Rev_MVZ_Cordoba_19(1) by Revista MVZ Córdoba

Diseño y Diagramación Luis Carlos Salgado Arroyo Ingeniero de Sistemas luis_salga2@hotmail.com Diva Santana Cordero Lic. Informática divayaneth@hotmail.com

Impresión Gráficas del Caribe Ltda. Cra. 1B No. 40-42 Tel. (57) (4) 782 6622 Telefax (57) (4) 782 7688 email: diseno@graficaribe.co

Revista MVZ Córdoba Journal MVZ Córdoba EDITOR

Marco González T. M.Sc. Universidad de Córdoba. Montería, Colombia

COEDITOR CO-EDITOR

Salim Máttar V. Ph.D. Universidad de Córdoba. Montería, Colombia

ASISTENTES DEL EDITOR - ASSISTANT EDITORS Luis Carlos Salgado A. Ing. German Arrieta B. M.Sc. Diva Santana C. Lic. Universidad de Córdoba. Montería, Colombia

COMITÉ EDITORIAL - EDITORIAL COMMITTEE James N. Mills Nelson Alvis G. Raúl Poutou P. Oscar Vergara G.

Ph.D. Ph.D. Ph.D. Ph.D.

C.D.C. Atlanta, USA U. de Cartagena, Cartagena, Colombia Pontificia Universidad Javeriana, Bogotá Universidad de Córdoba, Colombia

COMITÉ CIENTIFICO - SCIENTIFIC COMMITTEE Nicholas Komar Maria Aguero R. Joaquín Quilez C. Claudio C. Fonseca Priscila V. Logato Marcelo B. Labruna

Ph.D. Ph.D. Ph.D. Ph.D. Ph.D. Ph.D.

C.D.C. Atlanta, USA N. Y. Medical College, USA U. de Zaragoza, España U. Fed. de Vioçosa, Brasil U. Fed. de Lavras, Brasil U. de São Paulo, Brasil

Jorge Salazar B. Juan Carulla F. Henry Grajales L. Claudia Jiménez E. Agustin Góngora O. Sandra Pardo C.

Ph.D. Ph.D. Ph.D. Ph.D. Ph.D. Ph.D.

Texas Tech. University U. Nacional, Colombia U. Nacional, Colombia U. Nacional, Colombia U. de Los Llanos, Colombia U. Nacional, Colombia

Revista MVZ Córdoba La Revista MVZ Córdoba es una publicación científica de la Facultad de Medicina Veterinaria y Zootecnia de la Universidad de Córdoba, Montería, Colombia. Se publican artículos de procedencia nacional e internacional que estén relacionados con las ciencias agropecuarias en la modalidad de artículos originales de investigación, revisiones de literatura, comunicaciones breves y casos clínicos. Los temas que publica la Revista MVZ Córdoba tienen correspondencia con la medicina veterinaria, zootecnia, acuicultura, biología, biotecnología, ciencias básicas biomédicas, salud pública y otros tópicos de interés de las ciencias agropecuarias. La revista está dirigida a los profesionales de la medicina veterinaria, zootecnia, salud pública, epidemiología, acuicultura, biología, ciencias básicas biomédicas y biotecnología. Artículos y correspondencia: Los artículos deben ser enviados por correo electrónico al Editor de la Revista MVZ Córdoba. Correos: revistamvz@gmail.com revistamvz@unicordoba.edu.co Preparación de artículos: La información se puede encontrar en la sección Instrucciones para los Autores. También se puede consultar en el sitio web: http:// apps.unicordoba.edu.co/revistas/revistamvz/index.htm. Suscripción: La Revista MVZ Córdoba se publica cada cuatro meses y circula los meses de abril, agosto y diciembre. Los números de un año se agrupan en un volumen comenzando por el del mes de abril. La suscripción anual tiene un valor de US $40 para Colombia; US $55 para América Latina y el Caribe; US $60 para USA y Canadá; US $75 para otras regiones. Para suscribirse, se debe diligenciar el formulario que aparece al final de cada revista. Reproducción e impresos: Se autoriza la copia de artículos para uso académico o científico de las instituciones, citando la fuente. Para obtener ejemplares impresos se debe hacer la solicitud al Editor a través de los correos de correspondencia de la Revista MVZ Córdoba. Publicidad: La Revista MVZ Córdoba y la Universidad de Córdoba aclaran que la aceptación de publicidad no compromete la aprobación ni el respaldo de los productos o servicios que contraten pautas comerciales o de difusión. Teléfono: (57) (4) 756 9027 - Montería, Colombia. Acceso en línea: http://apps.unicordoba.edu.co/revistas/revistamvz/index.htm En el enlace anterior, se puede encontrar la revista a partir del volumen 5, número 1 enero-junio de 2000, y acceder a los artículos completos, las instrucciones para los autores y las suscripciones.

Journal MVZ Córdoba The Journal MVZ Cordoba is a scientific publication of the Faculty of Veterinary Medicine and Zootechny of the University of Córdoba, Montería, Colombia. It publishes national and international articles related to the agricultural sciences in the form of original investigation, literature reviews, short communications and clinical cases. The subjects that are published in Journal MVZ Córdoba correspond to veterinary medicine and zootechny, agriculture, biology, biotechnology, biomedical basic sciences, public health and other subjects of interest in agricultural sciences. The magazine is directed to professionals in veterinary and zootechny medicine, public health, epidemiology, aquaculture, biology, biomedical basic sciences and biotechnology. Articles and correspondence: Articles should be sent by via e-mail to the Editor of the Journal MVZ Córdoba. E-mails: revistamvz@gmail.com. revistamvz@unicordoba.edu.co. Articles preparation: Information can be found in the Instructions for Authors section. The website can also be consulted: http://apps.unicordoba.edu.co/revistas/ revistamvz/index.htm. Subscription: The Journal MVZ Córdoba is published every four months and circulates in the months of April, August and December. The issues are compiled in a yearly volume beginning with the month of April. The yearly subscription costs US$40 for Colombia; US $55 for Latin America and the Caribbean; US $60 for USA and Canada; US $75 for other regions. To subscribe, fill out the form that appears at the end of each magazine. Reproduction and printing: Copying articles for academic or scientific use of the institutions is authorized, citing the source. To obtain printed issues a request should be made to the Editor through the correspondence address of the MVZ Córdoba Magazine. Publicity: The Journal MVZ Córdoba and the Universidad de Córdoba make clear that accepting advertising does not affect the approval or backing of the products or services that have commercial ads or diffusion. Telephone: (57) (4) 756 9027 Montería, Colombia. Online access: http://apps.unicordoba.edu.co/revistas/revistamvz/index.htm. Starting with Volume 5, Issue 1 from January-June 2000, access to complete articles of the journal as well as instructions for authors and for subscriptions can be found in the above link.

Revista MVZ Córdoba Journal MVZ Córdoba

Categoría A1 Impresa desde Volumen 1, número 1, año 1994 Printed effective with Volume 1, issue 1, 1994 Publicación cuatrimestral / Published triannualy ISSN 0122-0268 Rev.MVZ Córdoba © 2014 Facultad de Medicina Veterinaria y Zootecnia, Universidad de Córdoba, Montería, Colombia. Financiada por / Sponsored by: Universidad de Córdoba

Revista MVZ Córdoba Volumen 19

ENERO - ABRIL

Número 1

CONTENIDO EDITORIAL

Veinte años divulgando ciencia Marco González, Salim Mattar

3919

ORIGINAL Efecto de diferentes niveles dietéticos de proteína y lípidos en el crecimiento de reproductores del langostino de agua dulce Macrobrachium carcinus Mario Benítez-Mandujano, Jesús Ponce-Palafox

3921

Ecología trófica de Saccodon dariensis (Pisces: Parodontidae) en afluentes del río Guatapé, Cuenca río Magdalena, Colombia Ana Restrepo-Gómez, Zoot, Néstor Mancera-Rodríguez

3930

Influencia del eter gliceril guayacolato sobre la anestesia en tilapias comparado con benzocaina y eugenol

Geovana Cosenza, Gustavo Claudiano, Paulo Marcusso, Silas Eto, Wilson Manrique, Bruna Loureiro, Marina Shimada, Rogerio Salvador, Julieta Moraes, Flavio Moraes

Diagnóstico comparativo y distribución geoespacial de Cryptosporidium spp., en terneros diarreicos en lecherías de Valdivia, Chile Pamela Muñoz, Ruben Mercado, Gabriela Morales, Viviana Bravo, Eduardo Raffo

Efecto del ensilado de caña de azúcar en los parámetros productivos de vaquillas Holstein-Friesian para reemplazo Jose Reyes, Oziel Montañez-Valdez, Candido Guerra, Jose Palma

Factores que afectan la reactivación ovárica postparto en vacas Holstein, en el trópico alto Humberto Guáqueta, Jorge Zambrano, Claudia Jiménez

Algunos aspectos ecológicos de fases de vida libre de Haemaphysalis juxtakochi Cooley, 1946 (Acari: Ixodidae) en Panamá Gleydis García, Angélica Castro, Sergio Bermúdez, Santiago Nava

Relación entre apoptosis y secuencia del dominio BH2 del peptido VP5 del virus de la necrosis pancreatica infecciosa Cesar Ortega, Sylvia Rodriguez, Juan Espinoza, Juan Kuznar, Alex Romero, Ricardo Enriquez

Evaluación de las propiedades fisicoquímicas y funcionales del polen apícola colombiano Carlos Fuenmayor, Carlos Zuluaga, Consuelo Díaz, Marta Quicazán, María Cosio, Saverio Mannino

Aplicación del modelo logístico para describir la curva de crecimiento en perros de diferentes razas Sandra Posada, Luis Gomez, Ricardo Rosero

3944

3954

3962

3970

3984

3990

4003

4015

Revista MVZ Córdoba Volumen 19

ENERO - ABRIL

Número 1

COMUNICACIÓN BREVE Tratamiento con dosis única con secnidazol en corderos naturalmente infectados con Giardia duodenalis Ural Kerem, Aysul N, Voyvoda Huseyin, Ulutas Bulent, Aldemir OS, Eren Hasam

Estimación de parámetros genéticos para características de la leche en la raza ovina local Rumano Pelmus RS, Pistol GC, Lazar C, Gras MA, Ghita E

4023

4033

Journal MVZ Córdoba Volume 19

JANUARY - APRIL

Issue 1

CONTENTS EDITORIAL Twenty years publishing science Marco González, Salim Mattar

3919

ORIGINALS Effects of different dietary of protein and lipid levels on the growth of freshwater prawns (Macrobrachium carcinus) broodstock Mario Benítez-Mandujano, Jesús Ponce-Palafox

Trophic ecology of Saccodon dariensis (Pisces: Parodontidae) in Guatapé River tributaries, Magdalena River Basin, Colombia Ana Restrepo-Gómez, Zoot, Néstor Mancera-Rodríguez

3921

3930

Influence of glyceryl guaiacolate ether on anesthetics in tilapia compared to benzocaine and eugenol

Geovana Cosenza, Gustavo Claudiano, Paulo Marcusso, Silas Eto, Wilson Manrique, Bruna Loureiro, Marina Shimada, Rogerio Salvador, Julieta Moraes, Flavio Moraes

Cryptosporidium spp., comparative diagnosis and geospatial distribution in diarrheic calves from dairy farms, Valdivia, Chile Pamela Muñoz, Ruben Mercado, Gabriela Morales, Viviana Bravo, Eduardo Raffo

3944

3954

Effect of sugarcane silage on productive parameters of replacement Holstein-Friesian heifers Jose Reyes, Oziel Montañez-Valdez, Candido Guerra, Jose Palma

Risk factors for ovarian postpartum resumption in Holstein cows, under high tropical conditions Humberto Guáqueta, Jorge Zambrano, Claudia Jiménez

Some ecological aspects of free-living Haemaphysalis juxtakochi Cooley, 1946 (Acari: Ixodidae) in Panama Gleydis García, Angélica Castro, Sergio Bermúdez, Santiago Nava

Relationship between apoptosis and the BH2 domain sequence of the VP5 peptide of infectious pancreatic necrosis virus Cesar Ortega, Sylvia Rodriguez, Juan Espinoza, Juan Kuznar, Alex Romero, Ricardo Enriquez

Evaluation of the physicochemical and functional properties of Colombian bee pollen

3962

3970

3984

3990

Carlos Fuenmayor, Carlos Zuluaga, Consuelo Díaz, Marta Quicazán, María Cosio, Saverio Mannino

4003

Application of the logistic model to describe the growth curve in dogs of different breeds Sandra Posada, Luis Gomez, Ricardo Rosero

4015

Journal MVZ C贸rdoba Volume 19

JANUARY - APRIL

Issue 1

SHORT COMMUNICATION Single dose of secnidazole treatment against naturally occuring Giardia duodenalis infection in Sakiz lambs Ural Kerem, Aysul N, Voyvoda Huseyin, Ulutas Bulent, Aldemir OS, Eren Hasam

Estimation of genetic parameters for milk traits in Romanian local sheep breed Pelmus RS, Pistol GC, Lazar C, Gras MA, Ghita E

4023

4033

Rev.MVZ Córdoba 19(1):3919-3920, 2013. ISSN: 0122-0268

EDITORIAL

Twenty years publishing science Veinte años divulgando ciencia La Revista MVZ Córdoba es una publicación científica de la Facultad de Medicina Veterinaria y Zootecnia de la Universidad de Córdoba, Montería, Colombia. Su misión es la divulgación del conocimiento científico y tecnológico de las ciencias agropecuarias; y su visión es convertirse en referente de consultas en el ámbito nacional e internacional en el campo de las ciencias agropecuarias y promover valores éticos que contribuyan con el desarrollo de la investigación científica y tecnológica.

The Journal MVZ Córdoba is a scientific publication of the Faculty of Veterinary Medicine and Zootechny of the University of Córdoba in Montería, Colombia. Its mission is to publish scientific and technological knowledge of agricultural sciences and its vision is to become a national and international consulting reference in the field of agricultural sciences and to promote ethic values that contribute to the development of scientific and technological investigation.

Este año se conmemora el vigésimo aniversario de la Revista MVZ Córdoba y, por lo tanto, es importante recordar algo de su historia.

This year the Journal MVZ Córdoba celebrates its twentieth anniversary, which is an important time to remember something of its history.

El primer número de la revista fue publicado en 1994 con 11 artículos y este número constituyó el volumen uno. En la actualidad, la revista publica tres números por año que conforman un volumen con más de 75 artículos. En los veinte años de existencia de la revista, se han divulgado 579 artículos y el 62% de ellos correspondió a artículos originales. En este periodo han publicado 1856 autores, de los cuales el 35% fueron locales; el 41%, nacionales y el 24%, internacionales. Desde su creación, la revista ha desarrollado planes de mejoramiento relacionados con la calidad científica, calidad editorial, visibilidad, el arbitraje de artículos y la impresión. En los últimos siete años, por ejemplo, se divulgaron 368 artículos divulgados y el 73% de ellos correspondió a artículos originales. En este espacio de tiempo, participaron 412 autores internacionales y se emplearon 707 árbitros: 30% fueron internacionales; 60%, nacionales y solo el 10%, locales. También se ha incrementado la visibilidad, al indexar la Rev. MVZ Córdoba

The first issue of the journal was published in 1994 with 11 articles that made up volume one. Today, the journal annually publishes three issues that make up a volume of more than 75 articles. In the twenty years since the journal started, 579 articles have been published and 62% of them corresponded to original articles. During that time, 1856 authors have published, of which 35% were local; 41%, national and 24%, international. Since its creation, the journal has developed improvement plans related to scientific quality, editorial quality, visibility, article refereeing and printing. In the last seven years, for example, 368 articles were published, and 73% of these were original articles. In this time, 412 international authors participated and 707 referees were used: 30% were international; 60% national and only 10% local. Visibility has also increased; the Journal MVZ Córdoba is listed in 32 new international databases

3919

3920

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

en 32 nuevas bases de datos e índices internacionales y para este año, 2014, se actualizaron las instrucciones para los autores. Además de historia, la revista tiene nuevos retos como, por ejemplo, realizar la publicación anticipada de la misma, ya que esta estrategia facilita la interacción oportuna entre investigadores y permite cumplir con los estándares nacionales e internacionales relacionados con esta materia.

and indexes, and this year, 2014, the instructions to authors were updated. In addition to its history, the journal has future challenges. For example, there are plans to produce in advance publication which aids in timely interaction between investigators and allows for compliance with national and international standards related to the subject.

Teniendo en cuenta lo anterior y que la generación y rápida divulgación del nuevo conocimiento son elementos fundamentales que contribuyen con el desarrollo y crecimiento de la sociedad; a partir de este año, 2014, la revista se empezará a publicar de forma anticipada y en dos idiomas: español e inglés.

Keeping in mind the above and aware that the production and rapid dissemination of new knowledge are fundamental elements that contribute to the development and growth of society; starting in 2014, the journal will begin to have in advance publication in two languages: Spanish and English.

En esta edición, queremos manifestar nuestro reconocimiento a todos los autores que creyeron en la Rev.MVZ Córdoba y enviaron sus artículos para sometimiento y publicación. A los árbitros que realizaron su valiosa e insustituible labor desde el anonimato, puesto que ellos revisaron y corrigieron, con independencia de criterio, los artículos que se les enviaron para ser evaluados. A todas las personas e instituciones que han formado parte de esta revista, desde su creación, impresión, publicación, dirección, capacitación, evaluación y financiación.

In this issue, we want to manifest our acknowledgment to all the authors that believed in the Journal MVZ Córdoba and submitted their articles for publication. Also to the referees that have performed a valuable and irreplaceable anonymous work, they guided the journal by independent criteria to check and correct articles submitted for evaluation. And also to all the people and institutions that have formed part of this journal in its creation, printing, publication, administration, training, evaluation and funding.

Asimismo queremos expresar nuestra gratitud a todas las autoridades académicas y administrativas de la Universidad de Córdoba que han apoyado esta iniciativa.

We also want to express our gratitude to the academic and administrative authorities of the Universidad de Córdoba that have supported this initiative.

Para terminar, haciendo alusión a una estrofa de la canción “Volver” del famoso cantante argentino de tangos, Carlos Gardel, que reza… “Sentir, que es un soplo la vida, que veinte años no es nada, que febril la mirada errante en las sombras te busca y te nombra”… queremos expresar con lucidez que veinte años no es nada, pero que estamos listos para enfrentar los próximos veinte.

Finally, we remember a line from the song “Volver” by the famous Argentine tango singer Carlos Gardel which says, “To feel that life is but a breath, that twenty years is nothing, how feverish the roving glance in the shadows that searches for you and speaks your name”, we want to express that twenty years is nothing, and that we are ready to face the following twenty to come.

Marco González T. M.Sc.

Salim Mattar V. Ph.D.

Rev.MVZ Córdoba 19(1):3921-3929, 2014. ISSN: 0122-0268 ORIGINAL

Effects of different dietary of protein and lipid levels on the growth of freshwater prawns (Macrobrachium carcinus) broodstock Efecto de diferentes niveles dietéticos de proteína y lípidos en el crecimiento de reproductores del langostino de agua dulce (Macrobrachium carcinus) Mario Benítez-Mandujano,1 M.Sc, Jesús T. Ponce-Palafox,2* Ph.D. Universidad Juárez Autónoma de Tabasco, División Académica Multidisciplinaria de los Ríos, Laboratorio de Acuacultura. Carretera a Estapilla km. 1 Col. Solidaridad. Tenosique, Tabasco 86900. México. 2Universidad Autónoma de Nayarit, Escuela Nacional de Ingeniería Pesquera y Centro de Innovación y Transferencia Tecnológica (CENITT). Tepic, Nayarit 63155. México. *Correspondencia: jesus.ponce@usa.net 1

Received: February 2013; Accepted: August 2013.

ABSTRACT Objective. Evaluate the effects of varying dietary protein and lipid levels on the growth and body composition of adult freshwater prawns, Macrobrachium carcinus (Linnaeus 1758), in a recirculation system for 11 weeks (77 days). Materials and methods. The experimental treatments were assigned in triplicate. Six test diets were formulated with three different protein levels (35, 40 and 45%) and two lipid levels (8 and 13%). Results. The highest survival rate, growth indices and feed utilization were observed for M. carcinus adults fed protein:lipid diets of 35:13, 40:13 and 45:13, and the lowest values for these parameters were recorded for prawns fed diets with the lowest lipid levels; the differences in these parameters between these types of diets were significant (p<0.05). A nonsignificant tendency for an increased percentage of protein in the body with an increased dietary protein level was observed. The percentage of lipids decreased with an increasing dietary protein level, and no definite trends in ash content were found. Conclusions. The results suggest that a diet with 35% dietary crude protein and 13% lipids enhances the growth and body composition of adult M. carcinus. Key words: Diets, growth, Macrobrachium, nutrition (Source: CAB).

RESUMEN Objetivo. Evaluar los efectos de diversos niveles dietéticos de proteína y lípidos en el crecimiento y composición corporal de reproductores del langostino de agua dulce Macrobrachium carcinus (Linnaeus 1758), en un sistema de recirculación durante 11 semanas (77 días). Materiales y métodos. Los tratamientos experimentales fueron asignados por triplicado. Seis dietas de prueba fueron formuladas con tres niveles diferentes de proteínas (35, 40 y 45%) y dos niveles de lípidos (8 y 13%). Resultados. Se observó la tasa más alta de supervivencia, índices de crecimiento y utilización del alimento para ejemplares adultos de M. carcinus alimentados con niveles dietarios de proteína: lípidos de 35:13, 40:13 y 45:13, mientras que el valor más bajo en estos parámetros se registró en langostinos alimentados con el nivel más bajo de lípidos; las diferencias en estos parámetros entre estos tipos de dietas fueron

3921

3922

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

significativas (p<0.05). Se observó una tendencia no significativa en un aumento del porcentaje de proteína en el cuerpo con un nivel mayor de proteína dietética. El porcentaje de lípidos disminuyó con un nivel de proteína dietario creciente, y no se encontró ninguna tendencia definida en el contenido de cenizas. Conclusiones. Los resultados sugieren que una combinación de dieta de proteína cruda del 35% y 13% de lípidos mejora el crecimiento y composición corporal de M. Carcinus adultos. Palabras clave: Crecimiento, dietas, Macrobrachium, nutrición (Fuente: CAB).

INTRODUCCIÓN

INTRODUCTION

El langostino de agua dulce Macrobrachium carcinus, uno de los palemónidos más grandes de América, vive en aguas salobres y frescas del norte, centro y sur de América (desde Florida hasta el sur de Brasil) y en las Indias Occidentales (1). La especie es una importante fuente local de proteínas para el consumo humano a lo largo del Océano Atlántico en América Latina. Aunque los ejemplares adultos de M. carcinus viven y se reproducen principalmente en agua dulce, el desarrollo larvario se produce sólo en agua salobre. Esta es una especie de interés comercial que ha sido explotada por la industria pesquera en varios países. En los estudios de idoneidad de esta especie para propósitos de acuicultura se ha reportado la posibilidad de cultivar artificialmente y criar exitosamente las larvas en la etapa juvenil (2).

