and fitness to make into Mr. Olympia in USA. NPC have set their eyes on Na galand as one of the Naga body builder won the NPC Nationals in May 2022, Agapeto said.
Haaland also provid ed the pass from which De Bruyne created Foden’s second-half goal.
How is this different from BBL’s X-Factor rule? The X-Factor rule al lows teams to substitute a member of their starting XI beyond the 10th over of the first innings, and the replaced player cannot have already batted, or bowled more than one over.
a fielder has been injured or become ill during the match, a substitute fielder is allowed to field in place of an injured player. The substitute shall not bowl or act as captain.
Director of competi tion, Kushal Sangtani in formed that players from other states have started coming in and have been put up in the best hotels in the city.
Meanwhile, Olym pic silver medallist Ravi Dahiya was out of medal contention after losing to Uzbekistan’s Gulomjon Abdullaev in the 57kg qual ification round here on Friday.World No. 2 Dahiya lost by technical superior ity (10-0) to the Uzbek in a rather one-sided bout.
(AGENCIES): Erling Haaland continued his impressive scoring run as Manchester City went back to the top of the Premier League with a comfortable win against 10-man Wolves at Molineux.Thehosts had only touched the ball once be fore Jack Grealish put City in front after just 55 sec onds.Haaland scored for the seventh consecutive game and took his tally to 14 in the past nine when he doubled the visitors’ advan tage with a long-range ef fort after 16 minutes, BBC reported.Aspirited Wolves con tinued to try and attack, even after Nathan Collins was sent off for a high firsthalf tackle on flickingpleting23,leaguetoneverfansmentenoughegoinjuryJimenezHowever,Grealish.withRaulmissingthroughandnewarrivalDiCostanotdeemedfitforanyinvolvebeyondmeetingsomebeforethegame,theylookedlikelytoaddtheirpaltrytallyofthreegoals.Bycontrast,CityhavewithPhilFodencomtheirvictorybyhomeKevinde
Haaland scores a goal against Wolves.
World C’ships: Punia losses in QFs, Sagar to fight for bronze
Staff Reporter
“I didn’t arrive in very good physical condition. Very, very tough. The court is very slow. I had just two days to adapt my game to this court. It was really tough day,” Alcaraz said.
“Nothing can stop you in progressing ahead in this great nation” he stated.
The Canadian pair came back from a break down at 4-5 in the decid ing set to win the last three games and clinch the rub ber and the tie with a 4-6 6-4 7-5
Sagar Jaglan
(PTI): Olympic bronze medallist Bajrang Punia (65kg) on Saturday suffered a shock quarterfinals defeat and was out of gold medal contention while Sagar Ja glan will grapple for bronze in the 74kg event at the Wrestling World Champi onshipsBajrang,here. a Jaglan,terfinals.pointsEnriquedefeatedmedalhereacheschampionthehisChampionshipdian,thekomihalis23-year-old0)achampion,Commonwealthtwo-timeGamessuccumbedtotechnicalsuperiority(10-defeatatthehandsofYianniDiaoftheUSAin65kgquarterfinalbout.The28-year-oldInwhohasthreeWorldmedalstoname,willnowhopetwo-timecadetworldDiakomihalisthefinalsothatgetsashotatabronzeviatherepechage.Earlier,BajranghadCuba’sAlejandroValdesTobieron(5-4)intheprequarThe18-year-oldontheotherhand,
NEW DELHI, SEP 17 (AGENCIES): The BCCI is set to introduce the Impact Player rule in the upcoming season of its domestic men’s T20 tournament, the Syed Mushtaq Ali Trophy, which will begin on October 11, Starsport reported. What exactly is the rule?
eligible to bat. In any situa tion, only 11 players can bat. Can the substituted player take further part in the game?
of Prime Minister, Naren dra Modi.Healso spoke on how the state government, un der the leadership of chief minister, Neiphiu Rio was very keen on development of sports, music, arts, etc.
federation in the world and for the first time, NPC has decided to hold the contest for bodybuilding and fitness contest in Nagaland.
On the formation of Nagaland Physique comit tee/ NPC Nagaland, Aga peto said that the commit tee was formed with the
He said that state Championship was basi cally a qualifier and the winners of the contest will not only receive cash prize and awards, but will get a
In doing so, he be came the first player to score in their first four Pre mier League away games.
A replacement player can bowl a maximum allot ment of four overs, even if the player they’ve replaced has bowled.
Forthree.context, when Mohamed Salah broke the record for goals in a 38game season in 2017-18, he had found the net on
The age limit for the competition will be 18 years and above.NPC Nagaland is also expecting around 150 male participants. Agapeto said that National Physique Committee (NPC) is th e largest and the most presti gious amateur bodybuilding
Will teams be allowed an Impact Player in short ened games?
Each team will name four substitutes in the team sheets at toss, and only one of them can be used as an Impact Player during the match. Both teams can use only one Impact Player. The move isn’t mandatory.
Haaland had scored more goals on his own than 13 of City’s 19 Pre mier League rivals before kick-off - and by the end the visiting fans were sing ing “Erling Haaland has scored more than you” at Wolves supporters. The current tally is Haaland 11, Wolves
BELGRADE, SEP 17
continued his quest for a bronze medal in 74kg as he defeated Suldkhuu Olon bayar of Mangolia 7-3.
Reporter
Surat all decked up as TT action set to kick off