Tampa Bay News and Lifestyles, Trinity Magazine, Vol. 18, Issue 09, September 2022

Page 5

By JoyForBergmanthirtyyears, the homegrown small business of Donna’s Cleaning Angels has been blessing those in the Tampa Bay area with impeccable cleaning and out-of-this-world customer service. The company has built an awe-inspiring reputation for being the “Number 1” cleaning crew in the Bay-area. In addition to providing topnotch services to their clients, Donna’s Cleaning Angels areSee “Cleaning Angels” on page 20

SwagJacobsonDecoratingAthletesChevalTechSAT/ACT....................................8Editor.........................5Talk..................................10Cares............................14oftheMonth........22-23Den........................24CulinaryArts............26Marketing..................28-29 Classifieds.................................30 INSIDE THIS ISSUE ®Your

“Let Our Family Care for Yours” - The Dr. Shirmo and Dr. Eldridge Story

See “TFP” on page 18

From

THIS INDEPENDENT COMMUNITY NEWS, BUSINESS & DINING GUIDE IS DIRECTLY MAILED ONCE EACH MONTH TO: Aristida, Champion’s Club, Chelsea Place, Country Place, Ellington Estates North, Ellington Place, Fairway Springs, Fox Hollow, Fox Wood, Greenbrook Estates, Heritage Lake, Heritage Springs, Hills Of San José, Hunter’s Ridge, Hunting Creek, Longleaf, Magnolia Estates, Nature’s Hideaway, Oak Ridge, Riverbend, Riverchase, River Crossing, River Oaks, Riverside Estates, Riverside Village, Riverside Villas, Seven Springs Golf & Country Club, Southern Oaks, Spring Lake, The Sabals, Thousand Oaks, Timber Greens, Trinity, Trinity East, Trinity Oaks, Trinity West, Veterans Village, Woodbend, Woodgate, Wyndgate & Wyndtree the community. Your magazine.

Vol. 18, Issue 09, September 2022

If caring, passion, and ded ication aren’t currently a daily part of your personal medical experience with your present physician, you should consider visiting the family practice of Trinity Family Physicians, Dr. Amir Shirmohammad (Dr. Shir mo), and Dr. Eldridge. They are Located on the corner of Trinity Blvd and Duck Slough Blvd at 1817 Cypress Brook Dr., Suite 101, Trinity, FL.

The Premier “Shop Local” Community Magazine Directly Mailed To 18,000 Homes In Trinity & Surrounding Areas

The doctors are pleased to announce they are celebrating the 15th Anniversary of their practice on September 1st, a testament to the quality and variety of the medical services they professionally provide for their many patients. HAPPY ANNIVERSARY DR. SHIRMO AND DR. ELDRIDGE! Visit their website theytionbooklyphysicians.comwww.trinityfamiortheirFacepageformoreinformaaboutthemanyservicesprovide.

Dr. Amir Shirmohammad (Dr. Shirmo), and Dr. Stephanie Eldridge

Donna’s Cleaning Angels Honors Angel Steve Insolia

By T. Bostock

2 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 3

4 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

Labor Day is commonly celebrated by most Americans as the symbolic “end of the summer” kickoff and is typically enjoyed with beach days, family gatherings, barbecues, fireworks displays, parades, shopping sales, and otherLaborevents.Day

Hispanic Heritage Month. During the four weeks, celebrations honor the heritage and contributions made by members of the Hispanic community. Celebrate Hispanic Heritage Month by joining local celebrations. It is a fantastic way to meet new people. Additionally, you can learn more about the contributions Hispanics have made in politics, business, the arts, sports, fashion, and cuisine, to name a few. Embracing the history and traditions of another culture not only broadens your knowledge but also teaches apprecia tion of other people and their customs.

By the time you probably read this, Labor Day will have already come and gone. Regardless of the timing, I hope you all had a wonderful and safe holi day with your loved ones.

safe!Until

From September 15th through Oc tober 15th, we also recognize National

Labor Day constitutes a yearly national tribute to the incredible con tributions workers have made to the strength, prosperity, and well-being of our country. It has officially been celebrated as a Federal holiday in the United States since June 1894.