The freshwater prawn Macrobrachium carcinus, one of the largest American palaemonids, lives in fresh and brackish waters of eastern North, Central and South America (Florida to southern Brazil) and the West Indies (1). The species is an important local source of protein for human consumption along the Atlantic Ocean in Latin America. Though M. carcinus adults live and breed mainly in fresh water, larval development occurs only in brackish water. This is a species of commercial interest that has been exploited by the fishery industry in several countries. Studies of the suitability of this species for aquaculture purposes have reported the possibility of artificially cultivating and successful rearing the larvae through the juvenile stage (2).

El alimento es uno de los factores más importantes que afectan el crecimiento, conversión alimentaria y composición de la canal de langostinos de agua dulce (3). Los langostinos en todas las etapas de desarrollo se alimentan tanto de material animal como vegetal, incluyendo insectos acuáticos, peces, moluscos, otros crustáceos, algas, hojas y tallos de plantas acuáticas y semillas de plantas de diversos tipos (2). Una ligera preferencia por alimentos de origen animal es observable en gambas con una longitud total mayor a 26 mm.

Food is one of the most important factors affecting the growth, feed conversion and carcass composition of freshwater prawns (3). Prawns in all stages of development feed upon both animal and vegetable material, including aquatic insects, fish, mollusks, other crustaceans, algae, leaves and stems of aquatic plants and plant seeds of various types (2). A slight preference for animal food is observable in prawns above 26 mm in total length.

Los langostinos de agua dulce con considerados como un manjar y por lo tanto tienen una alta demanda en mercados nacionales y extranjeros. Son bien conocidos como un alimento alto en proteínas y bajo en grasa, que contiene un 16-19% de proteínas, 1.0-2.2% de lípidos totales y 85-90 kcal de energía bruta (2). Las investigaciones sobre sus hábitos de alimentación y preferencias alimentarias sugieren que las larvas de M. carcinus prefieren alimento vivo y móvil, en este caso los nauplios de Artemia salina (2). Se han realizado pocos estudios sobre la nutrición y alimentación de ejemplares jóvenes de M. carcinus (1). Los ejemplares adultos de M. carcinus fueron alimentados con pellets de camaronina (Purina K-35) que contienen un 35% de proteína. En el langostino malayo M. rosenbergii, la dieta de los especímenes adultos tienen una influencia tanto en el tamaño y la composición bioquímica de los huevos (4). Dietas con diferentes

Freshwater prawns are considered a delicacy and are therefore in high demand in domestic and foreign markets. They are well known as a high-protein and low-fat food, containing 16-19% protein, 1.0-2.2% total lipids and 85-90 kcal of gross energy (2). Investigations into their feeding habits and food preferences suggest that M. carcinus larvae prefer live, mobile food, in this case the nauplii of Artemia salina (2). A few studies have been carried out on juvenile M. carcinus nutrition and feeding (1). M. carcinus adults were fed camaronina pellets (Purina K-35) containing 35% protein. In the Malaysian prawn M. rosenbergii, the adult diet influences both the size and biochemical composition of the eggs (4). Diets differing in protein content affect the quality of eggs produced by adults of both M. rosenbergii and M. tenellum (4).

Benítez-Mandujano - Protein and lipid on growth of M. carcinus adults contenidos de proteína afectan la calidad de los huevos producidos por los ejemplares adultos de M. rosenbergii y M. tenellum (4). El objetivo de este estudio fue determinar que los efectos de un aumento de la proteína en la dieta de animales adultos de M. carcinus para evaluar de mejor manera su crecimiento y calidad nutricional.

MATERIALES Y MÉTODOS Dietas experimentales. En la tabla 1 se muestran los ingredientes y el contenido nutricional de cada dieta experimental. Se formularon seis dietas experimentales con varios niveles de proteína dietaria (35, 40 y 45%) y niveles de lípidos dietarios (8 y 13%). Todos los ingredientes secos fueron finamente molidos, cuidadosamente pesados y mezclados manualmente. Luego se agregó aceite de pescado lentamente mientras la mezcla era revuelta continuamente, y luego se agregó agua (25-30, v/p) para lograr una mezcla homogénea. La mezcla de alimento se llevó entonces a través de una prensa de extrusión con un troquel de 2.5 mm de diámetro. Los pellets de alimento producidos para cada dieta experimental fueron secados al aire libre y almacenados a -15°C hasta su uso. Langostinos y diseño experimental. Los ejemplares adultos de M. carcinus fueron capturados en el río Usumacinta enfrente de la localidad de El Recreo (17°, 28.53’ N, 91° 25.68’ O) en el municipio de Tenosique, Tabasco, México. Los animales

3923

The aim of this study was to determine the effects of increased protein in the diet of M. carcinus adults to better assess their growth and nutritional quality.

MATERIALS AND METHODS Experimental diets. The ingredients and nutrient content of each experimental diet are shown in table 1. Six experimental diets were formulated with various dietary protein levels (35, 40 and 45%) and dietary lipid levels (8 and 13%). All dry ingredients were finely ground, carefully weighed and manually mixed. Fish oil was then added slowly while mixing continuously, and water (25-30%, v/w) was then added to achieve a homogenous mixture. The feed mix was then passed through a screw extrusion press with a 2.5 mm-diameter die. Feed pellets produced for each experimental diet were air dried and stored at -15°C until use. Prawn and experimental design. Adult M. carcinus were caught in the Usumacinta River in front of the town of El Recreo (17° 28.53’ N, 91° 25.68’ W) in the municipality of Tenosique, Tabasco, Mexico. The animals were transported to the Aquaculture Laboratory of the Multidisciplinary Academic Division,

Table 1. Composition and proximate analysis of the experimental diets (%, as-fed basis). Dietary crude Protein (%)

Fish meal1

37.0

37.1

41.0

42.0

40.9

46.0

Soybean meal2

21.5

22.4

28.8

28.3

35.0

35.5

Sorghum meal2

28.9

22.7

17.9

12.1

7.2

1.2

Polychaete meal3

5.0

Gelatin4

3.0

Fish oil5

2.0

6.5

1.7

6.2

1.3

5.9

Soy lecithin6

0.2

0.9

0.2

0.9

0.2

0.9

Super HUFA7

1.0

Vitamin C8

0.5

Cholesterol9

0.5

Vitamin premix10

0.2

0.3

0.2

0.3

Mineral premix11

0.2

Dietary Lipid Total (%) Ingredient (%)

Proximate composition (%, as-fed basis) Crude protein

35.5

35.0

40.0

40.2

45.3

45.0

Lipid total

8.1

13.2

8.0

12.9

7.9

13.0

Fiber

1.2

1.1

1.2

1.1

1.3

1.2

Ash

10.4

10.5

11.1

11.8

12.0

11.6

Carbohydrate

35.4

30.2

29.7

24.4

24.1

19.2

Gross energy (MJ/g)

19.5

19.7

19.6

19.9

19.4

19.8

Proteínas e insumos marinos de Guadalajara Jalisco, México crude protein 635 g/kg, crude lipid 87 g/kg (dry weight basis). 2Galmex; soybean meal: crude protein 465 g/kg, crude lipid 13 g/kg. 3Salt Creek,Inc 3528 West 00.South, Sal Lake City, Utah 84104. 4Wilson, México. 5Sigma. 6Pronat Ultra, México. 7Key HUFA Levels: Sum n3 fatty acids >40% (400 mg/g dry wt.). DHA >30% .EPA >16% .ARA >2.0% . 8Rovimix Roche. jSigma. Japón. 10Tiamina 60mg/kg, riboflamina 25, Niacin 35, Pyridoxine 45, Pantothenic acid 75, biotin 1, B12 0.01, myoinositol 345, Vitamin A 1, Vitamin D 0.1, Vitamin K 5, i Rovimix Roche. 11(g/kg de dieta): magnesium sulphate 0.0051, sodium chloride 0.0024, potassium chloride 0.002, ferrous sulphate 0.001, zinc sulfate 0.0002, copper sulfate 0.00000314, manganese sulphate 0.0001015, selenium sulfide 0.000083, calcium chloride 2H20 0.00514, phosphate di basic sodium 0.0114. 1

3924

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

fueron transportados al Laboratorio de Acuicultura de la División Académica Multidisciplinaria de la Universidad Autónoma de Tabasco, México. Estos fueron aclimatados a condiciones de laboratorio durante 15 días y alimentados con una dieta comercial que contiene un 35% de proteína antes de iniciar el experimento de 77 días. Dieciocho machos y 36 hembras fueron asignados al azar a 18 tanques circulares de plástico (capacidad de 1.000 L). Cada tanque tenía un volumen de operación de 345 L en un área de 1.54 m2 y representan un único grupo de tratamiento que albergaba un macho (205.0±87.2 g) y dos hembras (68.6±17.3 g). Se colocó una tubería de PVC (30 cm de largo y 6 cm de diámetro) en cada tanque como refugios para las gambas. Los tanques fueron mantenidos por un sistema de recirculación continua (2%) mediante una bomba de 3/4 Hp (Siemens N, DF, México) que mueve un volumen diario del 300%; el agua era ventilada por un soplador de 1/3 Hp (Pioneer, RB20-510, LingYa, Kaohsiung, Taiwán) y un filtro de arena (ms HAYWARD 180T Nueva Jersey, EE.UU.) proporciona filtración mecánica. Durante el experimento, los langostinos fueron expuestos a un fotoperiodo de 12:12 L:D. El diseño experimental fue bifactorial, con tres repeticiones por tratamiento: el nivel de proteína en la dieta (35, 40 y 45%) fue designado como el primer factor y el nivel de lípidos dietarios (8 y 13%) como el segundo factor. Los langostinos fueron alimentados con una dieta experimental a saciedad (determinado visualmente) dos veces al día (a las 8:00 y 18:00 horas) durante 11 semanas. Los ejemplares jóvenes muertos y los alimentos sin comer fueron removidos y pesados diariamente. Posteriormente se ajustó la cantidad de alimento proporcionado. El agua fue ventilada continuamente. El agua recirculada del tanque fue evaluada diariamente a las 10:00 horas con respecto a los siguientes parámetros: temperatura del agua (ºC), oxígeno disuelto (mg/L OD), pH, alcalinidad (mg/L) y amoníaco de nitrógeno (N-NH4) usando un medidor de salinidad ATAGO (precisión de salinidad de ± 0.05%); un medidor YSI-58, Ohio, Springfield, EE.UU. (°C±0.7; OD±0.1 mg/L de precisión); un pH-metro Orion Abilene, TX, EE.UU. (pH±0.01); y un medidor multiparámetro (Hanna C200, Hungría). Índices de crecimiento y análisis químico. Se registró el peso grupal, peso individual (g) y longitud total (mm) para cada gamba al final del estudio. Al final de la prueba de crecimiento, todos los langostinos fueron pesados y contados. La ganancia diaria promedio de peso (GDPP, g/d) se calculó de la siguiente forma: GDPP=(Wf-Wi)/t. La tasa de crecimiento específico (TCE, % del peso corporal/d) se calculó de la siguiente forma:

Juárez Autonomous University of Tabasco, Mexico. They were acclimated to laboratory conditions for 15 days and fed a commercial diet containing 35% protein before beginning the 77-day experiment. Eighteen males and 36 females were randomly allocated to 18 circular plastic tanks (1000 L capacity). Each tank had an operating volume of 345 L in a 1.54 m2 area and represented a single treatment group that housed one male (205.0±87.2 g) and two females (68.6±17.3 g). Pieces of PVC pipe (30 cm long and 6 cm in diameter) were placed in each tank to serve as refuges for the prawns. The tanks were maintained by a continuous recirculation system (2%) via a 3/4 Hp pump (Siemens N, DF, Mexico) that generated a daily turnover volume of 300%; a 1/3 Hp blower (Pioneer, RB20-510, Ling-Ya, Kaohsiung, Taiwan) aerated the water, and a sand filter (ms HAYWARD 180T New Jersey, USA) provided mechanical filtration. During the experiment, prawns were exposed to a 12:12 L:D photoperiod. The experimental design was bifactorial, with three replicates per treatment: dietary protein level (35, 40 and 45%) was designated the first factor, and dietary lipid level (8% and 13%) was the second factor. The prawns were fed an experimental diet to satiety (determined visually) twice daily (at 8:00 and 18:00 hours) for 11 weeks. Dead juveniles and uneaten food were removed daily and weighed. The amount of food provided was later adjusted. The water was continuously aerated. Recirculated tank water was tested daily at 10:00 hours for the following parameters: water temperature (ºC), dissolved oxygen (mg/L DO), pH, alkalinity (mg/L) and ammonia nitrogen (N-NH 4) using a ATAGO salt-meter (salinity ± 0.05% precision); YSI-58-meter, Ohio, Springfield, USA (°C±0.7; DO±0.1 mg/L precision); pH-meter Orion Abilene, TX, USA (pH±0.01); and multiparameter meter (Hanna C200, Hungary). Growth rates and chemical analysis. Group weight, individual weight (g) and total length (mm) were recorded for each prawn at the end of the study. At the end of the growth trial, all prawns were weighed and counted. Mean daily weight gain (MDWG, g/d) was calculated as MDWG = (Wf - Wi)/t. Specific growth rate (SGR, % body weight/d) was calculated as: SGR = 100 X (ln Wf – Ln Wi)/t, where ln=natural log, Wf= mean weight at the end of the culture period, Wi= mean weight at the beginning of the experiment, and t=time in days of the experimental period (5). At the end of the

Benítez-Mandujano - Protein and lipid on growth of M. carcinus adults TCE= 100X(Ln Wf–Ln Wi)/t, donde Ln=logaritmo natural, Wf = peso promedio al final del período de cultivo, Wi= peso promedio al principio del experimento y t=tiempo en días del período experimental (5). Al final de la prueba de alimentación, el factor de conversión alimentaria (FCA) fue calculado de la siguiente forma: FCA = (W de alimento consumido)/ (W peso húmedo adquirido); el coeficiente de eficiencia proteica (CEP) se calculó de la siguiente forma CEP=(aumento de peso, g)/(ingesta de proteína,g); y el coeficiente de eficiencia lipídica (CEL) se calculó de la siguiente forma: CEL = (aumento de peso, g)/(ingesta de lípidos, g). La supervivencia se calculó en base al número de langostinos de agua dulce cosechados: supervivencia = [(número de langostinos cosechados)/(número de langostinos proporcionados)] x 100) por cada tanque (5). Después de la aclimatación, quince gambas fueron muestreadas y almacenadas a -75°C para un análisis posterior de la composición del músculo de la cola. Al final del estudio, se analizaron las gambas en cada tratamiento con respecto a la composición química del músculo de la cola siguiendo los métodos de la Asociación Oficial de Químicos Analistas (6). La proteína cruda (N x 6.25) fue determinada por el método de Kjeldahl después de una digestión ácida utilizando un Sistema de Kjeldahl (2100-Autoanalyzer, Tecator, Höganäs, Suecia), y el contenido de lípidos crudos fue determinado por extracción con éter. El contenido lipídico crudo se cuantificó mediante un analizador automático (Fibertec, Tecator). El extracto libre de nitrógeno (ELN) fue determinado mediante el cálculo de la diferencia. Análisis estadístico. Todos los datos se presentan como el promedio de tres repeticiones. Los datos fueron sometidos a un ANOVA de dos vías (7), y el nivel de significancia fue fijado en p<0.05. Se utilizó la prueba de rango múltiple de Tukey para clasificar los grupos cuando se alcanzó la significancia estadística. Se realizó un análisis estadístico utilizando el programa Statistica Versión 7.0 para Windows (Statistica Stat Soft, Inc. 2004, EE.UU.).

RESULTADOS El estudio se realizó en interiores bajo las siguientes condiciones: 28.0±1.0ºC, OD 6.5±0.8 mg/L, pH 7.5±0.4, N-NH4 0.24±0.2 mg/L y alcalinidad 170±5.1 mg/L. No se observaron diferencias significativas a lo largo de este estudio en los índices de calidad de agua entre los tratamientos experimentales. La composición proximal de las dietas experimentales se muestra en la tabla 1. La proteína dietaria total varió de 35.0 al 45.3%, los lípidos totales variaron de 7.9 a 13.2%, los carbohidratos variaron de 19,2 a 35.4 y la energía bruta varió de 19.4 a 19.9 MJ/kg.

3925

feeding trial, the food conversion ratio (FCR) was calculated as FCR=(W feed consumed)/(W wet weight gained); the protein efficiency ratio (PER) was calculated as PER=(weight gain, g)/ (protein intake, g); and the lipid efficiency ratio (LER) was calculated as LER = (weight gain, g)/(lipid intake, g). Survival was calculated on the basis of the number of freshwater prawn harvested: survival = [(number of prawn harvested)/(number stocked)] x 100) per tank (5). After acclimatization, fifteen prawns were sampled and stored at -75°C for subsequent analysis of the tail muscle composition. At the end of the study, the prawns in each treatment were analyzed regarding the chemical composition of the tail muscle following the methods of the Association of Official Analytical Chemists (6). Crude protein (N x 6.25) was determined by the Kjeldahl method after an acid digestion using an Auto Kjeldahl System (2100-Auto-analyzer, Tecator, Hoganas, Sweden), and crude lipid content was determined by ether extraction. Crude lipid content was quantified by an automatic analyzer (Fibertec, Tecator). Nitrogen-free extract (NFE) was determined by calculating the difference. Statistical analysis. All data are presented as the mean of three replicates. Data were subjected to a two-way ANOVA (7), and the significance level was set at p<0.05. Tukey’s multiple range test was used to rank groups when statistical significance was achieved. Statistical analysis was performed using the STATISTICA program Version 7.0 for Windows (STATISTICA Stat Soft, Inc. 2004, USA).

RESULTS The study was conducted indoors at 28.0±1.0ºC, DO 6.5±0.8 mg/L, pH 7.5±0.4, N-NH4 0.24±0.2 mg/L and alkalinity 170±5.1 mg/L. Over the duration of this study, no significant differences were observed in water quality indices between the experimental treatments. The proximate composition of the experimental diets is shown in table 1. The total dietary protein ranged from 35.0 to 45.3%, total lipids ranged from 7.9 to 13.2%, carbohydrates ranged from 19.2 to 35.4 % and gross energy ranged from 19.4 to 19.9 MJ/kg diet. During the investigation, the water stabilities of the experimental diets were between 4.0 and 5.0 h.

3926

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014 Growth performance. Growth performance and the associated nutritional indices are presented in table 2. Survival for the freshwater prawn varied between 83.2% and 100.0%, and significant dietary effects were observed (p<0.05). Survival was highest among prawns fed a diet with a P:L ratio of 45:13 and lowest for the diet with a P:L ratio of 40:8. Final body weight, WG, SGR and FCR are shown in table 2. Although growth occurred across all treatments, prawns fed diets with 8% lipids exhibited slower growth that those given 13% lipids. Both average daily weight gain and specific growth rate differed significantly among the experimental diets (p<0.05); diets with P:L ratios of 35:13, 40:13 and 45:13 showed the greatest growth, with average daily weight gain and specific growth ranging from 1.55 to 1.65 g/d and from 0.94 to 1.00%/d, respectively, over 77 days. FCR remained between 2.2 to 2.3, which is considered above average for cultured giant freshwater prawns, and did not differ among the dietary groups.

Durante la investigación, la estabilidad del agua de las dietas experimentales estuvo entre 4.0 y 5.0 h. Tasa de crecimiento. La tasa de crecimiento y los índices nutricionales asociados se presentan en la tabla 2. La supervivencia para el langostino de agua dulce varió entre el 83.2% y el 100.0% y se observaron importantes efectos dietarios (p<0.05). La supervivencia fue mayor entre los langostinos alimentados con una dieta de proporción P:L de 45:13 y menor para la dieta con una proporción P:L de 40:8. El peso corporal final, GP, TCE y FCA se muestran en la tabla 2. Aunque se presentó crecimiento en todos los tratamientos, los langostinos alimentados con dietas con un 8% de lípidos mostraron un crecimiento más lento que aquellos con una dieta con un 13% de lípidos. Tanto la ganancia diaria promedio de peso y la tasa de crecimiento específico difieren significativamente entre las dietas experimentales (p<0.05); las dietas con cocientes P:L de 35:13, 40:13 y 45:13 mostraron el mayor crecimiento, con la ganancia diaria promedio de peso y crecimiento específico oscilando entre 1.55 y 1.65 g/d y de 0.94 a 1.00%/d, respectivamente, durante 77 días. El FCA se mantuvo entre 2.2 a 2.3, lo que se considera por encima del promedio para langostinos de agua dulce gigantes cultivados y no difirieron entre los grupos dietarios.

Carcass composition. The carcass composition of freshwater prawn fed experimental diets is shown in table 3. The experimental diets produced no appreciable differences in the prawns’ moisture content. A nonsignificant tendency for an increased percentage of body protein with an increased dietary protein level was observed. The highest percentage was observed for the diet with a P:L ratio of 45:8 (20.3%), followed by the diets with a P:L ratio of 40:8 (20.1%) and 35:8 (19.0%). Carcass composition differed significantly between diets with higher protein levels and those with higher lipid levels (p<0.05).

Composición de la canal. La composición de la canal de los langostinos de agua dulce alimentados con dietas experimentales se muestra en la tabla 3. Las dietas experimentales no producen ninguna diferencia apreciable en el contenido de humedad de las gambas. Se observó una tendencia no significativa para un mayor porcentaje de proteína corporal con un nivel mayor de proteína dietaria. El porcentaje más alto se observó en la dieta con una proporción de P:L de 45:8 (20.3%), seguida por las dietas con una proporción de P:L de 40:8 (20.1%) y 35:8 (19.0%). La composición de la canal varió significativamente entre dietas con niveles más altos de proteína y aquellas con niveles más altos de lípidos (p<0.05).

Table 2. Growth performance of freshwater prawn Macrobrachium carcinus adult fed the different experimental diets for 11 weeks. Experimental diets Protein (%)

Initial length (mm)

173.5±2.9a

165.0±3.6a

169.7±1.9a

168.0±3.2a

160.3±4.2a

163.0±4.7a

Final length (mm)

182.3±3.4a

178.1±4.6a

180.5±2.3a

182.0±3.8a

171.4±4.7b

179.2±5.1a

Initial weight (g)

109.9±5.5a

110.1±7.2a

117.4±6.9a

110.4±4.9a

110.5±5.1a

113.5±4.5a

Final weight (g)

225.2±11.1b

236.9±17.2a

227.5±10.4b

236.1±15.9a

226.7±15.2b

233.2±15.9a

Survival (%)

88.8±2.3b

92.5±1.1ab

83.2±2.5b

92.5±2.1ab

88.8±1.5b

100.0±1.2a

WG (g/day)

1.45±b

1.65±0.1a

1.43±b

1.63±a

1.51±ab

1.55±a

0.93±0.13a

1.00±0.10a

0.86±0.15b

0.99±0.12a

0.92±0.05b

0.94±0.09a

Lipid (%)

SGR (%/day) AFCR

2.1±0.3a

2.3±0.2a

2.2±0.2a

2.3±0.3a

2.1±0.4a

2.2±0.2a

PER

0.89a

0.79a

0.74a

0.69a

0.70a

0.67a

LER

5.0

2.8b

4.6a

2.7b

4.8a

2.8b

WG, average daily weight gain; SGR, specific growth rate; AFCR, apparent feed conversion ratio; PER, protein efficiency ratio; LER lipid efficiency ratio. Values are mean of triplicate. Values within a row with the same superscript letters have no significant difference among groups (p<0.05).

3927

Benítez-Mandujano - Protein and lipid on growth of M. carcinus adults

Table 3. Proximate whole carcass composition of freshwater prawn Macrobrachium carcinus adult the experimental diets for 77 days. Protein (%)

Moisture (%)

73.8±0.1a

74.7±0.1a

73.6±0.1a

73.1±0.09a

73.5±0.4a

72.7±0.8a

Crude protein (%)

Lipid (%)

19.0±0.2a

19.5±0.5a

20.1±0.2a

19.8±0.16a

20.3±0.5a

19.9±0.4a

Total lipid (%)

4.3±0.2a

4.7±0.1a

3.6±0.1b

3.9±0.3b

3.7±0.1b

3.9±0.6b

Total ash (%)

2.9±0.1a

2.6±0.1a

2.9±0.1a

3.1±0.4a

3.0±0.2a

3.2±0.2a

Values with the same superscript in a row do not differ significantly (p<0.05). Initial body composition: moisture 75.2%; crude protein 18.4%; total lipid 1.26%; total carbohydrate 2.7%; total ash 2.44%.

DISCUSIÓN

DISCUSSION

Los parámetros de calidad de agua estaban dentro del rango aceptable para las especies de langostino (8). Las dietas se formularon con ingredientes altamente digestibles similares a los utilizados en dietas experimentales diseñadas para gambas y otros crustáceos decápodos (9). Los langostinos aceptaron y toleraron las dietas experimentales en gran medida, y una examinación general no reveló ningún síntoma patológico o anomalía de ningún tipo. Una supervivencia mayor al 80.0% es considerada como buena en los estudios sobre crustáceos (2).

The water quality parameters were within the acceptable range for prawn species (8). Diets were formulated using highly digestible ingredients similar to those used in experimental diets designed for prawns and other decapod crustaceans (9). The prawn accepted and tolerated the experimental diets quite, well and a gross examination revealed no pathological symptoms or abnormalities of any kind. Survival greater than 80.0% is considered good in crustacean studies (2).

Aunque las tasas de crecimiento reportadas para langostinos de agua dulce cultivados son altamente variables (10,11), la variación fue baja entre los grupos de tratamiento. Esta baja variación puede atribuirse al mantenimiento de la calidad nutricional en las dietas. Los langostinos de agua dulce alimentados con varias dietas isonitrogenadas que contienen harina de soja y harina de pescado como fuentes de proteína no mostraron un aumento significativo de peso diferente en comparación con los controles. Se encontraron tasas de crecimiento similares para M. rosenbergii alimentados con una dieta comercial de camarones o una dieta que contiene harina de pescado, harina de camarones, harina de soya, orujo de mostaza, ajonjolí y arroz salvado (12). En esta etapa postlarval los ejemplares de M. rosenbergii exhibieron una conservación de proteínas (9).

Although the reported growth rates of cultured freshwater prawns are highly variable (10,11), variation was low among our treatment groups. This low variation may be attributed to the maintenance of nutritional quality across diets. Freshwater prawns fed various isonitrogenous diets containing soybean meal and fish meal as protein sources did not exhibit significantly different weight gain compared to controls. Similar growth rates were found for M. rosenbergii fed either a commercial shrimp diet or a diet containing fish meal, shrimp meal, soybean meal, mustard oilcake, sesame meal and rice bran (12). At this stage postlarval M. rosenbergii exhibit protein sparing (9).

Benítez-Mandujano y Ponce-Palafox (2) reportaron valores similares de FCA (2.18-2.43). El FCA es una medida del consumo adecuado de alimentos por el langostino ya que la tasa de consumo de alimentos aumenta a medida que el langostino crece hasta una edad determinada. En M. rosenbergii, Hossain et al (12). informó un FCA de 10-18:1 para alimentos crudos, 2-3.5:1 para dietas compuestas, y 2.35 por una dieta que contenga un 37% de proteínas (12). Se registraron valores más altos para el FCA de 3.7 (5 langostinos/m2) a 5.6 (20 langostinos/ m2) para ejemplares de M. rosenbergii cultivados en tanques de concreto y alimentados con una dieta con un 34% de proteína (13). Sin embargo, se han realizado estudios de alimentación en M. carcinus sólo a nivel postlarval (14) y de especímenes

Similar FCR values (2.18-2.43) were reported by Benítez-Mandujano and Ponce-Palafox (2). FCR is a measure of the proper consumption of feed by prawn since the rate of food consumption increases as the prawn grows until a certain age (12). In M. rosenbergii, Hossain et al (12) reported an FCR of 10-18:1 FCR for raw feeds, 2-3.5:1 for compounded diets, and 2.35 for a diet containing 37% protein. Higher FCR values of 3.7 (5 prawns/ m 2 ) to 5.6 (20 prawns/m 2 ) were reported for M. rosenbergii cultured in concrete tanks and fed a diet containing 34% protein (13). However, feeding studies on M. carcinus have been conducted only at the level of postlarvae (14) and juveniles (2); adults and broodstock have not been studied in this regard.

3928

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

jóvenes (2); los adultos y reproductores no han sido estudiados en este sentido. Manush et al (13) alimentaron cangrejos de río australianos de agua dulce jóvenes con dietas que contienen niveles de proteína cruda del 15%, 20%, 25% y 30% y encontraron que los niveles de proteína cruda en la canal variaban con respecto al nivel de proteína en la dieta. También se ha demostrado una relación lineal entre la proteína dietaria y la proteína fresca (15). Observamos una relación similar en ejemplares adultos de M. carcinus: los niveles de proteína cruda en la canal fueron significativamente superiores en langostinos alimentados con dietas ricas en proteínas. Dietas con cocientes de P:L de 35:13, 40:13 y 45:13 que contienen harina de soja y pescado como fuentes importantes de proteínas tuvieron como resultado un mayor contenido lipídico significativo en la canal (p<0.05) que aquellos con 8% de lípidos. Del mismo modo, Sambhu y Jayaprakas (16) no observaron ninguna diferencia en la longitud total de Penaeus indicus alimentados con diferentes dietas. No se observó ninguna diferencia significativa en el porcentaje total de humedad corporal para distintos tratamientos experimentales. Se reportaron resultados similares para M. rosenbergii (17). Sin embargo, la proporción de proteína total, aminoácidos, lípidos, ácidos grasos, los carbohidratos y ARN fue mayor en las hembras de M. rosenbergii que en los machos (17). En contraste, el contenido de humedad y cenizas fue mayores en los machos en comparación con las hembras. A pesar de estas diferencias, se observó una tendencia con respecto a los efectos producidos por las dietas con mayores niveles de proteína y lípidos. En conclusión, los datos aquí presentados sugieren que las dietas experimentales formuladas fueron utilizadas eficientemente por los reproductores de M. carcinus para producir un crecimiento satisfactorio y una calidad fresca. Se observó un crecimiento significativamente mejor (p<0.05) en dietas con un 13% de lípidos en comparación con las dietas con un 8% de lípidos. No se observaron diferencias significativas en el porcentaje de proteínas en los músculos con un mayor nivel de proteína dietaria. Sin embargo, se encontró una tendencia relacionada con una mejor calidad nutricional de los langostinos en dietas que contienen un 40% y 45% de proteína.

Manush et al (13) fed juvenile Australian freshwater crayfish diets containing crude protein levels of 15%, 20%, 25% and 30% and found that carcass crude protein levels varied with respect to the dietary protein level. A linear relationship has also been demonstrated between dietary protein and fresh protein (15). We observed a similar relationship in M. carcinus adults: carcass crude protein levels were significantly higher in prawns fed high protein diets. Diets with P:L ratios of 35:13, 40:13 and 45:13 containing soybean and fish meal as major protein sources resulted in significantly (p<0.05) higher carcass lipid content than those with 8% lipids. Similarly, Sambhu and Jayaprakas (16) saw no difference in the total length of Penaeus indicus fed different diets. No significant difference in whole body moisture percentage was observed for different experimental treatments. Similar results were reported for M. rosenbergii ( 1 7 ) . H o w e v e r, t h e p r o p o r t i o n o f t o t a l protein, amino acids, lipids, fatty acids, carbohydrates and RNA were higher in female M. rosenbergii than in the males (17). In contrast, the moisture and ash content were higher in males compared to females. Despite these differences, a trend was noted regarding effects produced by diets with increasing protein and lipid levels. In conclusion, the data presented here suggest that the formulated experimental diets were efficiently utilized by M. carcinus broodstock to produce satisfactory growth and fresh quality. Significantly better growth (p<0.05) was observed in diets with 13% lipids compared with diets with 8% lipids. No significant differences were observed in the percentage of protein in muscle with an increasing dietary protein level. However, we found a tendency for improved nutritional quality of prawn in the diets containing 40 and 45% protein.

Benítez-Mandujano - Protein and lipid on growth of M. carcinus adults

3929

REFERENCES 1.

Benítez-Mandujano MA. Macrobrachium carcinus prawns, a research potential. Panorama Acuícola 2005; 10(5):25-27.

Benítez-Mandujano MA, Ponce-Palafox JT. Biología, ecología e investigación sobre el langostino de río Macrobrachium carcinus Linnaeus, 1958. Bloomington. USA: Palibros; 2012.

Gupta A, Sehgal HS, Sehgal GK. Growth and carcass composition of giant freshwater prawn, Macrobrachium rosenbergii (De Man), fed different isonitrogenous and isocaloric diets. Aquacult Res 2007; 38:1355-1363. García-Ulloa M, Rodríguez H, Ogura T. Calidad del huevecillo de dos especies de langostino (Palemonidae) del genero Macrobrachium (M. rosenbergii, De Man, 1879, y M. tenellum, Smith, 1871) variando la dieta. Avances Invest Agropec 2004; 8:1-8. Abbaspour L.D. Survival and growth of the freshwater prawn Macrobrachium rosenbergii in relation to different nutrients composition. J Fish Aquat Sc 2011; 6:649-654.

William H. Official Methods of Analysis of A.O.A.C. Arlington, Virginia EE.UU.: The Association of Official Analytical Chemist Inc: 2005.

Montgomery, Douglas. Control Estadístico de la Calidad 3a Ed. México DF: LimusaWiley; 2004.

D a n a h e r J J, T i d w e l l J H , C o y l e S D, Dasgupta S, Zimba PV. Effects of two densities of caged monosex nile tilapia, Oreochromis niloticus, on water quality, phytoplankton populations, and production when polycultured with Macrobrachium rosenbergii in temperate ponds. J World Aquacult Soc 2007; 38(3):67–382.

Goda AM. Effect of dietary protein and lipid levels and protein–energy ratio on growth indices, feed utilization and body composition of freshwater prawn, Macrobrachium rosenbergii (de Man 1879) post larvae. Aquacult Res 2008; 39:891-901.

10. Tidwell JH, Coyle SD, Dasgupta S. Effects of stocking different fractions of size graded juveniles prawns on production and population structure during a temperaturelimited grow out period. Aquaculture 2004; 231:123-134. 11. Tidwell JH, Coyle SD, Bright LA, Van Arnum A, Weibel C. The effects of size grading and length of nursery period on growth and population structure of freshwater prawns stocked in temperate zone ponds with added substrates. Aquaculture 2003; 21:209-218. 12. Hossain MA, Siddique MAL, Miaje MAH. Development of low-cost feed for culture of giant fresh water prawn Macrobrachium rosenbergii de Man in ponds. Bangladesh J Fish 2006; 4:127-134. 13. Manush SM, Pal K, Das T, Mukherjee SC. Dietary high protein and vitamin C mitigate stress due to chelate claw ablation in Macrobrachium rosenbergii males. Comp Biochem Physiol Part A Mol Integr Physiol 2006; 142(1):10–18. 14. Dos Santos EP, Leal ALG, Da Silva PMM, Correla EDS. Influence of different diets in freshwater prawn Macrobrachium carcinus (Linnaeus, 1758) larval survival. Acta Sci Biol Sci 2007; 29(2):121-124. 15. Ezquerra JM, Salazar JA, Bringas L, Rouzaud O. Effect of dietary protein on muscle collagen, collagenase and shear force of farmed white shrimp (Litopenaeus vannamei). Eur Food Res Technol 2003; 217(4):277-280. 16. Sambhu C, Jayaprakas V. Effect of synthetic feed additive Stafac-20 on the growth characteristics of juveniles of white prawn Penaeus indicus (Crustacea/Penaeidea). Indian J Mar Sci 2003; 32:76-80. 17. Saravana Bhavan P, Radhakrishnan S, Seenivasan C, Shanthi R, Poongodi R, Kannan S. Proximate composition and profiles of amino acids and fatty acids in the muscle of adult males and females of commercially viable prawn species Macrobrachium rosenbergii collected from natural culture environments. Int J Biol 2010; 2(2):107-119.

Rev.MVZ Córdoba 19(1):3930-3943, 2014. ISSN: 0122-0268 ORIGINAL

Trophic ecology of Saccodon dariensis (Pisces: Parodontidae) in Guatapé River tributaries, Magdalena River Basin, Colombia Ecología trófica de Saccodon dariensis (Pisces: Parodontidae) en afluentes del río Guatapé, Cuenca río Magdalena, Colombia Ana Restrepo-Gómez, Zoot, Néstor Mancera-Rodríguez,* Ph.D. Universidad Nacional de Colombia, Departamento de Ciencias Forestales. Posgrado en Bosques y Conservación Ambiental. Medellín, Colombia. Correspondencia: njmancer@gmail.com Received: April 2013; Accepted: September 2013.

ABSTRACT Objective. To study the trophic ecology of Saccodon dariensis in the Peñoles and El Cardal streams, Guatape River mid-basin, Magdalena River Basin, Colombia. Materials and methods. To compare differences in size between individuals from the two streams in terms of hydrologic periods, oral polymorphisms or sexes, an analysis of variance was conducted (ANOVA). Volume percentages, frequency of occurrence and the food importance index (FII) were determined; a principal component analysis (PCA) and an ANOVA was carried out to determine the diet differences between streams, climatic periods, oral polymorphism, sexes and developmental states, as well as a Mann-Whitney pairwise comparison test for each food category. Results. A significant difference was found in size between individuals of the two streams with different oral polymorphism. Algae are the most important food item (FII: 91.9%), followed by Trichoptera and insect remains (FII: 4.3%), and vegetal material (FII: 1.8%). The PCA did not indicate significant differences in diet between streams, climatic periods, oral polymorphisms, sexes or developmental states, but the ANOVA and Mann-Whitney pairwise comparison test indicated differences in oral morphotype, where individuals with a straight mouth consumed more vegetal material. We also observed different proportions in consumption of different algae genera, and increased consumption of insects in ontogeny, this being higher in individuals with a straight mouth. Conclusions. The species is algaevorous. The oral morphotypes of S. dariensis may be related to a trophic polymorphism that confers different trophic habits and differential access to the items that constitute their diet. Key words: Algae, conservation, fish feeding, polymorphism (Source: AIMS, CAB).

3930

Restrepo-Gómez - Trophic ecology of Saccodon dariensis in Colombia

3931

RESUMEN Objetivo. Estudiar la ecología trófica de Saccodon dariensis en las quebradas Peñoles y El Cardal, parte media del río Guatape, cuenca del rio Magdalena, Colombia. Materiales y métodos. Para contrastar diferencias entre individuos de las dos quebradas en cuanto a períodos hidrológicos, polimorfismos bucales y sexos se realizó un análisis de varianza (ANOVA). Se determinó los porcentajes de volumen, frecuencia de ocurrencia e índice de importancia alimentaria (IIA); se realizó un análisis de componentes principales (ACP) y un ANOVA para determinar diferencias de dieta entre quebradas, períodos climáticos, polimorfismos bucales, sexos, estados de desarrollo, y una prueba de comparación por pares de Mann-Whitney para cada categoría de alimento. Resultados. Se encontró diferencia significativa en la talla entre individuos de las dos quebradas con diferente morfotipo bucal. Las algas es el item de alimento más importante (IIA: 91.9%), seguido por Trichoptera y restos de insectos con (IIA: 4.3%) y material vegetal (IIA: 1.8%). El ACP no indicó diferencias en la alimentación entre quebradas, períodos climáticos, polimorfismo bucal, sexos o estados de desarrollo, pero la ANOVA y la prueba de Mann-Whitney indicaron diferencias por morfotipo bucal, donde individuos de boca recta consumen más material vegetal. Se observó en proporciones diferentes el consumo de diferentes géneros de algas, y aumento de consumo de insectos en ontogenia, siendo más alto para individuos de boca recta. Conclusiones. La especie es alguivora. Los morfotipos bucales en S. dariensis pueden estar relacionados con un polimorfismo trófico que le confiere diferentes hábitos tróficos y acceso diferencial a los ítems que constituyen su dieta. Palabras clave: Algas, alimentación de peces, conservación, polimorfismo (Fuente: AIMS, CAB).

INTRODUCCIÓN

INTRODUCTION

Colombia posee la diversidad más alta en especies de peces de montaña dentro de la región Andina, con aproximadamente 220 especies, de las cuales alrededor del 37% son endémicas (1). Sin embargo, esta diversidad es vulnerable a los cambios ambientales actuales generados por el hombre, como la alteración de ecosistemas por fragmentación y deforestación, la pérdida y contaminación de cuerpos de agua, la introducción de especies exóticas, la alteración en las dinámicas de regulación hídrica con el desarrollo de hidroeléctricas y alta presión sobre recursos hidrobiológicos (2), que actúan al disminuir las poblaciones naturales; colocando en riesgo de extinción a muchas especies de peces. A pesar de esta problemática, aún es poco el conocimiento de muchos aspectos de la ecología trófica de peces andinos, y conocerlos ayudaría a establecer recomendaciones para su protección, conservación y manejo.

Colombia has the highest diversity in mountain fish species within the Andean region, with approximately 220 species, of which around 37% are endemic (1). However, this diversity is vulnerable to current environmental changes generated by man, such as the alteration of ecosystems by fragmentation and deforestation, loss and pollution of water bodies, introduction of exotic species, alteration of water regulation dynamics with the development of hydroelectric plants and high pressure on hydrobiological resources (2), that diminish natural populations; placing many fish species in the brink of extinction. Despite this problem, still there is little knowledge of many aspects of the trophic ecology of Andean fish, and knowing them would help establishing recommendations for their protection, conservation and handling.

La familia Parodontidae está compuesta por los géneros Parodon Valenciennes 1849 y Saccodon Kner 1863 (3), los que tienen una distribución geográfica amplia en el centro y sur de América, desde el Canal de Panamá hasta la cuenca del rio de la Plata en Argentina, excepto en las cuencas del sur del Estado de Bahía en Brasil en la Costa Atlántica, la Patagonia, y el canal del río Amazonas (4). En su mayoría no exceden los 20 cm de longitud, no son importantes comercialmente (4-5), y consumen preferencialmente algas e insectos acuáticos (4,610), aunque Parodon cf. gestri, ha sido ubicado dentro del grupo de los detritívoros (11).

The family Parodontidae consists of the genera Parodon Valenciennes 1849 and Saccodon Kner 1863 (3), which have a wide geographical distribution in Central and South America, from the Panama Canal to the basin of Rio de la Plata in Argentina, except in the basins to the south of the State of Bahia in Brazil in the Atlantic Coast, Patagonia, and the channel of the Amazon River (4). They mostly do not exceed 20 cm in length, have no commercial importance (4-5), and preferentially consume algae and aquatic insects (4, 6-10), although Parodon cf. gestri has been placed within the detrivores group (11).

3932

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Saccodon dariensis (Meek & Hildebrand, 1913) se distribuye en Centro y Suramérica, en aguas continentales al oriente del canal de Panamá y en Colombia en las cuencas de los ríos Atrato y Magdalena (4,12), en particular en los departamentos de Cauca y Valle del Cauca (13-14), Tolima (15) y Antioquia (1,16-17). La especie se encuentra asociada a sitios de corrientes rápidas, bajas pendientes y sustratos rocosos cubiertos de perifiton. Diferencias morfológicas intraespecíficas han sido reportadas en varias especies de fauna, las cuales se han descrito como “polimorfismos tróficos”, estando relacionadas con las estructuras encargadas de la alimentación y que pueden conferir ventajas en el uso del hábitat y recursos particulares (18). Roberts (5) ha señalado cinco polimorfismos bucales y dentales en Saccodon dariensis en afluentes de los ríos Sinú, Magdalena, alto Cauca y Atrato, y menciona la relación de éstos y posibles diferencias en la explotación de recursos alimenticios. Para la cuenca del río Guatapé se ha descrito la co-existencia de dos de éstos polimorfismos bucales. La especie presenta dientes altamente especializados para raspar algas adheridas al sustrato rocoso en los ecosistemas acuáticos. Algunos morfotipos tienen dientes premaxilares en línea recta y otros poseen 6 u 8 dientes escalonados en forma de medialuna; consume insectos acuáticos de los órdenes Diptera, Trichoptera, Ephemeroptera y Plecoptera que se adhieren a la superficie de las rocas (10). El objetivo de este trabajo fue estudiar la ecología trófica del mazorco, Saccodon dariensis, en las quebradas Peñoles y El Cardal, parte media del río Guatapé, cuenca del río Magdalena, y determinar si existen diferencias significativas en la dieta entre sexos, estados de desarrollo, quebradas y períodos climáticos, y si el polimorfismo bucal (boca recta vs boca en media luna) está relacionado con un polimorfismo trófico. Esta información es importante para la formulación de programas de conservación y manejo de la especie, que está incluida en el Libro Rojo de Peces Dulceacuícolas de Colombia en la categoría de Preocupación Menor (10).

MATERIALES Y MÉTODOS Área de estudio. El trabajo se realizó en las quebradas Peñoles (6°16’27.2’’ N, 75º05’23.7’’ O; 1201 msnm) y El Cardal (6º16’46.6” N, 74º55’24.6” O; 898 msnm), afluentes del río Guatapé, cuenca del río Magdalena, en los municipios de San Rafael y San Carlos en la región del oriente de Antioquia, Colombia (Figura 1).

Saccodon dariensis (Meek Hildebrand, 1913) is distributed in Central and South America, in inland waters to the east of the Panama Canal and in Colombia in the basins of the rivers Atrato and Magdalena (4,12), in particular in the departments of Cauca and Valle del Cauca (13-14), Tolima (15) and Antioquia (1, 16-17). The species is associated with sites that have fast-flowing currents, low slopes and rocky substrates covered with periphyton. Intraspecific morphological differences have been reported in several wildlife species, w h i c h h ave b e e n d e s c r i b e d a s “ t r o p h i c polymorphism,” being related to the structures responsible for food and which can confer advantages in the use of the habitat and specific resources (18). Roberts (5) has noted five oral and dental polymorphisms for Saccodon dariensis in tributaries of the rivers Sinu, Magdalena, upper Cauca and Atrato, and mentions the relationship of these and the possible differences in the exploitation of food resources. In the Guatape River basin, the coexistence of two of these oral polymorphisms has been described. The species has highly specialized teeth to scrape algae attached to the bedrock in aquatic ecosystems. Some morphotypes have premaxillary teeth in a straight line and others have 6 or 8 crescentshaped teeth; consumes aquatic insects from the Diptera, Trichoptera, Ephemeroptera, and Plecoptera order that adhere to the surface of the rocks (10). The objective of this study was to study the trophic ecology of the mazorco, Saccodon dariensis, in the Peñoles and El Cardal streams, Guatape River mid-basin, Magdalena River basin, and to determine if there are significant differences in diet between sexes, developmental states, streams and climatic periods, and if oral polymorphism (straight mouth vs. crescent-shaped mouth) is related to a trophic polymorphism. This information is important for the formulation of programmes for the conservation and handling of the species, which is included in the Red Book of Freshwater Fishes of Colombia in the category of Minor Concern (10).