Despite all these incredibly fun events happening all over our beau tiful city, let’s not forget that we’re still in the middle of a pandemic. So whatever big crowded events, and social interactions you choose to enjoy this beginning of Fall, please be cau tious. If you’re not feeling well or are showing any symptoms please stay home and be mindful of others. Even though there are no more official mask mandates or social distancing being enforced, let’s all continue to do our part to keep our Tampa Bay community next time,

Labor Day is a special day set aside to honor and pay tribute to hard-work ing men and women. It was a creation of the labor movement and is dedicat ed to the social and economic achieve ments of American workers.

Carla M. Dubis Tedeschi.

in Tampa FL is not just the end of summer but a chance to have a holiday from work or school and kick off the NFL & college football seasons. For the local baseball fans, I hope you’re keeping a close look at our Rays! Personally, I am looking forward to October and the start of hockey season. Go bolts!

A Labor Day Message and Hispanic Heritage Month

6 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 7

JUNIORS often want to have an idea of their scoring levels, and to be prepared for the PSAT in mid-October … which is the only qualifying exam for the National Merit privatetheyexamsexperiencegettingSOPHOMORESScholarships.areaheadbygainingtakingtheseandassessingwherearewithscoring.Also,manypublicandhighschoolsperiodicallygivetheSATto“track”students,meaningtoseeatwhatleveltheyarecapableofscoringacademicallywhichmeanswhatlevelofclassestheycantake.

TIONTHECOLLEGEandandDates:twoneededintheshouldEveryonelevels.interestedcheckthisoutwithBrightFuturesprogram.TherearenochangestheSATandACTscorestoqualifyfortheseawardlevels.UpcomingFallTestSATonOct2,Nov5,Dec3;ACTonOct22Dec10.ASECRETKEYTOADMISSIONISCOLLEGEAPPLICAESSAYHavingtalkedwith

8 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

al ideas about organization, style, including personal examples and quotations, and much more in writing their best essay. They are all written in “hook, look, took” format … meaning you have to “hook” the reader in the first sentence or two, pull that person in to “look” at what you want to say, leave with a vivid “took”, and say, “Wow! I wish more essays were like this one.”Inside are 40 sample essays that have helped my students gain admission to many colleges in the “Top 25” and UF, FSU, USF, UCF, more.

SAT AND ACT IMPROVEMENT: SEPTEMBER - MAJOR EXPANSION!

“early decision” or “early acceptance” because the probability of acceptance is usually 2 - 3 times higher than for regular admissions.

many admissions officers of the “Top 25” such as Har vard, Yale, Princeton … plus UF, FSU, USF, and UCF, they tell me students who apply “self-select”, that is are in the range for admissions on Class Standing, GPA, and SAT/ACTOftenscores.theapplication essay makes the difference between a “Yes or No” for admission.The104 page book I have written (cover above) gives my students addition

If You Would Like To Talk More About Your Student … Please contact me at 727-253-0639 or send me an email at wwa0811@ mykolab.com.

Dr. Wayne Adams is one of the leading SAT and ACT tutors in the country. His students normally improve around 200 points on the Writing, Reading, and Math superscore on the SAT, and 4 – 7

SPECIAL … SPECIAL … SPECIAL!!Iwanted to let you know that recently Gover nor DeSantis signed legisla tion to allow students to count hours from part-time work towards their hours needed to qualify for the 75% and 100% awards. Be fore, only volunteer hours counted.Soif you student had a part-time job this sum mer, the hours could count towards qualification for the $18,000+ or $25,000+ scholarship

points on the ACT composite. They have been admitted to all 5 of the “Top 5”, 9 of the “Top 10”, and 19 of the “Top 25” universi ties in the country, , and many top universities in Florida. These schools include Harvard, Yale, Princeton, Columbia, Stanford, U Chicago, Duke, U Penn, Johns Hopkins, Cornell, Notre Dame, Emory, UC Berkley, UCLA, USC, UNC (Chapel Hill), Wake For est, NYU, Northeastern (Boston), Boston College, Georgia Tech, Service Academies: Navy - Air Force - and Merchant MarinePenn State, LSU, Auburn, UF, U Miami, FSU, USF, UCF, Florida Atlantic, Florida Gulf Coast, FIU, New College of Florida, Stetson, and Julliard – Manhattan - New England - and Berklee Conser vatories of Music. Many have received academic, athletic, or music scholarships. He has also tutored three juniors who scored at the national merit finalist/semifinalist levels on the PSAT. He is a former Dean of a Graduate School of Business and Full Professor, and began college teaching at the University of Maryland in 1968. He has degrees and advanced studies at Harvard, Yale, Vander bilt, Columbia International, and Luther Rice.