MATERIALS AND METHODS Study area. The study was carried out in the Peñoles (6°16’27.2” N, 75°05’23.7” W; 1201 masl) and El Cardal streams (6°16’46.6” N, 74°55’24.6” W; 898 masl), tributaries of the Guatape River, Magdalena River basin, in the municipalities of San Rafael and San Carlos in the region east of Antioquia, Colombia (Figure 1).

Restrepo-Gómez - Trophic ecology of Saccodon dariensis in Colombia

3933

Figure 1. Location of the Peñoles and El Cardal streams in the Guatape river mid-basin, East of Antioquia, Colombia.

La zona presenta ecosistemas característicos de zonobioma húmedo tropical del valle del río Magdalena, con una temperatura promedio de 23-28°C (19), y un patrón de distribución de la precipitación bimodal con picos de lluvias en mayo y octubre, y un promedio anual de 4368 mm (Estación climatológica embalse de playas). El territorio es montañoso, con topografía ondulada, y las quebradas se caracterizan por ser torrenciales, de aguas muy claras y sin planicie aluvial.

The area shows tropical moist biome ecosystems characteristic of the Magdalena River valley, with an average temperature of 23-28°C (19), and a bimodal precipitation distribution pattern with rainfall peaks in May and October, and an annual average of 4368 mm (Embalse de las Playas weather station). The territory is mountainous, with an undulating topography, and the streams are characterized by being torrential, with very clear water and no alluvial plains.

Caracterización del hábitat. Las siguientes variables fisicoquímicas fueron tomadas in situ: oxígeno disuelto (mg/l), saturación de oxígeno (%), temperatura superficial del agua (°C) con medidor HANNA (HI9828/4-01) y pH, conductividad (µS/cm) y sólidos totales disueltos (STD) con medidor HANNA (9811-5). Ancho y profundidad fueron medidos con flexómetro, y una vara graduada en centímetros y el tipo de sustrato se clasificó de acuerdo con la escala propuesta por Wentworth (20).

Habitat characterization. The following physicochemical variables were taken in situ: dissolved oxygen (mg/l), oxygen saturation (%), surface water temperature (°C) with HANNA meter (HI9828/4-01) and pH, conductivity (µS/cm) and total dissolved solids (TDS) with HANNA meter (9811-5). The width and depth were measured with a measuring tape, and a rod in centimeters and the type of substrate was classified according to the scale proposed by Wentworth (20).

Obtención de las muestras. Se realizaron seis muestreos de campo que incluyeron períodos de lluvia (octubre y noviembre de 2007, mayo de 2008), seco (enero y marzo de 2010) y transición

Obtaining of samples. Six field samplings were carried out which included periods of rain (October and November 2007, May 2008), draught (January to March 2010) and dry to rain transition (March 2008). Specimens were captured with 30

3934

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

de seca a lluvia (marzo de 2008). Se efectuaron capturas de individuos con 30 lances de atarraya de 1 cm ojo de malla por estación y por medio de equipo de electropesca SAMUS 725MP, el cual se usó con descargas en un tramo lineal de 100 m por estación, haciendo barridos en contra de la corriente, y de ribera a ribera, que incluyera todos los biotopos posibles. Una vez capturados, los peces se etiquetaron con fecha, lugar de captura y arte de pesca, se depositaron en bolsas plásticas y se fijaron en formol al 10%. La identificación de contenido estomacal se realizó en el laboratorio de Ecología y Conservación de Fauna Silvestre de la Universidad Nacional de Colombia, Sede Medellín. Ejemplares de S. dariensis se preservaron en alcohol al 70% y están depositados en los Laboratorios de Ictiología de la Universidad del Quindío, Armenia, Colombia (IUQ) y de Limnología y Recursos Hídricos de la Universidad Católica de Oriente, Ríonegro, Antioquia, Colombia (UCO). Análisis de contenido estomacal. Los ejemplares recolectados fueron lavados con agua para eliminar el exceso de formaldehido y luego pasados a alcohol al 70%. En total se examinaron 117 estómagos de individuos de S. dariensis, de los cuales 53 fueron capturados en la quebrada Peñoles y 64 en la quebrada El Cardal. De estos 70 eran hembras y 47 machos, y 53 presentaban boca recta y 65 boca en forma de media luna (Tabla 1). A los ejemplares se les midió la longitud estándar (LE) en mm con un calibrador digital (Mitutoyo Serie 500) hasta centésimas de milímetro y el peso total (g) y eviscerado (g), con una balanza analítica (Ohaus Scout-Pro SP202, New Jersey, USA) hasta dos décimas de precisión (0.01g) y se les practicó una disección uroventral para la extracción de la gónada para la identificación del sexo y del tracto digestivo al cual se le midió el largo y ancho del estómago, la longitud del intestino y el número de ciegos pilóricos. Para contrastar diferencias de tamaño entre quebradas, períodos hidrológicos, polimorfismos bucales y sexos se realizó un análisis de varianza

sets of cast nets with chain links of 1 cm by station and with SAMUS 725MP electrofishing equipment, which was used on a linear stretch of 100 m per station, sweeping against the current, and from bank to bank, which included all possible biotopes. Once captured, fish were tagged with date, place of catch and fishing gear, they were placed in plastic bags and left in formalin at 10%. The identification of stomach contents was carried out in the Wildlife Ecology and Conservation Laboratory of Universidad Nacional de Colombia, Medellin. The specimens of S. dariensis were preserved in alcohol at 70% and are stored in the Ichthyology Laboratory of Universidad del Quindio, Armenia, Colombia (IUQ) and in the Limnology and Water Resources Laboratory of Universidad Catolica de Oriente, Rionegro, Antioquia, Colombia (UCO). Analysis of stomach contents. The specimens collected were washed with water to remove the excess of formaldehyde and then were put in alcohol at 70%. In total 117 stomachs of individuals of S. dariensis were examined, of which 53 were captured in the Peñoles stream and 64 in the El Cardal stream. Of these 70 were females and 47 males, and 53 had a straight mouth and 65 a crescent-shaped mouth (Table 1). The standard length (SL) in mm of the specimens was measured with a digital gauge (Mitutoyo 500 Series) up to hundredths of a mm and the total (g) and eviscerated weight (g) with an analytical scale (Ohaus Scout Pro SP202, New Jersey, USA) up to two tenths of precision (0.01g) and underwent a ventral dissection for extracting gonads for gender identification and the digestive tract, with which the length and width of the stomach, the length of the intestine and the number of pyloric caeca was measured. An analysis of variance (ANOVA) was performed to contrast the differences in size between streams, hydrological periods, oral polymorphisms and sexes. A linear correlation was made between the standard length (SL) and the

Table 1. Number of individuals of Saccodon dariensis studied by sex, stream, climatic period and oral morphotype in the Guatape River mid-basin, East of Antioquia, Colombia. Mouth shape

Stream

Period Sex

Straight mouth

Crescent-shaped mouth

Total

Rain

Transition

Dry

Rain

Transition

Dry

Total El Cardal

Total

117

Peñoles Total Peñoles El Cardal

Restrepo-Gómez - Trophic ecology of Saccodon dariensis in Colombia (ANOVA). Se realizó una correlación lineal entre la longitud estándar (LE) vs la longitud del intestino, la longitud estándar (LE) vs la longitud del estómago, la longitud estándar (LE) vs el ancho del estómago, y una correlación potencial entre el peso total del pez vs su longitud estándar. Para el análisis de la dieta, se realizó una separación de las categorías de alimento fácilmente reconocibles con estereoscopio EZ4 (Leica Microsystems) y el resto de contenido estomacal y del intestino se diluyó en 2 ml de agua destilada, se tomaron gotas (submuestras de volumen conocido) y se observaron en microscopio (Leica Microsystems). Se realizó la separación e identificación de los elementos alimenticios de manera cualitativa y cuantitativa de acuerdo con los métodos volumétrico y de frecuencia de ocurrencia (21,22), y se calculó el índice de importancia alimentaria (IIA) según Kawakami y Vazzoler (23) IIA=Fi*VI/Σ(Fi*Vi), donde IIA= índice de importancia alimentaria, Fi= frecuencia de ocurrencia (%) de cada categoría y Vi=volumen (%) de cada categoría. La determinación taxonómica de los diferentes ítems se basó en claves taxonómicas (24-28).

3935

length of the intestine, the standard length (SL) and the length of the stomach, the standard length (SL) and the width of the stomach, and a potential correlation between the total weight of the fish vs. its standard length. For the analysis of the diet, a separation of easily recognizable food categories was made with a EZ4 stereoscope (Leica Microsystems) and the rest of the stomach and intestine contents were diluted in 2 ml of distilled water, drops (known volume subsamples) were taken and observed under a microscope (Leica Microsystems). The separation and identification of nutritional elements was carried out in a qualitative and quantitative basis according to the volumetric and frequency of occurrence methods (21,22), and the food importance index (FII) was calculated according to Kawakami and Vazzoler (23) FII=Fi*VI/Σ(Fi*Vi), where FII = food importance index, Fi= frequency of occurrence (5) of each category and Vi=volume (%) of each category. The taxonomic determination of the different items was based on taxonomic cues (24-28).

Análisis de la información. Se realizó un análisis de componentes principales para establecer diferencias significativas en la dieta entre quebradas (Peñoles y El Cardal), períodos climáticos (lluvia, transición y seco), polimorfismo bucal (boca recta o en media luna), y estado de desarrollo (juveniles y adultos), y se realizó una prueba de la comparación por pares de Mann-Whitney para determinar si existen diferencias en el consumo de cada categoría de alimento por tipo de boca y estado de desarrollo. Para los estados de desarrollo se separaron en dos categorías de tallas, se consideraron juveniles a los individuos con una longitud inferior a la talla media de madurez sexual correspondiente, a 88.8 mm de largo estándar para las hembras y 109.3 mm para los machos, según fue establecido por UrregoBallestas et al (17) y adultos a los individuos con una longitud igual o mayor a estos valores.

Analysis of information. A principal components analysis was performed to establish significant differences in diet between streams (Peñoles and El Cardal), climatic periods (rain, transition and drought), oral polymorphism (straight mouth or crescent-shaped mouth), and developmental state (youth and adults), and a Mann-Whitney pairwise comparison test was conducted to determine if there are differences in the consumption of each food category by mouth type and developmental state. For the developmental states the fish was separated into two size categories, those considered young corresponded to individuals with a length less than the mean size at sexual maturity of 88.8 mm standard length for females and 109.3 mm for males, as established by Urrego-Ballestas et al (17) and adults as those individuals with a length equal to or greater than these values.

RESULTADOS

RESULTS

Características del hábitat. La quebrada Peñoles se caracteriza por presentar sustrato pedregoso o de guijarros, con pendiente inclinada cercana a un ángulo de unos 25°, y aguas arriba del punto de muestreo se observó la presencia de rocas de gran tamaño. Durante la época seca sus aguas son cristalinas y en época de lluvias turbias y con corriente fuertes. En sus riberas se observó bosque nativo y algunos potreros para ganadería. Cincuenta metros antes de la desembocadura al río Guatapé se observa una vía de concreto con corazón de acero que cruza la quebrada para el

Habitat characteristics. The Peñoles stream is characterized by having a rocky or pebbly substrate, with an incline with an angle of approximately 25°, and the presence of large rocks was observed upstream the sampling site. During the dry season, its waters are crystal clear and in the rainy season they are turbid with a strong current. A native forest and some pasture for livestock were observed on its banks. Fifty meters before the mouth of the Guatape river there is a concrete-steel road that crosses the stream for vehicle access to a farm, becoming

3936

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

acceso de vehículos a una finca, constituyéndose en una barrera principalmente en época seca, cuando baja el caudal de la quebrada. Presentó una profundidad media entre 0.40-0.60 m, aunque con algunas pozas de mayor profundidad. El ancho promedio fue de 16.5 m con máximo de 17.9 m en época de lluvias y mínimo de 14.6 m en época seca. La temperatura superficial del agua presentó un promedio de 19.6°C, el oxígeno disuelto de 10.2 mg/l, el porcentaje de saturación de oxígeno de 119%, la conductividad de 17.3 µS/cm, los sólidos totales disueltos de 16.3 y el pH de 7.5. La quebrada El Cardal presenta sustrato de arenas-guijarros, con presencia de rocas de gran tamaño aguas arriba de los sitios de muestreo, en ambas riberas el uso local del suelo predominante es de pastos para ganadería en la zona cercana a la desembocadura en el río Guatapé y en el margen derecho de la quebrada hay un campamento habitacional de Empresas Públicas de Medellín que realiza vertimientos a la quebrada; y para las partes más altas predomina el bosque nativo en buen estado de conservación. Presentó una profundidad media entre 0.30 - 0.60 m, aunque con algunas pozas de mayor profundidad. El ancho promedio fue de 11.1 m con máximo de 12.3 m en época de lluvias y mínimo de 9.1 m en época seca. La temperatura superficial del agua presentó un promedio de 20.8°C, el oxígeno disuelto de 7.5 mg/l, el porcentaje de saturación de oxígeno de 76%, la conductividad de 62.7 µS/cm, los sólidos totales disueltos de 42.3 y el pH de 7.3 Características de los ejemplares y la dieta. Los individuos de S. dariensis analizados fueron peces con una longitud estándar media de 104.8mm (Desviación estándar 19.3) con tallas entre 72.3 mm y 156.2 mm. Por zonas de muestreo se observa una diferencia significativa en talla entre los ejemplares capturados en las dos quebradas (p=0.000), para Peñoles la talla media de longitud estándar (LE) de los individuos estudiados fue de 119.8 mm (Desviación estándar 14.1, Mín. 90.3, Máx. 156.2) y para El Cardal de 92 mm (Desviación estándar 12.8, Mín. 72.3, Máx. 138.9). Por morfotipo bucal también se observa diferencia significativa (p=0.000) en la longitud estándar entre los individuos con boca en media luna que son más grandes que los de boca recta en las dos quebradas, y por período climático se observó diferencia significativa (p=0.001) durante el período seco en la quebrada El Cardal en el cual la talla media de LE fue de 101 mm, mientras que para el período de transición fue de 87.6 mm y lluvias de 86.4 mm (Tabla 2 y 3).

a barrier mainly during the dry season, when the flow of the stream is low. It has an average depth between 0.40-0.60 m, albeit with some deeper pools. The average width was 16.5 m with a maximum of 17.9 m in the rainy season and a minimum of 14.6 m in the dry season. The surface temperature of the water was on average at 19.6°C, oxygen dissolved was 10.2 mg/l, the oxygen saturation percentage 119%, conductivity 17.3 µS/cm, total solids dissolved 16.3 and the pH 7.5. The El Cardal stream has a sandy-pebbly substrate, with large rocks upstream the sampling sites, on both banks the land is predominantly used locally for livestock pastures in the area close to the mouth in the Guatape River and on the right bank of the stream there is a residential camp of Empresas Publicas de Medellin which carries out discharges into the stream; and the highest parts are dominated by a native forest in good state of conservation. It has an average depth between 0.30 - 0.60 m, albeit with some deeper pools. The average width was 11.1 m with a maximum of 12.3 m in the rainy season and a minimum of 9.1 m in the dry season. The surface temperature of the water was on average at 20.8°C, dissolved oxygen was 7.5 mg/l, oxygen saturation percentage 76%, conductivity 62.7 µS/cm, total solids dissolved 42.3 and pH 7.3 Characteristics of specimens and diet. The individuals of S. dariensis analyzed were fish with a standard average length of 104.8 mm (standard deviation of 19.3) with sizes between 72.3 mm and 156.2 mm. In the sampling zones a significant difference in size between the specimens captured in the two streams (p=0.000) is observed, for the Peñoles stream the mean standard length size (SL) of individuals studied was 119.8 mm (standard deviation of14.1, Min 90.3, Max. 156.2) and 92 mm for El Cardal stream (standard deviation of 12.8, Min 72.3, Max. 138.9). A significant difference by oral morphotype is also observed (p=0.000) in the standard length between individuals with a crescent-shaped mouth which are larger that those with a straight mouth in the two streams, and a significant difference was observed in the climate period (p=0.001) during the dry season in the El Cardal stream in which the average SL size was 101 mm, while for the transition period it was 87.6 mm and in the rainy season of 86.4 mm (Table 2 and 3). The stomachs of S. dariensis show a saccular form, being longer (average of 18.0 mm;) standard deviation of 4.6) than wider (average of 8.0 mm; standard deviation of 2.4). The average intestine length was 86.5 mm (standard deviation of 24.8). From two to ten pyloric caeca were observed being 8 the most frequent number (average:

3937

Restrepo-Gómez - Trophic ecology of Saccodon dariensis in Colombia Table 2. Average standard length value (mm) for Saccodon dariensis by stream, climatic period and oral morphotype in the Guatape River mid-basin, East of Antioquia, Colombia. Mouth shape Stream

Period Rain

Peñoles

Total

108.0

130.4

119.2

Sources of variation

Sum of squares

(A) Stream

20070.200

20070.200 172.950 0.000

1705.830

852.915

7.350

0.001

Transition

121.3

119.9

120.3

Dry

114.1

125.9

120.3

112.1**

125.8**

119.8*

Rain

81.8

91.0

86.4

Transition

82.7

92.5

87.6

Dry

93.0

107.7

101.0***

85.8**

97.7**

92.0*

97.2**

111.3**

104.8

Subtotal Total

Crescentshaped mouth

(B) Climatic period

Subtotal

El Cardal

Straight mouth

Table 3. ANOVA to contrast size differences of Saccodon dariensis by stream, climatic period and oral morphotype in the Guatape River mid-basin, East of Antioquia, Colombia. Mean square

4819.380

41.530

0.000

(D) Sex

12.199

0.110

0.746

A x B interaction

1002.970

501.486

4.320

0.016

Remainder

12648.700

109 116.043

Total

40259.279

116

* Significant differences between streams; ** Significant differences between morphotypes; *** Significant differences between climatic periods.

Bold values denote statistical significance.

Los estómagos de S. dariensis presentan forma sacular, siendo más largos (media 18.0 mm; Desviación estándar 4.6) que anchos (media 8.0 mm; Desviación estándar 2.4). La longitud media del intestino fue de 86.5 mm (Desviación estándar 24.8). Se observaron de dos a diez ciegos pilóricos siendo 8 el número más frecuente (media: 6.18, Desviación estándar 1.7). Se encontró una positiva y media correlación entre longitud estándar (LE) vs. longitud del intestino vs. (Longitud del intestino=0.9325*(LE)–9.1881, r=0.76, n=112), longitud estándar (LE) vs. longitud del estómago (Longitud del estómago=0.1665*(LE)+0.6756, r=0.77, n=111), longitud estándar (LE) vs. ancho del estómago (Ancho del estómago=0.0862*(LE)–1.1573, r=0.75, n=112); mientras que el peso total vs la longitud estándar presentó una alta correlación (Peso del pez= 0.00004*(LE)3.334, r=0.98, n=117).

6.18, standard deviation of 1.7). A positive and average correlation was observed between the standard length (SL) vs. the intestine length vs. (intestine length=0.9325*(SL)-9.1881, r=0.76, n=112), standard length (SL) vs. stomach length (stomach length=0.1665*(SL) + 0.6756, r=0.77, n=111), standard length (SL) vs. stomach width (stomach width=0.0862*(SL) - 1.1573, r=0.75, n=112); while the weight total vs. standard length showed a high correlation (fish weight=0.00004*(LE)3.334, r=0.98, n=117).

Del total de 117 estómagos, sólo 2 (1.7%) se encontraron vacíos. El contenido estomacal de los 115 estómagos se agrupó en 14 items alimenticios. De estos, el más importante lo constituyeron las algas con (V: 86.4%; FO: 94.9%; IIA: 91.9%), seguido por Trichoptera (V: 3.4%; FO: 39.3%; IIA: 3.9%), material vegetal (V: 4.8%; FO: 15.4%; IIA: 1.8%), y restos de insectos (V: 2.5%; FO: 12.8%; IIA: 0.4%) (Tabla 4). Para las algas se registraron 74 géneros de cinco divisiones: 29 géneros de Chlorophyta, 25 de Bacillariophyta, 16 de Cianophyta, 2 de Bacteriophyta y 2 de Euglenophyta. En el análisis volumétrico las divisiones más importantes fueron Bacillariophyta (94.1%), Cianophyta (3.8%) y Chlorophyta (2.1%). Así, los géneros más importantes Fragilaria (V: 71.0%; FO:

Of the total of 117 stomachs, only 2 (1.7%) were found empty. The stomach contents of the 115 stomachs were grouped into 14 food items. Of these, the most important was algae (V: 86.4%; FO: 94.9%; FII: 91.9%), followed by Trichoptera (V: 3.4%; FO: 39.3%; FII: 3.9%), vegetal material (V: 4.8%; FO: 15.4%; FII: 1.8%) and insects remains (V: 2.5%; FO: 12.8%; FII: 0.4%) (Table 4). Seventy-four genera with five divisions were recorded for algae: 29 genera of Chlorophyta, 25 of Bacillariophyta, 16 of Cianophyta, 2 of Bacteriophyta and 2 of Euglenophyta. In the volumetric analysis the most important divisions were Bacillariophyta (94.1%), Cianophyta (3.8%) and Chlorophyta (2.1%). Thus, the most important genera were Fragilaria (V: 71.0%; FO: 95.4%), Stauroneis (V: 10.4%; FO: 67.0%), Gomphonema (V: 6.5%; FO: 88.1%), Cymbella (V: 1.9%; FO: 95.4%), Gloeotrichia (V: 1.4%; FO: 22.0%) and Pseudolyngbya (V: 1.3%; FO: 30.2%) (Table 5). The principal components analysis (PCA) does not show any differences in feed between streams, climatic periods, oral polymorphism, sex or developmental state. The most important

3938

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Table 4. Food categories found in the stomach contents of Saccodon dariensis in the Guatape River midbasin, Colombia. Volume % V (%)

Frequency % F (%)

Food importance index (%)

86.359

94.872

91.926

Vegetal material

4.774

15.385

1.786

Trichoptera

3.450

39.316

3.868

Insect remains

2.549

12.821

0.350

Ephemeroptera

0.005

2.564

0.000

Hemiptera

0.006

1.709

0.001

Diptera

0.107

13.675

0.023

Coleoptera

0.116

7.692

0.038

Lepidoptera

0.041

1.709

0.011

Odonata

0.006

0.855

0.001

Acari

0.012

6.838

0.003

Eggs

0.055

8.547

0.009

Scales

0.011

1.709

0.001

Digested material

2.508

32.479

1.983

Algae

95.4%), Stauroneis (V: 10.4%; FO: 67.0%), Gomphonema (V: 6.5%; FO: 88.1%), Cymbella (V: 1.9%; FO: 95.4%), Gloeotrichia (V: 1.4%; FO: 22.0%) y Pseudolyngbya (V: 1.3%; FO: 30.2%) (Tabla 5).