We just finished our summer classes, and I thought you would like to see part of an email I re cently received from one of my students.Iamhappy to report back to you that I got a 32 composite on the ACT! 35 reading, 31 math, 29 read ing, and 34 science! I don’t know how I got a 34 on science. I still can’t believe it. I need one more point to improve to a 33, and will be taking the test again soon. Thanks for all your help. I am so happy with a 32, and potentially even a 33.

As we move ahead in the fall term SENIORS… are getting ready for these exams as part of their college ap plications. Most are due by Jan 1, except for UF which has a “stone cold” early Nov deadline.Foramuch higher chance of acceptance, I advise seniors to go for

By Dr. Wayne Adams

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 9

Any additional software you may have purchased for your computer should be installed next. Test each program as you install it. Then move onto installing the next program.

Tech Talk with Bob: Setting up your new system

Now, with your security software installed, updated, and properly configured, you are ready to setup

Are you certain your computer is safe? You don’t have to do this alone my friend. My team and I are here to keep your computer safer and keep it running. My team repairs computers and secures them, on our bench, onsite in your home or office, and even remotely. We have the best solutions already in place and we’re only a phone call away. Call us anytime at 727-534-4000. We’ve been helping folks restore their peace of mind, and sanity, with their technology for decades.WeKeep You Safer In Your Digi tal World!

install any additional hard ware you might have such as printers, scanners, etc. Test each hardware de vice as you install it. Then move onto installing the next device.

Last time we addressed consider ations for purchasing a new computer. Today, we’ll look at setting that com puter up when you get it home or to your office.

Before you connect your new computer to the internet, it’s a good idea to safeguard yourself with repu table security software protection. The problem is you must connect to the internet to initially download the security software. Sort of a “Catch-22” situation. But don’t worry. As long as you are certain you do not go any where else on the internet you should be able to safely download and install the security software you have chosen. Once installed, be sure to download and install all the product updates too.

your email account(s). Do not open any emails until you have properly secured your computer. Emails are the number-one way viruses and other malware find their way into your com puter.Next,

a new computer can be a lot of fun. However, properly setting up a new system can be time-consum ing for some and just flat out over

whelming for others. My team per forms new system setups every week. So, if you just bought a new computer and need some help assimilating it into your technology setup, give us a call. We also specialize in transferring your data from your old computer to your new computer, even if your old computer won’t turn on.

We have the software and hard ware as well as the knowledge and experience to provide you with a safe and secure data transfer from your old computer to your new computer. If we can be of service to you call me now at 727-534-4000.

10 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

And finally, it’s time to transfer all your data from your old computer’s hard drive to your new computer’s drive. This can be the most criti cal operation of setting up your new system. There are a number of ways to achieve this. Data transfers can take anywhere from a few minutes to a few days depending on the amount of data involved, speed of the hard ware devices, and the transfer method used.Getting

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 11

12 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 13

14 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 15

16 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 17

Eldridge are board certified family physicians. This is important because it de notes additional training, certifying their skills and

Neither wanted to treat just a single part of the body. Family practice

knowledge as experts in their field. This is a modernday love story of both the individuals and their profes sion. They met while work ing at Busch Gardens and have been inseparable ever since.Together, they attended Tulane University for Bach elor’s and Masters degrees. Medical School at Tulane Medical School followed shortly after for both of them. While in school, they faced the choice of decid ing on a specialty. It was difficult for them since, ac cording to Dr. Eldridge, they liked all of their rotations and didn’t want to have to choose just one.

mary focus, like her partner, is on prevention of disease, instead of treatment.

Dr. Eldridge indicated that being one of their patients has its responsi bilities. In selecting them for their doctors, patients are expected to help with their treatment by follow ing instructions that help avoid diseases in the first place. Their joint practice emphasizes prevention to all of their patients in all aspects of their treatment. As the saying reminds us, “an ounce of prevention is worth a pound of cure!”

If you are laboring under the misconception that a family practice is nothing more than old fashioned attitudes and outdated philosophies, a visit to Trin

“TFP” continuedstoryfrom page 1

“Women,” Dr. Eldridge noted, “are more likely to go to a doctor than men. I think they make their health a priority. Look at their obstacles, working, juggling what they go through as a wife, a mother and some times even the breadwin ner.”Dr. Eldridge said she ap preciated what other wom en go through and wanted to be able to treat a wom an’s overall health, “taking care of every aspect, like getting pap smears done, managing their cholesterol and heart health.” Her pri

“I really want to stress,” Dr. Shirmo said, “how thankful we are for all the wonderful patients that have allowed us to take care of them, their parents, wouldn’tcommunityoutandgrandparents,children,grandkids,theirneighbors.Withthemforreferralsandsupport,webehere.”BothDr.ShirmoandDr.

A married couple, both Dr. Shirmo and Dr. Eldridge emphasized they wanted to thank their patients for allowing them to treat them.

became the ideal solution. It gave them a chance to treat the entire patient. “We loved to learn, and we loved medicine. It Just made sense for us.”

or motivational speaker,” he laughed.Regardless of who you choose for your doctor, Dr. Eldridge warns that you should do your own due diligence. You need to learn if they went to an accred ited medical school. Even more importantly, be certain that they are board certified in their specialty to ensure the quality of your care.

If you are fortunate enough to live in the area, Trinity Family Physicians are only a phone call away. Call Monday through Friday from 8:30 AM to 5:00 PM. (727 834 8377). Schedule your office or re mote appointment today for a healthier tomorrow.

update their own training in the latest techniques and procedures.Theunexpected onset of Covid 19 caught the na tion by surprise. A number of businesses and medical practices were unfortunately not equipped to deal with its results; they had a diffi cult time and did not sur vive. In response to how the pandemic impacted their own practice, Dr. Shirmo said: “We were well posi tioned. We were able to transition our patients to tele visits (remote visits from the comfort of their homes) without missing a beat and continued giving the qual ity of the care our patients required.”Dr.Shirmo stressed their caring attitude towards their

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 19

patients. Although they are affiliated with local area hos pitals, through information and prevention, he noted, “our goal is to be there for our patients in the office and keep them out of the hospital. That is why we like to emphasize prevention, prevention, prevention!”

“Men shy away from go ing to a doctor,” Dr. Shirmo observed. “I know how to handle those personalities. It makes my day when I make a difference in some one’s life. It is a true passion for me.” He agreed he had to be a psychologist as well as a doctor in order to do his job. “You’re absolutely correct,” he said. “We wear many hats, sometimes coach, sometimes office manager, project manager

ity Family Physicians will be a pleasant surprise for you. In addition to the modern, pleasant, caring surround ings, state-of-the-art equip ment, and themdatingdridgesuccessfortwoprofessionalaretreatments,forward-thinkingbothdoctorsquicktocredittheirstaff,includingphysicians’assistants,theroletheyplayintheofthepractice.Dr.ShirmoandDr.Elarecontinuouslyuptheskillsthatearnedtheirinitialboard certification. It enhances the quality of the care they provide for their patients. As mentors in their field, they willingly share their knowledge and experience with future generations of doctors, interns, who peri odically visit the practice to

understand why they’ve remained in business for so many years in this area. I have referred them to many people.” And many other happy clients agree! “I love the feeling of coming home to a sparkling clean home and Donna’s Cleaning Angels deliver every time!”

JoAnne Peters of Palm Harbor businesswoman,Asrejoiced.atrue

being hard workers. Her family’s dedication to their Italian restaurant of over 70 years helped teach her to have a strong work ethic in whatever she does. When Donna moved to Florida in 1991, she started cleaning houses as a side job. During this time, the inspiring entrepreneur was cleaning for an elderly woman on hospice, of whom she became close friends with. Donna soon gifted the older woman a beautiful crystal angel, and her friend then referred to her as her “Cleaning Angel.” And that’s how “Donna’s Cleaning Angels” got its wings!Donna married “the love of her life,” Steve, in 1997, and his great business skills helped her employ 22 angels over time in the company. In addition, Steve lovingly started several other businesses for his wife, including Madam Butterfly Boutique and The Ten Dollar Store. The couple were active in many includingendeavors,workingat various flea markets and festivals throughout the state. As entrepreneurs with big hearts, Steve and Donna have trained their employees at Donna’s Cleaning Angels to work with the same positive attitude and dedication that they have shown. And as a result of the team’s hard work over the years, the angels have won the trust of their customers for doing “the job right the first time,” both openly and