Table 5. Volume and occurrence of algae in the stomach contents of Saccodon dariensis in the Guatape River mid-basin, Colombia. %V

%FO

Nostoc Oscillatoria

0.037 0.640

2.752 59.633

1.835

Plectonema

0.000

0.917

1.835

Pleurocapsa

0.097

8.257

0.003

2.752

Rivularia

0.165

13.761

Asterionella

0.000

0.917

Stigonema

0.131

15.596

Ceratoneis

0.070

14.679

Euglenophyta

Cyclotella

0.071

15.596

Facus

0.006

1.835

Cocconeis

0.334

59.633

Euglena

0.000

0.917

Cymatopleura

0.008

0.917

Chlorophyta

Cymbella

1.893

95.413

Ankistrodesmus

0.012

8.257

Diatoma

0.019

12.844

Bostrychia

0.001

1.835

Fragilaria

71.007 98.165

Pseudolyngbya

1.269

30.275

Gomphonema

6.518

88.073

Leptolyngbya

0.011

2.752

Hantzschia

0.026

6.422

Spirotaenia

0.003

1.835

Melosira

1.789

76.197

Bulbochaete

0.027

2.752

Navicula

0.850

77.981

Schizomeris

0.002

0.917

Rhoicosphenia

0.152

14.679

Crenothrix

0.007

2.752

Stauroneis

10.375 66.972

Chaetophora

0.031

10.092

Surirella

0.564

73.394

Chlorhormidium

0.025

2.752

Synedra

0.002

0.917

Cladophora

0.067

19.266

Tabellaria

0.095

25.688

Coleochaete

0.001

1.835

Eutonia

0.005

2.752

Crucigenia

0.004

1.835

Pinnularia

0.027

3.670

Geminella

0.016

0.917

Gyrosigma

0.002

0.917

Gloeocystis

0.007

2.752

Microspora

0.000

0.917 46.789 0.917

Bacillariophyta Achnanthes sp. 0.001

2.752

El análisis de componentes principales (ACP) no indica diferencias en la alimentación entre quebradas, períodos climáticos, polimorfismo bucal sexos o estado de desarrollo. El ítem alimenticio más importante para las dos quebradas lo constituyeron las algas con un IIA de 92.19% y 91.70%, seguido de insectos y restos de insectos con IIA de 5.57% y 3.20%, para las quebradas Peñoles y El Cardal respectivamente. Por períodos climáticos, existe un aumento en el consumo de material vegetal en el período seco (2.26%) y en transición (3.30%) con relación al período de lluvias (0.16%), y en el consumo de insectos en especial del Orden Trichoptera mayor en los períodos de lluvia y seco (Tabla 6).

Nitzschia

0.243

55.046

Aulacoseira

0.007

Heterothrix

0.003

Amphora

El índice de importancia alimentaria (IIA) muestra para los individuos con la boca en media luna que el mayor ítem alimenticio en su dieta son las algas (96.1%) y un consumo bajo de Insectos y restos de insectos (0.49%), y material vegetal (0.11%). Por su parte, los individuos con boca recta presentan una reducción en el consumo de algas, aunque sigue siendo el mayor ítem alimenticio en su dieta con un 87.10%, pero es mayor el consumo de Insectos y restos de insectos con un 8.74% y material vegetal con 3.75%. El análisis de varianza (ANOVA) para identificar las diferencias entre las dietas indicó diferencias significativas (p=0.038) únicamente por morfotipo bucal para el

Bacteriophyta Chlorotylium

0.006

2.752

Oedogonium

0.256

Sphaerotilus

0.001

0.917

Pleurococcus

0.000

Scenedesmus

0.001

0.917

Anabaena

0.185

5.505

Sphaeroplea

0.004

1.835

Aphanizomenon

0.004

1.835

Ulothrix

0.176

14.679

Calothrix

0.202

22.936

Penium

0.001

2.752

Chamaesiphon

0.003

0.917 1.835

Closterium

0.030

14.679

Cosmarium

0.015

Gonatozygon

0.000

6.422 0.917

Cianophyta

Pseudoanabaena 0.019 Chroococcus

0.001

1.835

Gloeotrichia

1.407

22.018

Pleurotaenium

0.004

Microcystis

0.001

0.917

Tetmemorus

0.003

0.917

Lyngbya Merismopedia

0.930 0.000

48.624 0.917

Mougeotia Spirogyra

0.116 0.006

23.853 3.670

0.917

Restrepo-Gómez - Trophic ecology of Saccodon dariensis in Colombia Table 6. Food Importance Index (%) for the food items of Saccodon dariensis by stream and climatic period in the Guatape River mid-basin, Colombia. Stream

Climatic period

Peñoles

El cardal

Lluvia

Seco

Transición

92.19

91.70

92.64

89.65

93.89

Vegetal material

1.01

0.25

0.16

2.26

3.30

Insects and insect remains

5.57

3.20

5.15

5.37

1.78

Digested material

1.23

2.63

2.03

2.68

1.02

Algae

Table 7. Food Importance Index (FII) for juveniles and adults of Saccodon dariensis for each oral morphotype. Straight mouth Juveniles Adultos

Crescent-shaped mouth Adultos

Total

Algae

91.02

73.51

87.06

95.53

96.52

96.09

Insects and insect remains

4.82*

22.15*

8.74

0.08*

0.81*

0.49

3.73

3.83

3.75**

0.00

0.18

0.11**

Vegetal material

Total

Juveniles

Mann-Whitney pairwise comparison test. *Significant differences between juveniles and adults in each morphotype **Significant differences between oral morphotypes.

consumo de material vegetal, el cual es mayor en individuos de boca recta y la comparación puntual entre ítems alimenticios con la prueba de comparación por pares de Mann-Whitney indica diferencias significativas por morfotipo bucal en el consumo de material vegetal siendo mayor en los individuos con boca recta (p=0.034) (Tabla 7). Dentro de los dos morfotipos se encontró un aumento significativo en el consumo de insectos al pasar de juveniles a adultos (boca recta: p=0.034, boca en media luna: p=0.000), siendo éste más alto para individuos de boca recta donde pasan de 4.82% a representar un 22.15% del IIA (Tabla 7). Se observó variación en el volumen consumido de los diferentes géneros de algas entre los individuos con diferente tipo de boca. Para ejemplares con boca recta los géneros más importantes son Fragilaria (%V: 80.6) y Stauroneis (%V: 11.8); mientras que para los de boca en media luna hay importancia en el consumo de una mayor variedad de géneros, siendo Gomphonema el más importante con (%V: 33.6), seguido de Fragilaria (%V: 16.1), Cymbella (%V: 8.9), Melosira (%V: 8.5), Lingbya (%V: 5.9), entre otros (Tabla 8).

3939

food item in the two streams was algae with an FII of 92.19% and 91.70%, followed by insects and insect remains with an FII of 5.57% and 3.20% for the Peñoles and El Cardal streams, respectively. By climatic periods, there is an increase in the consumption of vegetation material in the dry period (2.26%) and in the transition period (3.30%) in relation to the rainy period (0.16%), and in the consumption of insects, especially of the order Trichoptera, which is greater in rainy and dry periods (Table 6). The food importance index (FII) shows for individuals with a crescent-shaped mouth that the main food item in their diet is algae (96.1%) and a low consumption of insects and insect remains (0.49%), and vegetation material (0.11%). Moreover, individuals with a straight mouth showed a reduction in the consumption of algae, although it remains the main food item in their diet with 87.10%, but the consumption of insects and insect remains is higher at 8.74% and vegetation material with 3.75%. The analysis of variance (ANOVA) to identify differences between diets showed significant differences (p=0.038) only by oral morphotype for the consumption of vegetation material, which is higher in individuals with a straight mouth and the specific comparison between food items with the MannWhitney pairwise comparison test indicates significant differences by oral morphotype for the consumption of vegetation material being higher in individuals with a straight mouth (p=0.034) (Table 7). A significant increase in the consumption of insects was found within the two morphs when passing from youth to adults (straight mouth: p=0.034, crescent-shaped mouth: p=0.000), being this the highest for individuals with a straight mouth as they went from 4.82% to 22.15% of the FII (Table 7). A variation was observed in the volume consumed of the different genera of algae between individuals with a different type of mouth. For specimens with a straight mouth, the most important genera are Fragilaria (V%: 80.6) and Stauroneis (V%: 11.8); while for those with a crescent-shaped mouth there is an importance in the consumption of a greater variety of genres, being Gomphonema the most important with (V%: 33.6), followed by Fragilaria (V%: 16.1), Cymbella (V%: 8.9), Melosira (V% 8.5), Lingbya (V% 5.9), among others (Table 8).

3940

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Table 8. Volume percentage (V%) of algae in the stomach contents of Saccodon dariensis for each oral morphotype, in the Guatape River mid-basin, Colombia. Straight mouth

Crescent-shaped mouth

Fragilaria

Genus

80.59

16.05

Stauroneis

11.80

2.22

Gomphonema

1.80

33.61

Gloeotrichia

1.40

1.46

Pseudolynbbya

1.29

1.13

Cymbella

0.66

8.95

Melosira

0.63

8.47

Navicula

0.38

3.55

Oscillatoria

0.36

2.22

Cocconeis

0.14

1.44

Surirella

0.12

3.10

Lyngbya

0.07

5.87

Calothrix

0.07

0.98

Anabaena

0.01

1.20

DISCUSIÓN

DISCUSSION

Saccodon dariensis presentó mayor talla media en la quebrada Peñoles (119.8mm LE) con relación a los individuos capturados en la quebrada El Cardal (92mm LE), lo que puede estar relacionado con el hecho de que la quebrada Peñoles presenta un mayor ancho y profundidad. Esto coincide con lo descrito por Restrepo-Escobar (29), para especímenes de sabaleta Brycon henni de las cuencas medias de los ríos Nare y Guatapé (Colombia), donde se encontró diferencia significativa en tamaño, siendo los individuos de mayor tamaño capturados en los ríos y quebradas de mayor caudal medio y profundidad de la columna de agua. El alto porcentaje de individuos que están por debajo de la talla media de madurez sexual (17) en la quebrada El Cardal, permite inferir que es un área de importancia para el crecimiento y desarrollo. La comparación de medias de la longitud estándar entre los tipos de boca mostró que los individuos con boca en media luna presentaron un tamaño promedio mayor que los de boca recta en las dos quebradas, lo cual ha sido descrito para la especie por Restrepo-Escobar (29), quien sugiere respuestas diferenciales de los morfotipos a los factores que influyen en la talla que podrían estar determinados genéticamente o reflejar plasticidad fenotípica.

Saccodon dariensis showed a higher mean size in the Peñoles stream (SL 119.8mm) in relation to individuals captured in the El Cardal stream (SL 92mm), which may be related to the fact that the Peñoles stream is wider and deeper. This is consistent with what has been described by Restrepo-Escobar (29), for specimens of Brycon henni in the middle basins of the Nare and Guatape rivers (Colombia), where a significant differences in size was found, with the largest individuals being caught in rivers and streams with a higher average flow and water column depth. The high percentage of individuals below the mean size at sexual maturity (17) in the El Cardal stream, allows us to infer that it is an important area for growth and development. The comparison of the average standard length between mouth types showed that individuals with a crescent-shaped mouth had a larger average size than those with a straight mouth in the two streams, which has been described for the species by Restrepo-Escobar (29), suggesting responses for morphotypes different to the factors influencing the size that could be determined genetically or reflect a phenotypic plasticity.

Saccodon dariensis se alimenta casi exclusivamente de algas, principalmente de la división Bacillariophyta o diatomeas que representan las densidades más altas (%V=94.1) y es el ítem más frecuente e importante en todos los contenidos estudiados tanto en estadios juveniles como adultos. Las diatomeas pertenecientes a la familia naviculaceae están adaptadas a corrientes que presenten altos caudales o sistemas con alta incidencia de arrastre de sedimentos o influenciados por importantes escorrentías, además están

Saccodon dariensis feeds almost exclusively on algae, mainly Bacillariophyta or diatoms that represent the highest densities (V%=94.1) and is the most frequent and important item in all contents studied both in juvenile stages as in adults. Diatoms belonging to the family naviculaceae have adapted to streams with high flow rates or systems with a high incidence of sediment entrainment or that have been influenced by significant runoffs, which also usually consist of certain substances with a

Restrepo-Gómez - Trophic ecology of Saccodon dariensis in Colombia generalmente constituidos por ciertas sustancias de alto valor energético por lo cual constituyen una importante oferta para macroinvertebrados o peces que se alimentan de algas perifíticas (25). De otra parte, se encontró un aumento significativo en el consumo de insectos al pasar de juveniles a adultos, principalmente en individuos de boca recta donde pasan de 4.8% a representar más de un 22% del IIA, se destaca el consumo de insectos Trichoptera y dentro de este, de Helycopsichidae, que poseen mandíbulas raspadoras para obtener el perifiton y las partículas finas que recubren la superficie de las rocas. La baja proporción de categorías de insectos en la dieta y su menor frecuencia de ocurrencia permiten inferir que la ingestión de material animal es, probablemente muy ocasional. Al respecto, Zamudio et al (9) y Mojica-Corzo et al (10) destacan para S dariensis el consumo de insectos acuáticos de los órdenes Diptera, Trichoptera, Ephemeroptera y Plecoptera que se adhieren a la superficie de las rocas, los cuales capturan con ayuda de sus dientes superiores. Igualmente, otros autores (4,7-10), han encontrado que las especies de Parodontidae consumen preferencialmente algas e insectos acuáticos. Parodon caliensis en ocasiones consume accidentalmente perifiton y material inorgánico, pero muestra mayor preferencia por insectos acuáticos (Ephemeroptera, Trichoptera, Plecoptera y Diptera) y terrestres (Hymenoptera familia Formicidae y Coleoptera), Parodon buckleyi en el piedemonte de la Orinoquia Colombiana se alimenta principalmente de algas y P. suborbitalis en el alto Cauca se alimentan de algas y materia orgánica que raspan de las rocas e insectos acuáticos que permanecen entre la grava (13). En conclusión Saccodon dariensis es una especie principalmente alguívora con ocasional consumo de insectos y material vegetal y en la comparación de dieta por zonas y período climático no se hallaron diferencias. Los morfotipos bucales en S. dariensis pueden estar relacionadas con un polimorfismo trófico dadas las diferencias significativas con un mayor consumo de material vegetal en los individuos de boca recta (p=0.034), al igual que proporciones diferentes en el consumo de diferentes géneros de algas entre los dos morfotipos (para los individuos de boca recta los géneros más importantes fueron Fragilaria y Stauroneis, mientras que para los de boca en media luna hay una mayor importancia en el consumo de más variedad de géneros, siendo Gomphonema el más importante), y el aumento de consumo de insectos al pasar de juveniles a adultos, siendo éste más alto para individuos de boca recta. Es posible, que estas diferencias en la dieta se justifiquen por el tipo de boca y la forma de los dientes descritas por Roberts (5) para los dos morfotipos,

3941

high energetic value, therefore constituting an important offer for macroinvertebrates and fish that feed on periphytic algae (25). On the other hand, a significant increase in the consumption of insects was found when going from youth to adults, mainly individuals with a straight mouth where they pass from 4.8% to representing more than 22% of the FII, the consumption of Trichoptera insects stands out and within this, Helycopsichidae, which possess scraping jaws to obtain periphyton and fine particles that cover the surface of rocks. The low proportion of insect categories in the diet and their lower frequency of occurrence allow inferring that the ingestion of animal material is probably very seldom. In this regard, Zamudio et al (9) and Mojica-Corzo et al (10) indicate the consumption for S dariensis of aquatic insects of the orders Diptera, Trichoptera, Ephemeroptera, and Plecoptera that adhere to the surface of the rocks, which are caught with the help of their upper teeth. Likewise, other authors (4,7-10) have found that the species of Parodontidae preferentially consume algae and aquatic insects. Parodon caliensis accidentally consumes periphyton and inorganic material, but shows a greater preference for aquatic insects (Ephemeroptera, Trichoptera, Plecoptera and Diptera) and terrestrial insects (Hymenoptera family Formicidae and Coleoptera), Parodon buckleyi in the foothills of the Colombian Orinoquia feeds mainly on algae and P. suborbitalis in the upper Cauca feed on algae and organic matter scraped from rocks and aquatic insects that lie in the gravel (13). In conclusion Saccodon dariensis is a mainly algaevorous species with occasional consumption of insects and vegetation material and no differences were found in the comparison of diet by areas and climate period. The oral morphotypes of S. dariensis may be related to a trophic polymorphism given the significant differences with the increased consumption of vegetation material in individuals with a straight mouth (p=0.034), as well as different proportions in the consumption of different genera of algae between the two morphotypes (for individuals with an straight mouth the most important genera were Fragilaria and Stauroneis, while for those with a crescent-shaped mouth there is a greater importance in the consumption of a greater variety of genres, with Gomphonema being the most important), and the increase in the consumption of insects when going from youth to adults, being this higher for individuals with a straight mouth. It is possible that these differences in diet are justified by the type of mouth and the shape of the teeth described by Roberts (5) for

3942

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

que les confiere diferencias para el acceso a los recursos de alimento, al permitir a los peces de boca recta con dientes con cúspides acceder al recurso ramoneando las algas filamentosas que mordisquean por encima del sustrato, al ingerir en este proceso de forma ocasional insectos y otro material vegetal, mientras que los de boca en media luna lo hacen como raspadores, al obtener algas muy cerca del sustrato haciendo uso de sus dientes lisos en forma de cuchara. Estas formas de obtener algas bentónicas actuando como ramoneadores o como raspadores también han sido descritas para Parodon tortuosus (7). Finalmente, los cambios en estos componentes de la dieta pueden estar asociados con las diferencias en el tamaño de ejemplares entre morfotipos, teniendo diferentes influencias a nivel nutricional, pero esto debe ser explorado por estudios de dieta a partir de isótopos estables (30). Agradecimientos A la Corporación Autónoma Regional de los Ríos Negro y Nare (CORNARE), a ISAGEN S.A. E.S.P. y a la Universidad Nacional de Colombia, quienes financiaron el proyecto 20101009235: “Estudio de la biología, ecología y diversidad genética de las poblaciones naturales de sabaleta Brycon henni en las cuencas de los ríos Nare y Guatapé, departamento de Antioquia”, dentro del cual fue colectado el material biológico analizado en este estudio. A la Dirección de Investigación Medellín -DIME y a la Vicedecanatura de Investigación de la Facultad de Ciencias Agrarias de la Universidad Nacional de Colombia. Al Profesor Alvaro Lema por el apoyo en el análisis estadístico y a los revisores anónimos por sus acertados comentarios.

the two morphotypes, which provides differences for access to food resources, as the fish with a straight mouth with cusped teeth are able to access the resource by foraging filamentous algae nibbled above the substrate, occasionally ingesting in this process insects and other vegetal material, while fish with a crescent-shaped mouth make it by scrapping, as they obtain algae close to the substrate using their spoon-shaped smooth teeth. These forms for obtaining benthic algae acting as foragers or scrapers have also been described for Parodon tortuosus (7). Finally, changes in these diet components may be associated with differences in the size of specimens between morphotypes, having different nutritional influences, but this must be explored through diet studies from stable isotopes (30). Acknowledgements The Autonomous Regional Corporation of the Negro and Nare rivers (CORNARE), ISAGEN S.A. E.S.P. and Universidad Nacional de Colombia, which funded the project 20101009235: “Study of the biology, ecology and genetic diversity of natural populations of Brycon henni in the basins of the Nare and Guatape rivers, department of Antioquia,” where the biological material analyzed in this study was collected. To the Medellin Research Department – DIME and the Dean’s Office for Research of the Faculty of Agricultural Sciences of Universidad Nacional de Colombia. Professor Alvaro Lema for his support with statistical analysis and the anonymous reviewers for their commentaries.

REFERENCES 1.

Jaramillo-Villa U, Maldonado-Ocampo JA, Escobar F. Altitudinal variation in fish assemblage diversity in streams of the central Andes of Colombia. J Fish Biol 2010; 76:2401–2417.

Roberts T. Dental polymorphism and systematics in Saccodon, a neotropical genus of freshwater fishes (Parodontidae, Characoidei). J Zool Lond 1974; 173:303-321.

Anderson E, Maldonado-Ocampo JA. A Regional Perspective on the Diversity and Conservation of Tropical Andean Fishes. Conserv Biol 2011; 25(1):30-39.

Melo CE, Machado FA, Pinto-Silva V. Feeding habits of fish from a stream in the savanna of Central Brazil, Araguaia Basin. Neotrop Ichthyol 2004; 2(1):37-44.

Londoño-Burbano A, Román-Valencia C. Redescripción de Parodon caliensis y Saccodon dariensis (Characiformes: Parodontidae). Rev Biol Trop 2010; 58(3):813-826.

Pelegrin N, Haro JG. Ecología alimentaria de Parodon tortuosus (Pisces, Characiformes) en el Río de La Suela, Córdoba (Argentina). Ecol Austral 2004; 14(1):45-51.

Reis RE, Kullander SO, Ferraris CJ (eds.) Checklist of the Freshwater Fishes of South and Central America. Porto Alegre Brasil: EDIPUCRS; 2003.

Rodríguez-Olarte D, Coronel JA, Taphorn D. Línea base para la estimación de la integridad en comunidades de peces en la cuenca del río Tocuyo, vertiente del Caribe, Venezuela. Mem Fund La Salle de Cienc Nat 2007; 165:63-81.

Restrepo-Gómez - Trophic ecology of Saccodon dariensis in Colombia 9.

Zamudio J, Urbano-Bonilla A, MaldonadoOcampo JA, Bogotá-Gregory JD, Cortés-Millán GA. Hábitos alimentarios de diez especies de peces del piedemonte del departamento del Casanare, Colombia. Dahlia Rev Asoc Colomb Ictiol 2008; 10:43-56.