20 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

“You never told me how to live the rest of my life without you,” Donna says in Steve’s memory. “I honor you, I miss you, and I love you. My heart aches for your smiling face, and to hear your voice and laughter... He was spontaneous, creative, adventurous, funny, classy, and beautiful, just to name a few of his qualities,” she reminisces. While this past year has been unbelievably hard to bear, Steve’s angelic touch has been with Donna and her angels all the way. Donna continues to honor Steve by providing the best cleaning services possible with her team each and everyday. “Even though I have a broken heart, you will live on through me,” she says. I will be your voice and promise that I will never let anyone forget you...I keep going to make him proud.”Donna InsoliaFerrante was born into a mixed Italian and FrenchCanadian family up in New Hampshire, who were notoriously known for

honestly. In fact, some of Donna’s clients have been using her for over 20 years! Diane Morris of Odessa was particularly pleased by the angels’ work, and wrote, “The girls work in teams, this way they have a lot more energy together. References and insurances provided per request. Her team brings their own supplies,” she said. “Donna herself returns my calls...I’m very pleased with this company, and

also punctual, trustworthy, and most importantly, caring. And now, it’s time to honor one very special and caring angel who helped make it all happen, Steve Insolia. Donna’s late husband Steve helped grow Donna’s Cleaning Angels to the huge success that it is today. Unfortunately, Steve passed away from Covid on Februrary 18th of 2021, leaving a void with Donna.

Donna & Steve are married on December 27th, 1997

Donna enjoys getting to meet her clients while giving them

“Cleaning Angel” story continued from page 1

“A Magical Love Story Forever.”

brighter throughout the area, and it’s all a result of the great people who helped make it happen.

Steve made such an impact in so many people’s lives that Donna continues to share that same blessing every day with her community by providing the best in cleaning services.

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 21

a free consultation for their residences. Whether you need a deep-house

cleaning or a regular cleaning, Donna’s angels will provide your home

Donna and Steve together in 2020

with the versatile tools needed to uncover your place’s natural shine. The experienced and welltrained angels perform every job with the finest cleaning products, including high-quality germ-killing chemicals, commercial grade vacuums, and much more. No matter the service or the situation, whether you need a last minute clean before you move out of your house, or a nice clean for your brand-new home before you move in, Donna’s Cleaning Angels are ready to help and do a thorough job. Or as they say, “We are obsessed with the details of clean!” Altogether, the impressive company serves a total of three counties, including Pasco, Hillsborough, and Pinellas. Three decades later, the well-known cleaning service continues to shine brighter and

Tampa Bay News & Lifestyles would like to thank Donna and Steve for all of their support over the years. Dust your home-ownership worries away with Donna’s Cleaning Angels today! Call them now at (727) 942-8289. References provided upon request. As Steve would say, they really are “Simply The Best.”

“When someone you love become a memory, that memory becomes a treasure.”

Donna’s Cleaning Angels’ ability to truly care for their clients brings heaven just a little closer to home. And now that one angel has already made it there, Donna honors him with these very words: “Thank you for giving me the most exciting life...Thank you for being my everything in life, Steve. Just know I am so grateful for all we had and did. You always told me that we were truly a magical love story and many people knew why that was so true…There will never be another Steve Insolia. Always know that I will love you forever and you are truly my magical love story. What a blessing you were to me...”

Service Aces and 6 Blocks.” Coach Weber Congratulationssaid. to Kinnah Kreidler, Gregg Schindler Female Student Athlete of the Month.

Kreidler for the Gregg Schindler Female Student Athlete of The Month.

22 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

Now as her sixth and final year starts, she plans to spend it surrounded by her teammates as they prepare for the upcoming matches.

Bump. Set. Spike!

Kinnah Kreidler, a senior varsity volleyball player at J.W. Mitchell High School, was selected as the Gregg Schindler Female Student Athlete for September

After this school year she will be attending University of Tampa on a softball scholarship. Kreidler looks up to anyone who is a hard worker and professionally softball players like Sierra Mero. She looks forward to playing rivalry games this year and is ready to show how she’s approved since last tremendouslyseason.“I’veimprovedthanks to all my coaches for volleyball. They’ve helped me so much since I don’t play volleyball for a club. [I feel] they have helped me so much just in this small part of the year,” KreidlerKreidlersaid. was selected as Player of the Match after their game against Largo High School on Aug. 23 and again on Aug. 25 against Gulf High School. Currently, the girls varsity volleyball team has a three week winning streak consisting of games against Largo, Gulf, and Sickles.BradWeber, J.W. Mitchell High Coach of the varsity and JV girls volleyball team nominated

withvolleyballnew.itsoftballbeeninhighKreidler’syearSimmeringCarberry-Asthenewschoolbegins,sodoesKinnah(’23)lastyearofschool.Whileshewassixthgrade,KreidlerhadexclusivelyplayingwhenshedecidedwastimeforsomethingShedecidedonandhasstuckitforthepastsixyears.

“ Kinnah was the player of the game in both our opening two wins with a combined total of 19 Kills, 4

By Hanna

Kinnah Kreidler (‘23) smiles at her fellow team mates before the game during introductions. Photo provided by Kinnah Kreidler

“[We] usually as a team, go out to dinner to kind of calm ourselves down. We just like to have fun before the games and try not to take anything super seriously. This year I’m finishing up volleyball strong as this will be my last year playing and then I’ll have a successful softball season later this year,” KreidlerThoughsaid. Kreidler’s volleyball career is coming to an end this will not be the end to her career in sports.

this honor after seeing growth in his skill and maturity level.

Coach Schmitz recognized Simmons for

September’sThurberathlete

“Our relationship has gotten so much better as he’s gotten older. I think he would even admit he was a little bit immature as a freshman, but he’s turned into a mature young man. I feel I have a tight relationship with him, he can be honest with me, and I can be honest with him as far as telling him when he’s doing well and critiquing him when he’s not,” Schmitz said.

Simmons fell in love with football at six years old, when he started playing for the New Tampa Wildcats Pop Warner team. Since then, he has dominated the sport, being pulled up from Junior Varsity to Varsity his sophomore year. Head Coach Schmitz guided Simmons’ transition throughout his high school football career, making the decision to pull him up to Varsity.

By Cassidy

Gaining experience since freshman year, as Simmons plays alongside his teammates, he has built a close teammate relationship on and off the field. After earning the captain spot on Varsity during his senior year, he led the team to a win at their first game against Gulf High School. Starting the year off strong, Simmons tied a school record: three touchdowns at a single game.“Playing with my teammates for years has really helped me because they keep me in line when I’m being lazy or doing something wrong that’s why I think it’s great to be so close with my teammates on and off the field we really become a family and make sure we keep everyone accountable, same with my coach. I have great leaders on the team and because of that I think we’re headed in the right direction,” Simmons said.

Work hard, Play Harder!

Mitchell High School, Varsity football captain, Drayk Simmons (‘23) has been selected by Coach Schmitz for the Gregg Schindler Athlete of the Month

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 23

On August 19 2022, Drayk Simmons (‘23) surveys the field at the preseason game happening at Steinbrennar High School. Photo by Kole McGibbon

Congratulations to Drayk Simmons for being awarded the Gregg Schindler Athlete for September.

of the month, Drayk Simmons (‘23), shines on the field during Friday night’s Varsity games as the first-string wide receiver and captain.

“Coach Schmitz is an amazing coach who has guided me throughout the last 4 years. Coach has really taught me how to be a great player on and off the field; which I’m super thankful for. He truly is one of the greatest coaches I’ve had,” Simmons said.

24 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

Top accessories to bring your space to the next level

Clocks are quite literally timeless accessories that fit into any style, theme, or room in your house. Browse for a unique digital clock or a fascinating, classic analog clock for a bare room in your home to make heads turn.

Work with a decorator for assistance

Accessorizing can be intimidating if you don’t have a lot of experience in interior design and decorating. But there’s no need to take on the project on your own! At Decorating Den Interiors, I can help you bring your vision to life and create a space that’s more complete in your home.

1. An Area Rug

4. Floating shelves

Putting a large canvas of artwork in your home shows your appreciation for creativity and can tie your room’s theme together. If you want to make a meaningful statement, find a piece from a local artist in the community and place it in a room that encourages conversation and togetherness.

2. A room divider

5. A fun clock

Decorating your living space is a very intimate task. You want to make sure your home is equally comfortable and stylish while also putting your personality on display for you, your family, and guests to enjoy. The color of the walls and the furniture within a room can set a strong foundation for the way the rest of the space will look, but accessories bring everything together. Just like an outfit needs jewelry and a bag, a bedroom needs accent pieces that bring the theme to life and help you illustrate the exact look and feel you envisioned during the planning process.

By Decorating Den Interiors

Open floor plans have always been popular, and there’s no speculation that the trend is dying off anytime soon. However, more homeowners are falling in love with the idea of creating separation when it feels

this accessory if you want to curate division in your space without committing to new drywall.