10. Mojica-Corzo JI, Usma-Oviedo JS, Álvarez-León R & Lasso-Alcalá CA (eds.). Libro rojo de peces dulceacuícolas de Colombia. Bogotá D.C.: Instituto de Investigación de Recursos Biológicos Alexander von Humboldt; 2012. 11. Pouilly M, Barrera S, Rosales C. Changes of taxonomic and trophic structure of fish assemblages along an environmental gradient in the upper Beni Watershed (Bolivia). J Fish Biol 2006; 68:137-156. 12. Maldonado-Ocampo JA, Vari RP, Usma JS. Checklist of the Freshwater Fishes of Colombia. Biota Col 2008; 9(2):143-237. 13. Ortega-Lara A, Aguiño A, Sánchez GC. Los peces del Alto Cauca: Caracterización de la ictiofauna nativa de los principales ríos de la cuenca alta del río Cauca en el departamento del Cauca. Popayán, Colombia: Fundación para la investigación y el Desarrollo Sostenible, FUNINDES y Corporación Autónoma Regional del Cauca CRC; 2002. 14. Amaya JD, Naranjo LG. Plan Nacional de las Especies Migratorias: Diagnóstico e identificación de acciones para la conservación y el manejo sostenible de las especies migratorias de la biodiversidad en Colombia. Bogotá, Colombia: MAVDT – WWF; 2009. 15. Villa-Navarro F, Briñez-Vásquez AN, Castro-Roa D, García-Melo LJ, García-Melo JE, HerradaYara ME. Biodiversidad faunística y florística de las cuencas de los ríos Prado y Amoyá – Biodiversidad Regional Vol. II. Ibagué, Colombia: Cortolima y Universidad del Tolima; 2005. 16. Jaramillo-Villa U, Maldonado-Ocampo JA, Bogotá-Gregory JD. Peces del Oriente de Antioquia, Colombia. Biota Col 2008; 9(2):279-293. 17. Urrego-Ballestas DA, Castellanos-Barliza JJ, Mancera-Rodríguez NJ. Biología reproductiva de Saccodon dariensis (Pisces: Parodontidae) en la cuenca media del río Guatapé, Antioquia – Colombia. En: III Congreso Colombiano de Zoología; Medellín, Colombia, 18. Olsson J, Eklöv P. Habitat structure, feeding mode and morphological reversibility: factors influencing phenotypic plasticity in perch. Evol Ecol Res 2005; 7:1109–1123.

3943

19. Rodríguez N, Armenteras D, Morales M, Romero M. Ecosistemas de los Andes colombianos. Bogotá, D.C.: Instituto de investigación de recursos Biológicos Alexander von Humboldt; 2004. 20. Wentworth C. A scale of grade and class terms for clastic sediments. J. Geology 1922; 30:377-392. 21. Ricker WE. Methods for assessment of fish production in fresh waters. 2ª ed..- 2nd ed. Oxford: I.B.P. Handbook No 3. Blackwell Sci Publ; 1971. 22. Hyslop EJ. Stomach contents analysis a review of methods and their applications. J Fish Biol 1980; 17:411- 429. 23. Kawakami E & Vazzoler G. Método gráfico e estimativa de alimentar aplicado no estudo de alimentação de peixis. Bol Inst Oceanogr 1980; 29(2):205-207. 24. Bicudo CE, Menezes M. Géneros de algas de aguas continentales do Brasil. Sao Carlos, Brasil: Editorial Rima; 2006. 25. Ramírez JJ. Fitoplancton de agua dulce: aspectos ecológicos, taxonómicos y sanitarios. Medellín Colombia: Editorial Universidad de Antioquia; 2000. 26. Krammer K, Lange-Bertalot H. Bacillariophyceae. Tomos 1,2,3,4. Berlin, Alemania: Verlag; 1949. 27. Streble H, Krauter D. Atlas de los microorganismos de Agua dulce. Barcelona, España: Editorial Omega S.A.; 1987. 28. Roldán-Pérez G. Guía para el estudio de los macro invertebrados acuáticos del departamento de Antioquia. Bogotá, Colombia: Fondo FEN Colombia, Colciencias y Universidad de Antioquia; 1996. 29. Restrepo-Escobar N. Brycon henni y Saccodon dariensis (Pisces: Characiformes): Análisis de la variación del cuerpo mediante el uso de la Morfometría geométrica. [Tesis de M.Sc.]. Medellín, Colombia: Universidad Nacional de Colombia, Facultad de Ciencias, Escuela de Biociencias; 2013. 30. Adams CE, Fraser D, McCarthy I, Shields S, Waldron S, Alexander G. Stable isotope analysis reveals ecological segregation in a bimodal size polymorphism in Arctic charr from LochTay, Scotland. J Fish Biol 2003; 62:474-481.

Rev.MVZ Córdoba 19(1):3944-3953, 2014. ISSN: 0122-0268 ORIGINAL

Influence of glyceryl guaiacolate ether on anesthetics in tilapia compared to benzocaine and eugenol Influencia del eter gliceril guayacolato sobre la anestesia en tilapias comparado con benzocaina y eugenol Geovana R. Cosenza,1 MV, Gustavo S. Claudiano,1,2 M.Sc, Paulo F. Marcusso,1,2 M.Sc, Silas F. Eto,1,2 M.Sc, Wilson G. Manrique,1 Ph.D, Bruna A. Loureiro,3 M.Sc, Marina T. Shimada,1 M.Sc, Rogerio Salvador,1,2 Ph.D, Julieta RE. Moraes,1 Ph.D, Flavio R. Moraes,1,2* Ph.D. Universidade Estadual Paulista, Departamento de Patologia Veterinaria, Via Prof. Paulo Donato Castellane km 05, CEP 14.884-900, Jaboticabal, Sao Paulo, Brazil. 2Universidade Estadual do Norte do Parana, Laboratorio de Imunopatologia de Peixes, Rodovia BR-369 Km 54,Vila Maria, CP 261,CEP 86360-000, Bandeirantes, Parana, Brazil. 3Universidade Estadual Paulista, Departamento de Zootecnia, Via Prof. Paulo Donato Castellane km 05, CEP 14.884-900, Jaboticabal, Sao Paulo, Brazil. *Correspondence: fruasmoraes@gmail.com 1

Received: March 2013; Accepted: September 2013.

ABSTRACT Objective. The study aimed to investigate the effectiveness of glyceryl guaiacolate ether (GGE) and compare the times of induction, recovery, hematological changes, total protein and glycaemia among anesthetics in Nile tilapia, Oreochromis niloticus. Materials and methods. A total of 60 tilapia distributed in 3 aquariums (N=20) were used, which formed the group benzocaine (100 mg/L), eugenol (50 mg/L) and guaiacol glyceryl ether (9.000 mg/L). After the induction of anesthesia fish blood samples were collected to determine the complete hemogram and glycemia. Then the animals were placed in aquariums with running water for assessing the anesthesia recovery. Results. It was verified that GGE showed longer induction and recovery times as well a significant increase (p<0.05) of glycemia, when compared with the other groups (p<0.05). The concentration of total protein did not differ between groups (p>0.05). An increase in the number of monocytes in the group treated with benzocaine (p <0.05) was observed in the analysis of the hematological parameters with no difference between groups for other variables. Conclusions. Eugenol and benzocaine allow rapid induction and recovery in Nile tilapia, without evidence of stress during handling and GGE showed high induction and recovery times, being inadequate for anesthetic use in Nile tilapia. Key words: Anesthesia, hemogram, teleosts, Oreochromis niloticus (Source: CAB).

RESUMEN Objetivo. El trabajo tuvo como objetivo investigar la eficacia del eter gliceril guayacolato (EGG) y comparar los tiempos de inducción, recuperación, alteraciones hematológicas, de proteínas totales y glicemia entre los anestésicos en tilapias del Nilo, Oreochromis niloticus. Materiales y métodos. Fueron utilizadas 60 tilapias distribuidas en 3 acuarios (n=20), que formaron los grupos benzocaína (100 mg/L), eugenol (50 mg/L) y éter gliceril guayacolato (9.000 mg/L). Después de la inducción

3944

Cosenza - Influence of glyceryl guaiacolate ether on anesthetics in tilapia

3945

anestésica se procedió a colectar la sangre para determinar el hemograma y glicemia. A seguir, los animales fueron colocados en acuarios con agua corriente para la evaluación de la recuperación anestésica. Resultados. Se verificó que el EGG presentó mayor tiempo de inducción y recuperación, así como aumento significativo (p<0.05) de la glicemia, cuando fue comparado con los otros grupos (p<0.05). La concentración de las proteínas totales no fueron diferentes entre los grupos (p>0.05). En el análisis de los parámetros hematológicos fue observado aumento del número de monocitos en el grupo tratado con benzocaína (p<0.05) sin diferencia ente los grupos para las otras variables. Conclusiones. El eugenol y la benzocaína permiten rápidas inducciones y recuperación en tilapias del Nilo, sin evidencias de estrés durante la manipulación y el EGG presenta tiempos elevados de inducción y recuperación, no siendo este adecuado para el uso en tilapias del Nilo. Palabras clave: Anestesia, hemograma, teleósteos, Oreochromis niloticus (Fuente: CAB).

INTRODUCCIÓN

INTRODUCTION

La expansión e intensificación de la piscicultura genera problemas de manejo y sanidad, pues el aumento de la densidad produce pérdida de la calidad del agua, condiciones adversas de manejo y otras que resultan en estrés con depresión de los mecanismos de defensa (1).

The expansion and intensification of fish farming creates handling and health problems, because an increase in density leads to a loss in water quality, adverse handling conditions and others that result in stress with a decrease in defense mechanisms (1).

Dentro de este contexto, la utilización de los anestésicos en peces es ampliamente empleada para disminuir los efectos adversos del manejo como forma de garantizar la integridad de los animales, así como reducir la mortalidad y facilitar su manipulación (2). Entre los anestésicos más utilizados en peces se encuentra la tricaína metanosulfonato (MS222), benzocaína, quinaldina, 2-fenoxietanol, aceite de clavo y sus derivados (eugenol, metileugenol e isoeugenol) (2).

Within this context, the use of anesthetics in fish is widely used to reduce the adverse effects in handling as a way to ensure the integrity of animals, as well as reduce mortality and facilitate manipulation (2). The anesthetics mostly used in fish include the tricaine methanesulfonate (MS222), benzocaine, quinaldine, 2-phenoxyethanol, clove oil and its derivatives (methyleugenol, eugenol and isoeugenol) (2).

En Brasil no existen leyes que regulen el uso de anestésicos en peces, adaptando así, recomendaciones de la Food and Drugs Administration (FDA). De esta forma, se buscan alternativas de anestésicos más seguros y eficaces para uso en la piscicultura. El efecto de diferentes anestésicos sobre los parámetros fisiológicos de los peces es variado con relación a los diferentes anestésicos y especies utilizadas. La benzocaína actúa bloqueando los canales de sodio y reduce los potenciales de acción de la membrana celular (3). Dependiendo del grado pretendido de depresión del pez, está indicada la adición de solución de benzocaína con etanol o acetona en el agua en dosis de 25 a 100 mg/L. Por esta razón, peces sometidos a anestesia con benzocaína y destinados para alimentación, deben ser sometidos a cuarentena (4). El “aceite de clavo” es un compuesto fenólico resultante de la destilación de las hojas y flores de los árboles de clavo de la India (Syzgium aromaticum), siendo el eugenol su sustancia

In Brazil there are no laws that regulate the use of anesthetics in fish, so the recommendations of the Food and Drugs Administration (FDA) have been adapted. In this way, alternatives are being sought for having safer and more effective anesthetics for use in fish farming. The effect of different anesthesia on the physiological parameters of fish is varied in relation to the different anesthetics and species used. Benzocaine acts by blocking sodium channels and reduces the action potential of cell membranes (3). Depending on the intended degree of depression in the fish, the addition of a solution of benzocaine with ethanol or acetone in water at a dose of 25 to 100 mg/L is indicated. For this reason, fish under anesthesia with benzocaine and intended for feeding must be subjected to quarantine (4). Clove oil is a phenolic compound resulting from the distillation of leaves and flowers of the clove trees in India (Syzgium aromaticum), with eugenol being its active ingredient, ranging from 70% to 95% (5). It is listed as a safe,

3946

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

activa, variando entre 70 y 95 % (5). Este es catalogado como anestésico seguro, eficaz, de bajo costo y con amplio margen de seguridad para peces, además de ser atóxico para el operador en las dosis mencionadas. Otra ventaja de este compuesto es que su metabolización y excreción son rápidas, permitiendo el consumo sin esperar un período de cuarentena (6). La Food and Agriculture Organization (FAO) prescribe como aceptable la ingestión diaria de 2.5 mg eugenol/kg en seres humanos. En peces anestesiados con 450 mg/L de aceite de clavo demostró que después de 48 horas antes del abate, hubo retención de apenas 0.32 mg de eugenol/kg, valor que está dentro de los niveles aceptables para la FAO (7). El éter gliceril guayacol (EGG) o guaifenesina es un polvo blanco, de sabor amargo, poco soluble en agua. Es relajante muscular de acción central que bloquea reflejos polisinápticos y deprime la transmisión de impulsos nerviosos en las neuronas intercelares de la médula espinal, utilizado ampliamente en equinos (8). Aunque este compuesto esté asociado al relajamiento muscular con sedación y efecto analgésico mínimo, sus efectos en peces todavía no fueron evaluados. El objetivo del presente estudio fue evaluar el tiempo de inducción y recuperación así como determinar la glicemia, concentración de proteínas totales y las variables hematológicas en tilápias del Nilo, Oreochromis niloticus, sometidas a los efectos anestésicos de benzocaína, eugenol y éter gliceril guayacol con el propósito de evaluar este último para uso en la manipulación de peces en procedimientos de rutina.

MATERIALES Y MÉTODOS Sitio de estudio. El experimento fue realizado en la Universidade Estadual do Norte do Paraná, Campus Luiz Meneghel, en Bandeirantes, Paraná – Brasil, (23°6′18″S, 50°21′37″W). Animales y acondicionamiento. Fueron utilizadas 60 tilápias del Nilo, Oreochromis niloticus con peso medio de 95.0±1.5 g distribuidos en 3 acuarios con capacidad de 350 L (n=20), abastecidos con agua de pozo artesanal, con flujo de agua 1 L/min y aireación artificial. La calidad del agua fue monitoreada diariamente y los peces alimentados dos veces al día (9:00 y 17:00 h) con concentrado comercial para peces 20% de proteína bruta, con ofrecimiento de 3% de la biomasa. Protocolo experimental. Los peces fueron divididos en tres grupos (n=20) en un delineamiento enteramente al azar. Todos los peces fueron sometidos a anestesia por el método de inmersión,

effective, affordable anesthetic with a wide safety margin for fish, as well as being non-toxic for the operator in the doses mentioned. Another advantage of this compound is that metabolism and excretion are faster, allowing consumption without waiting for a quarantine period (6). The Food and Agriculture Organization (FAO) indicates as acceptable a daily intake of 2.5 mg eugenol/ kg in humans. In fish anesthetized with 450 mg/L of clove oil, it was demonstrated that after 48 hours prior to abate there was a retention of just 0.32 mg of eugenol/kg, a value that is within the acceptable levels for the FAO (7). Guaiacol glyceryl ether (GGE) or guaifenesin is a white powder, with a bitter taste, little soluble in water. It is a muscle relaxant of central action that blocks polysynaptic reflexes and depresses the transmission of nerve impulses in spinal cord neurons, widely used in horses (8). Although this compound is associated with muscle relaxation through sedation and a minimal analgesic effect, its effects on fish are yet to be evaluated. The objective of this study was to assess the time of induction and recovery as well as determine glycemia, total protein concentration and hematological variables in Nile tilapias, Oreochromis niloticus, subjected to the anesthetic effects of benzocaine, eugenol, and guaiacol glyceryl ether in order to assess the latter for use in fish manipulation in routine procedures.

MATERIALS AND METHODS Study site. The experiment was conducted in Universidade Estadual do Norte do Parana, Campus Luiz Meneghel, in Bandeirantes, Parana – Brazil, (23°6′18″S, 50°21′37″W). Animals and conditioning. Sixty Nile tilapias, Oreochromis niloticus, were used with an average weight of 95.0±1.5 g distributed in 3 aquariums with a capacity of 350 L (n=20), supplied with water from a well, a water flow of 1 L/min and artificial aeration. Water quality was monitored daily and fish fed twice a day (9:00 and 17:00 h) with commercial fish concentrated with 20% of crude protein, with a biomass offer of 3%. Experimental protocol. Fish were divided into three groups (n=20) in an entirely random outline. All the fish were subjected to anesthesia through the immersion method, each prepared with different concentrations. Benzocaine (BEN) was diluted in ethanol (0.1 g/ml) and in water for

Cosenza - Influence of glyceryl guaiacolate ether on anesthetics in tilapia cada uno preparada en concentraciones diferentes. La benzocaína (BEN) fue diluida en alcohol etílico (0.1 g/ml) y esta en agua para concentración final de 100 mg/L (9). El eugenol (EUG) y gliceril éter guayacolato (EGG) se diluyeron directamente en el agua a una concentración de 50 mg/L (10) y 9.000 mg/L (dosis establecida en las pruebas anteriores), respectivamente. Para el ensayo, cada pez fue capturado con nasa al azar y colocado en recipientes plásticos con volumen útil de 50 L, donde los peces fueron mantenidos hasta el estado IV (Tabla 1). Table 1. Stages of anesthesia according to Ross y Ross (11). State 0 I

Description

Behavioral response in fish

Normal

Reaction to external stimuli, normal opercular movements, normal muscular reaction.

Reaction to external stimuli, slow swimming Mild sedation movements, small opercular movements, normal balance.

Deep sedation

Total loss to external stimuli, even to strong pressure, reduced opercular movements.

III

Narcosis

Partial loss of muscle tone, erratic swimming, increased opercular movements, reaction to tactile stimuli and vibration.

Deep anesthesia

Total loss of muscle tone, balance, slow but constant opercular movements.

Surgical anesthesia

Total absence of reaction, slow and irregular opercular movements, decreased heart rate, and complete loss of all reflexes.

Spinal collapse

Decreased heart rate and total loss of reflexes.

Parámetros hematológicos. Después de la inducción se realizó la colecta de aproximadamente 2 mL de sangre de cada pez, por medio de la venopunción caudal. A partir de esas muestras fueron determinados la glicemia (Accu-Check® Active-Roche), porcentual de hematocrito (12), concentración de proteínas plasmáticas totales por el método biureto (545 nm de longitud de onda), la tasa de hemoglobina y el recuento de eritrocitos en cámara de Neubauer (13). Una vez fueron determinados estos datos, fueron calculados los índices hematimétricos comprendidos por el volumen corpuscular medio (VCM), hemoglobina corpuscular media (HCM) y concentración de la hemoglobina corpuscular media (CHCM). Para el recuento de leucocitos totales se utilizó la cámara de Neubauer siguiendo los procedimientos descritos por Martins et al (14) y tinciones según Tavares-Dias & Moraes (15). Tiempos de exposición a los anestésicos. Para evaluar la recuperación anestésica los peces fueron colocados en acuarios con 90 L de agua corriente, con flujo de 1 L/min. Durante este periodo fueron observadas las variables descritas por Grush et al (16) donde: i) reaparecimiento de movimientos operculares, ii) retorno parcial del equilibrio y de la capacidad de nado, iii) recuperación total del equilibrio, iv) nado y reacción para estímulos externos todavía vacilantes y v) recuperación total

3947

a final concentration of 100 mg/L (9). Eugenol (EUG) and guaiacolate glyceryl ether (GGE) were diluted directly in water at a concentration of 50 mg/L (10) and 9.000 mg/L (dose established in previous tests), respectively. For the assay, each fish was captured with a creel at random and placed in plastic containers with a volume of 50 L, where fish were maintained until state IV (Table 1). Hematological parameters. Approximately 2 mL of blood were collected from each fish after the induction, by means of the caudal venipuncture. These samples served to determine the glycemia (Accu-Check® ActiveRoche), hematocrit percentage (12), total plasma protein concentration by the biuret method (545 nm wavelength), hemoglobin rate and erythrocytes count in a Neubauer chamber (13). Once these data were determined, the hematimetric indexes, composed of the mean corpuscular volume (MCV), mean corpuscular hemoglobin (MCH) and mean corpuscular hemoglobin concentration (MCHC), were calculated. Total leukocytes were counted through the Neubauer chamber following the procedures described by Martins et al (14) and stains according to Tavares-Dias & Moraes (15). Exposure times to anesthetics. To evaluate the anesthetic recovery, the fish were placed in aquariums with 90 L of tap water, with a flow of 1 L/min. During this period were observed the variables described by Grush et al (16) where: i) reemergence of opercular movements, ii) partial return of balance and swimming ability, iii) total recovery of balance, iv) swimming ability and reaction to external stimuli still unsteady, and v) total balance recovery and normal swimming ability. The times required for induction and anesthetic recovery were evaluated with a digital stopwatch. During the exposure period the animals were evaluated by direct observation for signs of intoxication, taking into account the alterations of behavior and mortality. Statistics. The results were subjected to analysis of variance and comparison of means by the Tukey test with five percent significance (p<0.05) (17).

RESULTS The quality of water remained within the comfort values of the fish (DO=5.1 mg/L: T0=26.47°C; pH=7.66 and electrical conductivity=117.96 μS/cm) (18). The three substances used as anesthetics in Nile tilapia were able to annul the reactions to handling and material collection, including fish out of the

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

del equilibrio y capacidad normal de nado. Los tiempos requeridos para inducción y recuperación anestésica fueron evaluados en cronómetro digital. Durante el período de exposición los animales fueron evaluados por observación directa en busca de señales de intoxicación, teniendo en cuenta las alteraciones de comportamiento y mortalidad. Estadística. Los resultados fueron sometidos a análisis de varianza y la comparación de medias por la prueba de Tukey cinco por ciento de significación (p<0.05)(17).

RESULTADOS La calidad del agua permaneció dentro los valores de confort de los peces (OD=5.1 mg/L: T0= 26.47ºC; pH=7.66 y conductividad eléctrica=117.96 μS/cm) (18). Las tres sustancias utilizadas como anestésicos en tilápias del Nilo fueron capaces de abolir las reacciones a la manipulación y a la colecta de material, inclusive con los peces fuera del agua. Sin embargo, hubo diferencias en la inducción y recuperación y en la glicemia determinada después de la inducción anestésica. Con relación a la inducción los animales del grupo EGG presentaron un tiempo mayor (p<0.05) a los observados en los grupos BEN e EUG (Figura 1). Los tiempos medios de inducción para cada anestésico fueron en media 1.6±0.33 minutos para el grupo EUG; 2.58±0.51 minutos para el grupo BEN y 10.88±2.09 minutos para el grupo EGG; demostrando que las dosis preseleccionadas de cada compuesto fueron eficientes para la inducción anestésica y la manipulación, incluyendo la venopunción, sin reacción en los animales. Lo mismo puede ser observado con relación a los tiempos de recuperación en el grupo EGG con tiempo medio de 37.54±30.49 minutos para la recuperación de los peces, fue mayor (p<0.05) a los grupos BEN y EUG, con tiempos de 3.88±0.89 y 2.38±1.25 minutos, respectivamente (Figura 2). En el grupo anestesiado con EGG la tasa de glicemia fue superior (p<0.05), (Figura 3) a los grupos BEN y EUG. En el análisis de los parámetros hematológicos (Tabla 2), las sustancias ensayadas no difieren (p>0.05) en relación a la concentración de las proteínas plasmáticas totales. Entre tanto, se observó que el EGG disminuyó significativamente (p<0.05) los valores de los monocitos circulantes con relación a los otros anestésicos (Tabla 2).

water. However, there were differences in the induction and recovery and glycemia determined after anesthetic induction. With respect to induction, animals in the GGE group showed times (p<0.05) higher than those observed in the groups BEN and EUG (Figure 1). The mean induction times for each anesthetic were on average 1.6±0.33 minutes for group EUG; 2.58±0.51 minutes for group BEN and 10.88±2.09 minutes for group GGE; demonstrating that the preselected dose of each compound was efficient for anesthetic induction and manipulation, including venipuncture, with no reaction in the animals. The same can be observed with regard to recovery times in the GGE group with an average time of 37.54±30.49 minutes for the recovery

Tiempo (minuto) Time (minutes)

3948

BEN (100 mg/L)

EUG (50 mg/L)E

GG (9000 mg/L)

Figure 1. Anesthetic effect at the time of anesthetic induction in Nile tilapia exposed to benzocaine (BEN), eugenol (EUG) and guaiacol glyceryl ether (GGE). Results are expressed as mean ± standard error (N=20) *significant difference with Tukey test (p<0.05).

of fish, which was higher (p<0.05) than the BEN and EUG groups, with times of 3.88±0.89 and 2.38±1.25 minutes, respectively (Figure 2). In the group anesthetized with GGE the glycemia rate was higher (p<0.05) (Figure 3) than the BEN and EUG groups. In the analysis of hematological parameters (Table 2), the substances tested did not differ (p>0.05) in relation to the total plasma protein concentration. Meanwhile, it was observed that the GGE significantly decreased (p<0.05) the values of circulating monocytes in relation to other anesthetics (Table 2).