Your kitchen deserves some fun and functional accessories too, so why not consider a mini garden? A lovely garden box near the window can add an environmental aspect to your kitchen space and provide delicious fresh herbs, fruits and vegetables whenever you need them.

Does your living room need a revamp? Is your guest bathroom feeling blander and more boring than usual? Here are a few suggestions for accessories that can bring your living space to the next level:

Shelving systems are effective pieces of furniture that can add more style to a space while creating a home for all your favorite books, works of art and other trinkets and accessories. If you don’t want to invest in a bookshelf that takes up a large portion of your home office, a wall of floating shelves can make a major statement.

Area rugs have a way of giving a room an entirely new identity, whether the floors are carpeted or hardwood. A soft shag rug near the center of the room can complete the space, make it look cute and cozy — and provide the ultimate layer of comfort for your feet after a long, exhausting day.

3. A mini garden

6. Local art

Creatingright: a “zen den” is simple with stylish room dividers — consider

Eye-catching art is a great conversation starter.

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 25

• 2 lettuce leaf, spinach, savoy or red cabbage, cut chiffonade (roll up tight and slice very •thinly)1carrot, julienned

• 2oz. vermicelli rice noodles cooked, then cooled

*For garnish: soy, tamari, sweet and sour, or chili sauce

• Pour Ponzu sauce over cooked noodles.

• Fill the center with desired

• Black sesame seeds or chopped peanut Instructions:s

•ingredients.Wrapingredients “snuggly”

26 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

• large brown or white spring roll wrappers

Late SpringSummerRolls

• ½ zucchini or cucumber, thin sliced or julienned

by folding over, turning in the sides, and rolling tightly

• Cut in half at an angle and arrange on a bed of lettuce and spinach.

• Sprinkle with black or toasted sesame seeds or

• Arrange all ingredients on a work surface.

• Carefully dip the wrapper into warm water to soften and place it on a cutting board

• ½ red pepper, julienned

JACOBSON CULINARY ARTS ACADEMY AT TARPON SPRINGS HIGH SCHOOL

• 4oz. cooked chicken breast, cooled and shredded

• 1 ripe avocado, thinly sliced

•peanuts.Fillaramekin with a variety of dipping sauces and enjoy!

• 2 Tablespoons Ponzu sauce

• Fill a round cake pan with warm water.

for dipping.

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 27

28 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

pany, SWAG Party Rentals, focuses on your individual party needs. Often over looked are things as simple as having enough seating for your party goers. Lind say assured me that they have enough seating avail able to accommodate any size party. Wouldn’t it be embarrassing if Aunt Edith, who just had a hip replace

So, You’re Having a Party?

planning elicits groans rather than sighs of joy, you might want to remember this catchy little ditty: “Skip the bother and skip the fuss. If you are having a par ty, you need to call us!” The “us,” in this case, is owner Lindsay Williams and the talented professional party planners at SWAG Party Rentals, your one-stop shop

By TomCelebrationsBostock

for all of your celebration needs. As owner Lindsay noted, “we can save ev erybody time and stress by planning your entire party, taking the stress off your plate. We can organize and plan all of your vendors. Most importantly, we are local, reliable, and afford able.”Afamily-owned com

Someone must order the catering, arrange for the entertainment, buy, and send out the invitations or email your friends after agreeing on the guest list. Those are just a few of the tedious, all.SWAGproblem,No?onegettabletables,forthesuredaysareover,fun,ningelementstime-consuminginyourpartyplanprocess.Soundslikeordoesit?With2022alreadyhalfdon’tdespair,therestillseveralmajorholiyettocelebrate.I’myou’vealreadylocatedthemedcenterpiecesyourHalloweenbashtomakethemunforaffairsforeveryinattendance,right?Ifnot,thatcouldbeabutdon’tdespair,PartyRentalshasitIfthethoughtofparty

are impor tant parts of the American persona. We don’t even need an excuse, just a memorable moment. It can be a graduation, anniver sary, birthday, or any other reason for a party. With so many details and so much stress associated with plan ning and executing a good party, it is a wonder that anyone ever has one.

ment, couldn’t find a seat at your party? That can never happen with SWAG Party Rentals. We pay attention to your every event detail. Shouldn’t you be enjoying your party and not worrying about the details?

we are more flexible with pickups, drop-offs, and spe cial customer requests.” In a previous interview, Lind say told me that “if some one needed something and it was feasible and reason ably affordable,” she would purchase it and make it available to her customers. The photos included in this article will show the results of some of her recently added purchases.

I asked Lindsay what was the advantage of us ing SWAG Party Rentals over a competitor. She did not hesitate with her an swer. “We are nearby. As a smaller family-run company,

To enhance any holiday celebration, SWAG Party Rentals can provide a vari ety of thematic decorations for just about any event. Do you need a scary cen terpiece to complete your Halloween table or some thing with a Pilgrim motif to compliment your Thanks giving celebration? Would a custom backdrop or wall backstop add just the right touch to your festivities? SWAG can provide them, and they are only a simple phone call Cateringaway!tosmall to midsized groups and fam ily gatherings, SWAG can provide games, products, and services for every age group. Even the latest crazes, corn hole, and a ver sion of step golf are avail able to add to your party’s entertainment.

In response to reserva tions, Lindsay said, “ide ally, I would like a month in advance, but we are also available at the last minute if necessary. That is where our flexibility comes in.” Call 813 240 5474 or either visit their website at tion.”rememberwillAtFacebooktipstheirswagpartyrentals.comwww.orFacebookpageforforyournextevent.Herpagepromises:SWAGPartyRentals,wecreateanexperiencetoatyourcelebra

Want to capture the memory of your party for a lifetime? That’s right. SWAG Party Rentals even has an available photo booth. It is one of their most popular attractions and is run by Lindsay’s son, J. B. The col orful strips of photos can be customized to reflect any theme, adding even more fun to any party. There is also a QR code available. Taking a picture of it digital ly adds the photos to your cell phone. Lindsay noted that “customers enjoy it!”

Parties can be fun, memorable, and enjoyable events. Don’t let the stress of planning a party ruin your celebration. Call SWAG Party Rental today! 813 240 5474 Now, get out there and enjoy. Go have a party!

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 29

30 SEPTEMBER 2022 For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com

A NEW LOOK Pressure 2Washing.cardriveway $75 (includes all front sidewalks). 3 car driveway $95 (call for long driveways). Pool decks & cages $125-$200. I also gently clean home exteriors, gutters, soffits, lanai’s & fences - Free estimates. Heritage Springs, Trinity & other

for a FREE estimate!

Custom Edge Window Cleaning. Residential and commercial. Reasonable rates. Also offering Vinyl window cleaning. Fully licensed and insured. Call Gary at 727-877-5650

• CALL DARIN. www. insured.experience.com.lowcostpressurecleaning.20+yearsLicensedand( 727) 207-9176

CLEANING

Owner performs all jobs. We offer many services, from switch replacements to ceiling fan installations and more. Reasonable rates. Keep this ad on your refrigerator, we do troubleshooting as well! Licensed, EC13005494, and insured. Call CHARGER ELECTRICAL SERVICES @ 727-9375999.

Mary’s Spotless Touch Cleaning Service, Inc.- Licensed, Insured and Bonded for your piece of mind. We offer both residential and commercial cleaning and have been cleaning in the area for 15 years. No home/office too large or small. We are extremely pet friendly, pay attention to detail that is often overlooked and supply all the necessary cleaning products to efficiently clean your home/office and leave it smelling and looking wonderful!!We also offer other cleaning services such as carpet cleaning, deep cleaning, windows, etc. Weekly, biweekly and monthly rates available. Now also accepting Visa, MC, American Express, and Discover for your

convenience. Call for a free estimate today with a dependable and trustworthy company!! Call Mary (727) 389LOW0347.COST PRESSURE CLEANING. HOUSES

Experienced teacher with two master’s degrees and knowledge of Spanish and French. ESL certified with 120-hour course through Oxford Seminars, both classroom, and practicum. I seek students who are motivated to learn writing.English,conversationalreading,andIcharge$25 per hour and live in New Port Richey. Zoom meetings are available as well as one-to-one in-person teaching. Call 941-962-

CONTRACTOR.ELECTRICALOWNERFAMILYCONTRACTORELECTRICALCallanewlookpw.comwww.Randy727-271-2920OWNEDANDOPERATED

WINDOW0028.

ENGLISH AS A SECOND LANGUAGE

local areas. Resident of 34655.

• POOL CAGES • DRIVEWAYS AND SIDEWALKS • POOL DECKS • PVC FENCES • CLEAN OUT GUTTERS

TRINITY AREA CLASSIFIEDS

For Advertising Info 727-943-0551 I info@nnlflorida.com or visit tbnewsandlifestyles.com SEPTEMBER 2022 31

Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.