3949

Cosenza - Influence of glyceryl guaiacolate ether on anesthetics in tilapia

30 20 10 0

100

0 BEN (100 mg/L)

EUG (50 mg/L)E

GG (9000 mg/L)

Figure 2. Effect of anesthetics in the recovery time of Nile tilapia exposed to benzocaine (BEN), eugenol (EUG) and guaiacol glyceryl ether (GGE). Results are expressed as mean±standard error (N=20) *significant difference with Tukey test (p<0.05).

150 Glucose (mg/dl) (mg/dl) Glucosa

Time (minuto) (minutes) Tiempo

BEN (100 mg/L)

EUG (50 mg/L)E

GG (9000 mg/L)

Figure 3. Effect of treatment with benzocaine (BEN), eugenol (EUG) and guaiacol glyceryl ether (GGE) in blood glucose levels in Nile tilapia. Results are expressed as mean ± standard error (N=20) *significant difference with Tukey test (p<0.05).

Table 2. Average values (standard error) and analysis of variance of hematological variables of Oreochromis niloticus under BEN, EUG and GGE anesthetics. Variables

Anesthetics BEN 27.2 ±2.1a

EUG 32.2 ±2.4a

GGE 30.2 ±2.6a

Ert (x106/mm3)

1.7 ±0.2a

1.6 ±0.3a

1.8 ±0.2a

Hb (g/dL)

5.8 ±0.4a

6.2 ±0.7a

5.3 ±0.2a

VCM (fL)

170.3 ±26.2a

182.1 ±30.2a

201.3 ±17.8a

HCM (pcg)

36.8 ±6.2a

48.2 ±4.6a

31.5 ±3.8a

CHCM (%)

21.4 ±0.6a

24.2 ±1.2a

19.8 ±1.9a

PPT (g/dl)

4.02 ±0.2a

4.1 ±0.8a

4.7 ±0.5a

Total leukocytes (×103/μL)

28.3 ±4.5a

20 ±4.1a

18.1 ±1.4a

Lymphocytes (×103/μL)

11.4 ±2.7a

VG (%)

20.3 ±3.5a

13.5 ±1.6a

Neutrophils (×103/μL)

3.3 ±0.9a

3.6 ±0.5a

4.5 ±1.3a

Monocytes (×103/μL)

1.8 ±0.2a

0.6 ±0.2b

0.5 ±0.1b

Eosinophils (×103/μL) Basophils (×103/μL)

2.5 ±0.4a

1.5 ±0.2a

1.8 ±0.3a

0.2 ±0.01a

0.07 ±0.05a

0.07 ±0.03a

Average (n=20) followed by at least one common letter do not differ in Tukey test (p>0.05). VG: Corpuscular volume; Ert: erythrocytes, Hb: hemoglobin, MCV: mean corpuscular volume, HCM: mean corpuscular hemoglobin; MCHC: mean corpuscular hemoglobin concentration; PPT: total plasma protein; (BEN) Benzocaine; (EUG) Eugenol and (GGE) guaiacol glyceryl ether. 1

DISCUSIÓN

DISCUSSION

Los tiempos observados para la inducción y recuperación en el grupo BEN fueron inferiores a los encontrados por Delbon y Paiva (19), quienes utilizaron la misma dosis y verificaron tiempos de 1.5 y 4.7 minutos, respectivamente. Esta diferencia puede ser atribuida a la diferencia de la concentración de oxígeno disuelto (OD) en este ensayo en comparación a la medias de 2.3 mg/L OD observada por los referidos autores. Además, el peso diferente de los peces utilizados en el presente trabajo ya que eran adultos (100±12 g) en comparación de los utilizados por Delbon y Paiva (19) que eran alevinos, existiendo correlación de peso con la disminución del tiempo de inducción y recuperación, también verificada en carpas, Cyprinus carpio (20).

The times observed for induction and recovery in the BEN group were lower than those found by Delbon and Paiva (19), who used the same dose and reported times of 1.5 and 4.7 minutes, respectively. This difference can be attributed to the difference in the concentration of dissolved oxygen (DO) in this test compared to the averages of 2.3 mg/L DO observed by said authors. In addition, the weight of the fish used in this study was different since they were adults (100±12 g) compared to those used by Delbon e Paiva (19) which were fingerlings, there being a correlation of weight with the reduction of the induction and recovery time, also verified in carps, Cyprinus carpio (20).

3950

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

El tiempo de inducción encontrado para los animales expuestos al eugenol fueron inferiores a los observados en la literatura para juveniles de tilápias del Nilo (19), diferencia que puede ser atribuida a la tasa metabólica, al peso y a la edad (21). El tiempo superior de inducción también fue observado en juveniles de pampo (Trachinotus marginatus), anestesiados con 50 mg/L de eugenol (22), probablemente debido a la diferencia fisiológica y metabólica entre las especies utilizadas. El tiempo de recuperación para el EUG coincide con los encontrados en tilápias (19).

The induction time found for animals exposed to eugenol were lower than those observed in the literature for juvenile Nile tilapia (19), a difference that can be attributed to the metabolic rate, weight and age (21). A higher induction time was also observed in juvenile pampo (Trachinotus marginatus), anesthetized with 50 mg/L of eugenol (22), probably due to physiological and metabolic differences between the species used. The recovery time for EUG coincides with those found for tilapia (19).

La inducción a la anestesia profunda debe presentar tiempo corto de latencia (60 a 180 segundos) y la recuperación no debe pasar de 300 segundos (23). En este ensayo, la exposición de tilápia a la benzocaína y al eugenol en la concentración de 100 mg/L y 50 mg/L respectivamente. Estos valores corroboran los resultados de trabajos realizados en la misma especie (22).

The induction and deep anesthesia must have a short latency time (60 to 180 seconds) and recovery should not exceed 300 seconds (23). In this test, tilapia specimens were exposure to benzocaine and eugenol at a concentration of 100 mg/L and 50 mg/L respectively. These values confirm the results of studies conducted within the same species (22).

Los peces anestesiados con EGG presentaron mayores tiempos de inducción y recuperación, debido posiblemente de la farmacocinética del compuesto (24). Los peces anestesiados con EGG no perdieron el equilibrio y la inducción fue confirmada por la manipulación sin reacción. Este comportamiento puede resultar del mecanismo de acción del compuesto, que no es depresor central, pero si miorrelajante (8), lo que posibilitaría el mantenimiento del equilibrio de los peces. No se encontró en la literatura consultada referencias sobre la utilización del éter gliceril guayacolato en peces. El grado de estrés puede ser estimado a partir de la elevación de los niveles séricos de glucosa, pues la glicemia es una de las respuestas fisiológicas secundarias al estrés, para suplir la mayor demanda energética (25). Los grupos anestesiados con benzocaína y eugenol tuvieron medias de 59.38±22.98 y 42.0±18.71 mg/dL, respectivamente, siendo estadísticamente inferior el grupo EGG (102.83±21.45 mg/dL) con relación a los niveles de glicemia determinados. Los valores de la glicemia obtenidos en los animales anestesiados con benzocaína y eugenol corroboran los encontrados por Tavares – Dias (26) con el uso de benzocaína en O. niloticus. Son considerados valores normales de glicemia aquellos de 57.43±0.44 mg/dL (27). Los resultados sugieren que la inducción con EGG no deprime el sistema nervioso central (8) y por eso los peces, están imposibilitados de responder debido al relajamiento muscular, perciben y desencadenan respuestas de estrés a la manipulación y a estímulos dolorosos, evidenciado por el aumento de la tasa de glicemia presentada en los animales tratados con EGG.

Fish anesthetized with GGE showed higher induction and recovery times, possibly because of the pharmacokinetics of the compound (24). Fish anesthetized with GGE did not lose the balance and the induction was confirmed by manipulation without reaction. This behavior can result from the action mechanism of the compound, which is not a central depressant but a muscle myorelaxant (8), which would enable the maintenance of the balance of the fish. No reference was found in the literature consulted on the use of guaiacolate glyceryl ether in fish. The level of stress can be estimated from the increase of serum glucose levels, as glycemia is one of the secondary physiological responses to stress, to meet the increased energy demand (25). Groups anesthetized with benzocaine and eugenol showed averages of 59.38±22.98 and 42.0±18.71 mg/dL, respectively, being statistically lower in the GGE group (102.83±21.45 mg/dL) in relation to the glycemia levels determined. Glycemia values obtained in animals anesthetized with benzocaine and eugenol corroborate those found by Tavares – Dias (26) with the use of benzocaine in O. niloticus. Normal glycemia values are considered as 57.43±0.44 mg/dL (27). The results suggest that induction with GGE does not depress the central nervous system (8) and therefore fish are unable to respond due to muscle relaxation, perceive and trigger stress responses to handling and painful stimuli, evidenced by the increase in the glycemia rate shown by animals treated with GGE.

Cosenza - Influence of glyceryl guaiacolate ether on anesthetics in tilapia

3951

Las variables hematológicas de las especies de peces son de interés ecológico, fisiológico y patológico. Estos análisis auxilian en la comprensión de la relación entre las características sanguíneas y el ambiente (28). Los resultados del hemograma y de la concentración de proteínas totales de los animales sometidos a la anestesia con todos los compuestos ensayados, no presentaron diferencias significativas, corroborando los valores encontrados en tilápias anestesiadas con benzocaína y eugenol en diferentes concentraciones (29). En tambaquis (Colossoma macropomum) anestesiados con eugenol no se verificaron alteraciones en las variables sanguíneas, excepto por el aumento en el hematocrito. Los autores atribuyeron este hecho a la mayor hidratación de los glóbulos rojos frente al estímulo estresante a que los animales fueron expuestos (30), hecho que no fue observado en el presente ensayo.

The hematologic variables of fish have an ecological, physiological and pathological interest. These analyses help to understand of the relationship between blood characteristics and the environment (28). The results of the hemogram and total protein concentration in animals subjected to anesthesia with all the compounds tested, did not show significant differences, corroborating the values found in tilapia anesthetized with benzocaine and eugenol in different concentrations (29). In tambaquis (Colossoma macropomum) anesthetized with eugenol, no alterations in blood variables were verified, except for the increase in hematocrits. The authors attributed this fact to the higher hydration of red blood cells due to the stressful stimulus to which animals were exposed (30), a fact not observed in this test.

Una posible explicación para el aumento del número de monocitos observada en el grupo BEN puede ser atribuida a que la benzocaína posee propiedades irritantes como el ácido p-aminobenzóico, dejando los peces agitados durante el inicio del ensayo y como consecuencia la movilización del pool marginal de los monocitos y aumento del mismo en la circulación. Esta alteración comportamental en el inicio del proceso de inducción, también fue observada por Delbon (29).

A possible explanation for the increase in the number of monocytes observed in group BEN can be attributed to the fact that benzocaine has irritative properties such as p-aminobenzoic acid, leaving the fish agitated during the start of the test and as a result the mobilization of the marginal pool of monocytes and the increase of the same in blood circulation. This behavioral alteration in the beginning of the induction process was also observed by Delbon (29).

Los resultados del presente estudio permiten concluir que los anestésicos no causaron alteraciones hematológicas. La benzocaína (100 mg/L) y el eugenol (50 mg/L) permitieron rápida inducción y recuperación en tilápias del Nilo sin evidencias de estrés durante la manipulación. El éter gliceril guayacolato en la concentración testada (900 mg/L), así haya inducido la anestesia de los peces, presentó un tiempo elevado de inducción y recuperación, y se mostró inadecuado para el uso en O. niloticus.

The results of this study suggest that the anesthetics did not cause hematological alterations. Benzocaine (100 mg/L) and eugenol (50 mg/L) enabled a rapid induction and recovery in Nile tilapia without evidence of stress during handling. The guaiacolate glyceryl ether in the concentration tested (900 mg/L), despite having induced the anesthesia of the fish, showed a high induction and recovery time and was inappropriate for use in O. niloticus.

REFERENCES

Belo MAA, Moraes JRE, Soares VE, Maritns ML, Brum CD, Moraes FR. Vitamin C and endogenous cortisol in foreign-body inflammatory response in pacus. PAB 2012; 47:1015.

2. Hasan M, Bart AN. Improved survival of rohu, Labeo rohita (Hamilton-Buchanan) and silver carp, Hypophthalmichthys molitrix (Valenciennes) fingerlings using low-dose quinaldine and benzocaine during transport. Aquac Res 2007; 38:50-58.

Holloway AC, Keene JL, Noakes DG, Moccia RD. Effects of clove oil and MS-222 on blood hormone profiles in rainbow trout Oncorhynchus mykiss. Aquac Res 2004; 35:1025-1030.

4. Davis KB, Griffin BR. Physiological responses of hybrid striped bass under sedation by several anesthetics. Aquacult 2004; 233:531-548.

3952

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

5. Mazzafera P. Efeito alelopático do extrato alcoólico do cravo-da-índia e eugenol. Rev Bras Bot 2003; 26:231-238. 6.

Wagner E, Arndt R, Hilton B. Physiological stress responses, egg survival and sperm motility for rainbow trout broodstock anaesthetized with clove oil, tricaine methanesulfonate or carbon dioxide. Aquaculture 2002; 211:353-366.

Kildea MA, Allan GL, Hearney RE. Accumulation and clearance of the anesthetics clove oil and AQUI-S™ from the edible tissue of silver perch (Bidyanus bidyanus). Aquaculture 2004; 232:265-277.

Andrade, SF. Manual de Terapêutica Veterinária. 3ª ed. Brasil: Roca São Paulo; 2002.

Roubach R, Gomes LC, Fonseca FAL, Val AL. Eugenol as an effi cacious anaesthetic for tambaqui, Colossoma macropomum (Cuvier). Aquac Res 2005; 36:1056-1061.

10. Gomes LC, Chippari-Gomes AR, Lopes NP, Roubach R, Araujo-Lima CARM. Efficacy of benzocaine as an anesthetic in juvenile tambaqui Colossoma macropomum. J World Aquacult Soc 2001; 32:426-431. 11. Ross LG, Ross B. Anaesthetic and Sedative techniques for Aquatic Animals. 2ª ed. London: Willey-Blackwell Publishing; 2008.

12. Lourenço KG, Claudiano GS, Eto SF, Aguinaga JY, Marcusso PF, Salvador R, et al. Hemoparasite and hematological parameters in Nile tilapia. Comp Clin Path 2012; DOI:10.1007/s00580-012-1638-8. 13. Madella DA, Neto EJR, Felisberto ME, Souza CE. Valores hematológicos de capivaras (Hydrochoerus hydrochaeris) de vida livre na região de Campinas-SP. Cienc Rural 2006; 36:1321-1324. 14. Martins ML, Pilarsky F, Onaka EM, Nomura DT, Fenerick JR. J, Ribeiro K, Myiazaki DMY, Castro MP et al. Hematologia e resposta inflamatória aguda em Oreochromis niloticus (Osteichthyes: Cichlidae) submetida aos estímulos único e consecutivo de estresse de captura. Bol Inst Pesca 2004; 30:71-80. 15. Tavares-Dias M, Moraes FR. Haematological and biochemical reference intervals for farmed channel catfish. J Fish Biol 2007; 71:383-388.

16. Grush J, Noakes DLG, Moccia RD. The effi cacy of clove oil as an anesthetic for the zebrafi sh, Danio rerio (Hamilton). Zebrafish 2004; 1:46-53. 17. Correa, SMBB. Probabilidade e estatítica. 2ª ed. Belo Horizonte, Brasil: PUC Minas Virtual; 2003. 18. Santos DMS, Cruz CF, Pereira DP, Alves LMC, Moraes FR. Microbiological water quality and gill histopathology of fish from fish farming in Itapecuru-Mirim County, Maranhão State. Acta sci Biol sci 2012; 34:199-205. 19. Delbon MCE, Paiva MJTR. Eugenol em juvenis de tilápia do Nilo: concentrações e administrações sucessivas. Bol Inst Pesca 2012; 38:43-52. 20. Antunes MIPP, Spurio RS, Godoi DA, Grumadas CES, Rocha MA. Cloridrato de benzocaína na anestesia de carpas (Cyprinius carpio). Semina Cienc Agrar 2008; 29:151-156. 21. Gilman AG. The Pharmacological Basis of Therapeutics. 6ª ed. Rio de Janeiro, Brasil: Guanabara-Koogan; 2010. 22. Okamoto MH, Tesser MB, Louzada LR, Santos RA, Sampaio LA. Benzocaína e eugenol como anestésicos para juvenis do pampo Trachinotus marginatus. Cienc Rural 2009; 39:866-870. 23. ROSS LG, ROSS, B. Anesthesia, sedation and transportation of juvenile Menidia estor (Jordan) using benzocaine and hypothermia. Aquacult Res 2007; 38:909-917. 24. Smith J, Colon J, Madero-Visbal R, Isley B, Konduri DS, Baker HC, Davis LE, Wolff WA. Blockade of MUC1 Expression by Glycerol Guaiacolate Inhibits Proliferation of Human Breast Cancer Cells. Anticancer Agents Med Chem 2010, 10:644–650. 25. Martins ML, Miyazaki DM, Moraes FR, Giraldelli L, Adamante WB, Mouriño JLP. Ração suplementada com vitraminas C e E influencia a respostas inflamatoria aguda em tilápia do Nilo. Cienc Rural 2008; 38:213-218. 26. Tavares-Dias M, Moraes FR. Hematological parameteres in two neotropical freswater teleost, Leporinus macrocephalus (Anostomidae) and Prochilodus lineatus (Prochilodontidae). Biosci J 2008; 24:96-101.

Cosenza - Influence of glyceryl guaiacolate ether on anesthetics in tilapia 27. Tavares-Dias M. Manejo e Sanidade de Peixes em Cultivo. 1ªed. Brasil: Embrapa Amapá, Amapá; 2009. 28. Tavares-Dias M, Moraes FR, Schalch SHC. Hematological characteristics of brazilian teleosts. VII. Parameters of seven species collected in Guariba, São Paulo State, Brazil; Bol Inst Pesca 2003; 29:109-115.

3953

29. Delbon MC. Ação da Benzocaína e do Óleo de Cravo sobre parâmetros fisiológicos de tilápia, Oreochromis niloticus, [Tesis Doctoral]. Jaboticabal, Brasil: Universidade Estadual Paulista. Centro de Aquicultura: 2006. 30. Inoue LAKA, Boijink CL, Ribeiro PT, Silva AMD, Affonso EG. Avaliação de respostas metabólicas do tambaqui exposto ao eugenol em banhos anestésicos. Acta Amaz 2011; 41:327-332.

Rev.MVZ Córdoba 19(1):3954-3961, 2014. ISSN: 0122-0268 ORIGINAL

Cryptosporidium spp., comparative diagnosis and geospatial distribution in diarrheic calves from dairy farms, Valdivia, Chile Diagnóstico comparativo y distribución geoespacial de Cryptosporidium spp., en terneros diarreicos en lecherías de Valdivia, Chile Pamela Muñoz A,1* M.Sc, Rubén Mercado P,2 Ph.D, Gabriela Morales T,1 MV, Viviana Bravo O,1 MV, Eduardo Raffo C,1,3 MV. Austral University of Chile, Faculty of Veterinary Science, Valdivia, Chile. 2University of Chile, Medicine School, Santiago, Chile. 3Austral University of Chile, National Commission for Scientific and Technology Research of Chile (CONICYT) Doctorate Program in Veterinary Science, Valdivia, Chile. *Correspondence: pamela.munoz@uach.cl 1

Received: April 2013; Accepted: September 2013.

ABSTRACT Objective. To determine the Cryptosporidium spp. infection frequency by using Ziehl-Neelsen and Auramine stains on samples obtained from diarrheic calves from milking farms of the Valdivia province. To compare both diagnostic tests and to determine the geospatial distribution of the infections caused by this protozoan. Materials and methods. 221 fecal samples of diarrheic calves of 24 milking farms of the Valdivia province were studied. The processing and analysis of the samples was done by Ziehl-Neelsen (ZN) and Auramine (AU) staining techniques, and the results were compared by McNemar statistical test and the concordance level was determined by kappa index. A map was also generated to determine the geospatial distribution of Cryptosporidium infections. Results. 57.9% of all the animals tested were classified as positive with the ZN stain test, while 55.6% of all the animals turned out positive for the AU stain test. The McNemar test showed no significant difference between both diagnostic techniques (p>0.05), while the kappa index showed proper concordance between tests (κ=0.73). 100% of the farms studied showed protozoan presence demonstrating the broad distribution of the parasite, however, and considering the previous factor, it was not possible to determine geospatial associations for the parasite distribution. Conclusions. The infection frequency of Cryptosporidium is higher than 50% in the milking farms studied from the Valdivia province. No difference between the Ziehl-Neelsen and Auramine staining techniques was demonstrated showing very consistent results. It was possible to detect that the number of farms infected correspond to 100% of the farms analyzed. Key words: Bovine, diarrhea, feces, infection, parasite, protozoa (Source: DeCS).

3954

Muñoz - Cryptosporidium spp., comparative diagnosis and geospatial distribution

3955

RESUMEN Objetivo. Determinar la frecuencia de infección por Cryptosporidium spp., mediante las tinciones de Ziehl-Neelsen y Auramina en terneros diarreicos de predios lecheros de la provincia de Valdivia. Comparar ambas pruebas diagnósticas y determinar la distribución geoespacial de las infecciones causadas por este protozoo. Materiales y métodos. Se estudiaron 221 muestras fecales de terneros diarreicos pertenecientes a 24 predios de la provincia de Valdivia. El procesamiento y análisis de las muestras se realizó mediante tinción de Ziehl-Neelsen (ZN) y Auramina (AU); y ambas técnicas se compararon mediante la prueba estadística de McNemar y su nivel de concordancia se determinó mediante índice kappa. Se generó además un mapa para determinar la distribución geoespacial de las infecciones por Cryptosporidium. Resultados. Del total de animales muestreados, 57.9% resultaron positivos a ZN, mientras que 55.6% fueron positivo para AU. En la prueba de McNemar no hubo diferencia significativa entre los métodos diagnósticos estudiados (p>0.05), en tanto el índice kappa determinó una concordancia buena entre ambas pruebas (κ=0.73). Del total de predios georeferenciados el 100% resultó positivo a la presencia del protozoo; demostrándose que ésta parasitosis tiene una amplia distribución; sin embargo, dado este factor, no fue posible determinar asociaciones geoespaciales sobre la distribución de éste. Conclusiones. La frecuencia de infección por Cryptosporidium supera el 50% en los predios lecheros de la provincia de Valdivia. No hubo diferencia entre las técnicas Ziehl-Neelsen y Auramina con resultados concordantes. Fue posible detectar que el número de predios infectados corresponde al 100% de los predios analizados. Palabras clave: Bovino, diarrea, heces, infección, parásito, protozoa (Fuente: DeCS).

INTRODUCCIÓN

INTRODUCTION

La criptosporidiosis es una enteroparasitosis de distribución cosmopolita, causada por el protozoo Cryptosporidium spp., cuyo principal signo clínico en el hospedero es la diarrea no hemorrágica (1,2). La criptosporidiosis es considerada una enfermedad zoonótica por eso su importancia desde el punto de vista de la salud pública (3). En los bovinos afecta principalmente a los terneros recién nacidos que adquieren el parásito por vía oral (1,4), siendo la principal fuente de infección las heces de los individuos jóvenes o neonatos con diarrea y aquellos animales adultos que actúan como portadores asintomáticos (2). Otra fuente importante de infección para terneros neonatos la constituyen los pezones de la vaca o los baldes de leche sustituta, que puedan estar contaminados con ooquistes del parásito (4).

Cryptosporidiosis is a parasite infection with cosmopolitan distribution, caused by the Cryptosporidium spp. protozoan, the main clinical sign of which in the host is nonhemorrhagic diarrhea (1,2). Cryptosporidiosis is considered to be a zoonotic disease, hence its importance from the public health point of view (3). In cattle, it mainly affects newborn calves that acquire the parasite orally (1.4), being the feces of newborns or young individuals with diarrhea and adult animals that act as asymptomatic carriers the main source of infection (2). Cow’s teats or substitute milk buckets, which may be contaminated with the oocysts of the parasite, are another important source of infection for newborn calves (4).

Con respecto a la prevalencia de la enfermedad, los primeros reportes en Chile de hallazgo de Cryptosporidium en bovinos se producen en el año 1986, estudio en el que se determinó la presencia de este protozoo en 12 terneros de un total de 51 animales diarreicos. Luego en 1989, un estudio realizado en la región Metropolitana determinó niveles de prevalencia menores, el 2.2% en animales sanos y el 23% en animales diarreicos (5,6). Después en el año 1997, un estudio realizado en terneros diarreicos, reportó una prevalencia de 30.6% en el sur de Chile (6). El estudio más reciente en el país, corresponde al realizado por Díaz-Lee et al (5) en la región Metropolitana donde se analizaron 205 muestras de terneros diarreicos, pertenecientes a 2 predios lecheros, determinándose una frecuencia de infección de un 57%.

With respect to the prevalence of the disease, the first reports in Chile of the discovery of Cryptosporidium in cattle, are produced in the year 1986, a study where the presence of this protozoan was determined in 12 calves from a total of 51 diarrheic animals. Then in 1989, a study conducted in the Metropolitan region found lower prevalence levels, 2.2% in healthy animals and 23% in diarrheic animals (5,6). Then in 1997, a study conducted on diarrheic calves, reported a prevalence of 30.6% in the south of Chile (6). The latest study in the country is that conducted by Diaz-Lee et al (5) in the Metropolitan region, where 205 samples of diarrheic valves belonging to 2 dairy farms were analyzed, determining an infection rate of 57%.

3956

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Con respecto al diagnóstico de laboratorio de esta parasitosis, en animales de ganado existen diferentes métodos para la detección de ooquistes de Cryptosporidium, como la tinción de ZiehlNeelsen modificada o la tinción de Auramina (5). Ambas tinciones se aplican sobre extendidos de heces previamente concentrados y luego se observan en el microscopio óptico y de luz ultravioleta para fluorescencia, respectivamente (7). Se describe que la técnica de Auramina presenta ventajas ante la tinción de Ziehl-Neelsen al ser un método más rápido y eficaz de diagnóstico de ooquistes de Cryptosporidium spp., debido a que la inversión de tiempo durante la realización de la tinción y lectura de los frotis, resulta ser menor, por lo que es mayormente utilizada para análisis de un gran número de muestras o bien para estudios epidemiológicos o epizootiológicos (8). Este estudio tuvo como objetivo determinar la frecuencia de infección por Cryptosporidium spp., en terneros diarreicos de predios lecheros mediante las tinciones de Ziehl-Neelsen y Aramina; comparando el rendimiento de ambas pruebas diagnósticas mediante la prueba estadística de McNemar y la concordancia de éstas mediante el índice kappa; y generar un mapa de distribución geoespacial de las infecciones provocadas por este protozoo en terneros de lechería pertenecientes a la provincia Valdivia.

MATERIALES Y MÉTODOS Muestras. Se recolectaron muestras de heces de terneros diarreicos, con edades entre 1 y 35 días, entre los meses de mayo 2010 hasta abril del 2011. Éstas fueron obtenidas directamente del recto de cada animal y cada muestra fue depositada en tubos de 50 mL que contenían 25 mL de etanol al 70%, con su respectiva identificación (número de cada animal, sexo, edad y predio). Las muestras fueron trasladadas al laboratorio de Parasitología de la Facultad de Ciencias Veterinarias de la Universidad Austral de Chile para su posterior análisis. Procesamiento. De cada muestra se realizaron 2 extendidos de material fecal sobre portaobjetos, uno para tinción con Ziehl-Neelsen y otro para Auramina, los que se dejaron secar a temperatura ambiente para luego ser teñido según protocolo de Fredes et al (9) para Ziehl-Neelsen y según Fayer y Xiao (7) para Auramina. Distribución geoespacial. Se registraron todas las coordenadas de latitud y longitud geográficas desde donde se obtuvieron muestras fecales de terneros mediante el uso de un GPS portátil de uso civil. Los datos fueron obtenidos y registrados con el sistema de grilla WGS-84 identificando

With regard to the laboratory diagnosis of this parasitism, in livestock animals there are different methods for detecting oocysts of Cryptosporidium, such as the modified ZiehlNeelsen stain or the Auramine stain (5). Both stains are applied on previously concentrated feces and then are observed in an optical and ultraviolet light microscope for fluorescence, respectively (7). The Auramine technique shows advantages to the Ziehl-Neelsen stain as it is faster and more efficient method for the diagnosis of oocysts of Cryptosporidium spp., since the time investment during the staining process and the reading of the smear proves to be less, so it is mostly used for the analysis of a large number of samples or for epidemiological or epizootiological studies (8). The objective of this study was to determine the frequency of infection by Cryptosporidium spp. in diarrheic calves from dairy farms through Ziehl-Neelsen and Auramine stains; comparing the performance of both diagnostic tests using the McNemar statistical test and the consistency of these through the kappa index; and generate a geospatial distribution map of infections caused by this protozoan in dairy calves from the Valdivia province.

MATERIALS AND METHODS Samples. Feces samples from diarrheic calves were collected, with ages raging between 1 and 35 days, between the months of May 2010 to April 2011. These were obtained directly from the rectum of each animal and each sample was placed in 50 mL tubes containing 25 mL of ethanol at 70%, with their respective identification (number of each animal, gender, age and farm). The samples were transferred to the parasitology laboratory of the Faculty of Veterinary Science of the Austral University of Chile for further analysis. Processing. From each sample two fecal smears were placed on a slide, one for ZiehlNeelsen stain and another for Auramine stain, which were left to dry at room temperature to then be stained according to the protocol of Fredes et al (9) for Ziehl-Neelsen and according to Fayer and Xiao (7) for Auramine. Geospatial distribution. All the geographical latitude and longitude coordinates where fecal samples from calves were obtained were recorded through the use of a portable GPS for civilian use. Data were obtained and registered with the WGS-84 grid system identifying coordinates and the corresponding

Muñoz - Cryptosporidium spp., comparative diagnosis and geospatial distribution coordenadas y el huso geográfico correspondiente. La información obtenida fue transferida a un mapa en blanco en el software Arc-Gis generándose una capa (layer) con los puntos de obtención de las muestras. A este mapa en blanco se le agregaron capas de información como propiedad de la tierra, curvas de elevación, hidrología, tipos de suelo y vegetación, con el fin de determinar criterios de riesgo para la presencia del parásito (10). Análisis estadístico. Los resultados se analizaron mediante la prueba estadística de McNemar para proporciones correlacionadas o dependientes. Mientras que para determinar los niveles de concordancia entre ambas pruebas, se utilizó el índice kappa (κ) (11). Toda la información recopilada fue ingresada a una base de datos generada en el programa computacional Microsoft® Excel 2003.

RESULTADOS Se muestrearon 24 predios lecheros pertenecientes a la provincia de Valdivia. De éstos se obtuvieron 221 muestras de heces de terneros diarreicos. Ciento veintiocho resultaron positivas a tinción de Ziehl-Neelsen, lo que corresponde al 57.9% del total de muestras (Tabla 1). En todas las muestras positivas se hizo evidente la presencia de abundantes elementos esféricos de tamaño entre 4-6 µm, con bordes delimitados y teñidos de color fucsia (Figura 1). Con respecto a la tinción de Auramina, 123 muestras resultaron positivas lo que corresponde al 55.6% del total de muestras (Tabla 1). En éstas se encontró la presencia de elementos esféricos de tamaño aproximado entre 4-6 µm, irregularmente teñidos de color verde fluorescente (Figura 2).

3957

geographical zone. The information obtained was transferred to a blank map on the Arc-Gis software generating a layer with the sampling points. Layers of information were added to this blank map such as land ownership, elevation curves, hydrology, soil and vegetation types, in order to determine risk criteria for the presence of the parasite (10). Statistical analysis. T he result s w ere analyzed using the McNemar statistical test for correlated or dependent proportions. While the kappa (κ) index was used for determining the level of concordance between the two tests (11). All the information collected was entered into a database generated in the computer program Microsoft® Excel 2003.

RESULTS Twenty-four dairy farms from the Valdivia province were sampled. From these 221 feces samples from diarrheic calves were obtained. One hundred twenty-eight turned out positive to the Ziehl-Neelsen stain, which corresponds to 57.9% of the total samples (Table 1). The presence of abundant spherical elements with a size between 4-6 µm was seen in all positive samples, with borders delimited and stained in fuchsia (Figure 1). With respect to the Auramine stain, 123 samples were positive which corresponds to 55.6% of the total samples (Table 1). The presence of spherical elements with an approximate size between 4-6 µm was found, unevenly stained in fluorescent green (Figure 2).

Del total de terneros diarreicos estudiados, el 48.9% resultaron positivos a ambas pruebas diagnósticas y el 35.7% resultaron negativos tanto para Ziehl-Neelsen como para Auramina (Tabla 2).

Table 1. Frequency of infections of Cryptosporidium spp., using the Ziehl-Neelsen (ZN) and Auramine (AU) techniques (absolute value and %) in feces samples from diarrheic calves belonging to 24 dairy farms in the Valdivia province (n=221). Diagnostic Test

Positive n

Positive %

128

57.9%

123

55.6%

Figure 1. Microscopic observation of oocysts of Cryptosporidium in feces of diarrheic calves in the Valdivia province, stained using the Ziehl-Neelsen technique (100x).

3958

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Table 2. Concordance of the results for feces samples of diarrheic calves analyzed using the microscopic techniques of Ziehl-Neelsen (ZN) and Auramine (AU) (absolute value and %).

Figure 2. Microscopic observation of oocysts of Cryptosporidium spp. in feces of diarrheic calves in the Valdivia province, stained with Auramine technique (40x).

Mediante McNemar se determinó que no hubo diferencia significativa entre los dos pruebas de laboratorio empleadas (p>0.05), en tanto el índice kappa mostró una buena concordancia entre las dos pruebas (κ=0.73). Finalmente, del total de predios analizados (n=24) el 100% resultó positivo a la presencia del protozoo. El mapa con capas generado para la determinación de factores de riesgo geoespaciales no permitió realizar una discriminación ya que el 100% de los predios registrados presentó resultados positivos para la presencia del parásito estudiado, por lo que la distribución geoespacial no pudo asociarse a las características específicas del sector geográfico (Figura 3).

Results of Diagnostic Tests

No. of Samples Obtained

Positive Percentage %

Positive to Both (ZN and AU)

108

48.9%

Positive to ZN

128

57.9%

Positive to AU

123

55.6%

Negative to Both (ZN and AU)

35.7%

From the total of diarrheic calves studied, 48.9% turned out positive to both diagnostic tests and 35.7% were negative for both ZiehlNeelsen and Auramine (Table 2). Using McNemar it was determined that there was no significant difference between the two laboratory tests employed (p>0.05), insofar as the kappa index showed proper consistency between the two tests (κ=0.73). Finally, from the total of farms analyzed (n=24) 100% was positive to the presence of the protozoan. The layered map generated for the determination of geospatial risk factors did not allow conducting a differentiation since 100% of the farms recorded showed positive results for the presence of the parasite under study, so the geospatial distribution could not be associated with the specific characteristics of the geographical area (Figure 3).

Figure 3. Geographical location and distribution of the 24 dairy farms positive to the Cryptosporidium spp. agent in the province of Valdivia, Chile.

Muñoz - Cryptosporidium spp., comparative diagnosis and geospatial distribution

3959

DISCUSIÓN

DISCUSSION

El alto nivel de infección por Cryptosporidium spp., observado en terneros de lechería de la provincia de Valdivia fue mayor con relación a los primeros registros observados en esta zona del país (5,6); donde se reportó una prevalencia de criptosporidosis de 30.6% en las regiones del Maule, la Araucanía y Los Lagos. En este estudio se determinó aproximadamente el doble de las tasas de infecciones para la misma especie animal y el mismo rango etario. Por otra parte, en recientes estudios realizados en la Región Metropolitana se determinó un nivel de infección de 49.8% utilizando la técnica de Ziehl-Neelsen y 56.1% mediante Auramina, de un total de 205 terneros diarreicos pertenecientes a dos predios lecheros (5). Es importante destacar el hecho de que en el presente estudio, así como en el realizado por Díaz-Lee et al (5), se obtuvieron resultados que superan al 50% de animales positivos a este agente protozoario. Esto demuestra que la criptosporidiosis es una parasitosis que se mantiene prevalente y probablemente reemergente en el país.

The high infection level by Cryptosporidium spp., observed in dairy calves of the Valdivia province was higher when compared to the first records observed in this part of the country (5,6); where a 30.6% criptosporidosis prevalence was reported in the regions of Maule, Araucania and Los Lagos. In this study approximately twice the infection rates for the same animal species and the same age range were determined. On the other hand, in recent studies conducted in the Metropolitan Region an infection level of 49.8% was determined using the Ziehl-Neelsen technique and 56.1% using Auramine, from a total of 205 diarrheic calves belonging to two dairy farms (5). It is important to highlight the fact that in this study as well as in that conducted by Diaz-Lee et al (5), results exceeding 50% of animals positive to this protozoan agent were obtained. This proves that cryptosporidiosis is a parasitic infection that remains prevalent and will probably remerge in the country.

Con respecto la prueba de McNemar demostró que no existen diferencias significativas entre las dos técnicas diagnósticas (p>0.05). De Quadros et al (8), en 331 muestras de heces en animales domésticos en donde comparó ambas técnicas, determinó que un 7.5% de las muestras analizadas resultaron positivas a ZN y un 5.7% para AU y ZN demostrando que no hay diferencias significativas entre ambos métodos. Los autores exponen además, que la tinción de AU posee una mayor afinidad por la pared de los ooquistes de Cryptosporidium spp., que la fucsina utilizada en la tinción de ZN, demostrando que la primera tinción presenta ventajas ante la segunda al ser un método más eficaz de diagnóstico, ya que es de más rápida realización y lectura, por lo que es mayormente utilizado en un gran número de muestras o bien para estudios epidemiológicos. En cambio, en el estudio realizado por Díaz-Lee et al (5) se demuestra que existe diferencia entre ambos métodos, y que la tinción de AU presenta mayor sensibilidad que la de ZN, detectándose diferencia significativa (p<0.05). Se ha sugerido que el método de ZN teñiría una pequeña proporción de los ooquistes presentes en una muestra y podría teñir un menor número de ooquistes que la prueba de AU (11); sin embargo, este mismo autor, estimó una sensibilidad aceptable para ambas técnicas diagnósticas. Con respecto al índice kappa se obtuvo como resultado que los niveles de concordancia entre ambas pruebas diagnósticas, es bueno (κ=0.73), lo que condice con el nivel de concordancia logrado por Brook et al (12), donde el valor de κ fue igual a 0.79.

Regarding the McNemar test, it demonstrated that there are no significant differences between the two diagnostic techniques (p>0.05). De Quadros et al (8), in 331 feces samples from domestic animals where both techniques were compared, determined that 7.5% of the samples analyzed turned out positive for ZN and 5.7% for AU and ZN, showing that there are no significant differences between both methods. The authors also stated that the AU staining has a greater affinity for the wall of the oocysts of Cryptosporidium spp. Than the fuchsine used for the ZN stain, demonstrating that the first stain has advantages to the second as it is a more effective diagnosis method, of faster execution and reading, so it is mostly used in a large number of samples or for epidemiological studies. In contrast, the study conducted by Diaz-Lee et al (5) demonstrates that there is a difference between both methods, and the AU staining has a greater sensitivity than ZN, detecting a significant difference (p<0.05). It has been suggested that ZN method would stain a small proportion of the oocysts present in a sample and could stain a smaller number of oocysts than the AU test (11); however, this same author considered an acceptable sensitivity for both diagnostic techniques. With respect to the kappa index, it was obtained as a result that the level of concordance between the two diagnostic tests is good (κ=0.73), which is consistent with the level of concordance achieved by Brook et al (12), where the κ value was equal to 0.79.

Respecto a las ventajas y desventajas que presentan las técnicas utilizadas, se debe mencionar que la principal ventaja de ZN como metodología diagnóstica, es su bajo costo, a esto se suma el hecho de que los

Regarding the advantages and disadvantages of the techniques used, it is worth mentioning

3960

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

extendidos una vez teñidos, pueden ser conservados de forma permanente, a diferencia de la tinción de AU (12). Mientras que la desventaja que presenta ZN corresponde al mayor tiempo que se debe dedicar para la microscopia convencional (11,12). Con respecto a la tinción de AU cabe destacar su rápida realización y lectura, pero los extendidos teñidos no se conservan de forma permanente y se requiere de un microscopio de campo oscuro dotado de luz ultra violeta para la observación de muestras teñidas, que no siempre está disponible en laboratorios clínicos; y finalmente la fluorescencia del fondo de la muestra podría representar un problema en la lectura de los extendidos cuando existe una gran cantidad de detritus fecales presentes en éstas (7). Por otra parte, es importante considerar que se detectó ooquistes del agente protozoario en un ternero diarreico de 1 día de edad con posterior muerte del animal. El presente hallazgo se relaciona con lo registrado en el estudio de Díaz-Lee et al (5) quien también destaca el hecho de haber investigado 2 animales positivos a este protozoario al día de nacidos, es decir antes que trascurra el período prepatente (3 a 4 días) para esta infección en los bovinos (2). Una posible causa de encontrar ooquistes en terneros de 1 día, hace referencia a lo expuesto por Romero et al (4) implicando a los pezones de la madre, como una fuente importante de infección al estar contaminados con ooquistes de Cryptosporidium spp., los que ingresarían al sistema digestivo del ternero, en el momento en que éste mama el calostro. La eliminación de ooquistes en un período de tiempo menor al descrito en el ciclo de vida de este protozoo podría explicarse con el rol de hospedero de tránsito, que cumpliría el ternero de un día de edad eliminándose directamente a través de las heces. A la vez, cabe la posibilidad de que existan otras vías de transmisión por lo que es necesario hacer futuras investigaciones al respecto. Con relación a la distribución geoespacial de las infecciones causadas por este protozoo se determinó que en los 24 predios muestreados se investigó la presencia de ooquistes de Cryptosporidium spp., lo que demuestra un alto nivel de infección en la provincia de Valdivia. No fue posible determinar los criterios de riesgo asociados a la presencia o ausencia del protozoo; ya que no hubo grupos, predios o sectores de la provincia negativos al agente. De la misma forma, las características de vegetación, calidad edafológica y cercanía a cursos hídricos fueron prácticamente compartidas por todos los predios, ya que todos corresponden a lecherías de características similares. En el presente estudio fue posible observar que todos los predios estudiados se encuentran cerca de cursos de aguas superficiales (Figura 1) constituyendo una posible fuente de infección para los bovinos. Se recomienda para futuros estudios, considerar el análisis e investigación de las aguas superficiales cercanas a estos predios positivos a

that the main advantage of ZN as a diagnostic methodology is its low cost, coupled to the fact that once the smears have been stained, there may be stored permanently, as opposed to the AU stain (12). While the disadvantage of ZN is the longer time that must be used in conventional microscopy (11,12). The quick execution and reading of the AU stain is noteworthy, but the stained smears cannot be kept permanently and a dark field microscopy equipped with ultra violet light is required for the observation of stained samples, which is not always available in clinical laboratories; and finally the fluorescence on the bottom of sample could represent a problem in the reading of smears when there is a large amount of fecal detritus present in the same (7). On the other hand, it is important to consider that oocysts of the protozoan agent were detected in a diarrheic calf of 1 day of age followed by the death of the animal. This find is related to that recorded in the study of Diaz-Lee et al (5) who also emphasizes the fact of having investigated 2 animals positive for this protozoan on the day of their birth, i.e. before the incubation period (3 to 4 days) for this infection in cattle (2). A possible cause of finding oocysts in calves of 1 day of age has been referred to by Romero et al (4) involving the teats of the mother as a major source of infection by being contaminated with oocyst of Cryptosporidium spp., which would enter the digestive system of the calf when drinking the colostrum. The elimination of oocysts in a smaller period of time than that described in the lifecycle of this protozoan may be explained by the role of the transit host, which would be fulfilled by the calf of one day old being eliminated directly through feces. In turn, it is possible that there are other routes for transmission so it is necessary to do further research on the subject. In relation to the geospatial distribution of infections caused by this protozoan, it was determined that the presence of oocysts of Cryptosporidium spp. was investigated in the 24 farms sampled, which demonstrates a high infection level in the Valdivia province. It was not possible to determine the risk criteria associated with the presence or absence of protozoa; since there were no groups, farms or sectors in the province negative to the agent. Similarly, the characteristics of the vegetation, soil quality and proximity to watercourses were practically shared by all farms, since all correspond to dairies with similar characteristics. In this study it was possible to observe that all farms studied are near surface watercourses (Figure 1) constituting a potential source of infection for cattle. For future studies it is recommended to consider the analysis and research of surface watercourses near these

Muñoz - Cryptosporidium spp., comparative diagnosis and geospatial distribution

3961

infección por Cryptosporidium spp., con el fin de automatizar medidas necesarias para prevenir la diseminación de esta enfermedad entre los animales y su posible transmisión al ser humano con el consecuente perjuicio sanitario y económico.

farms positive to infection by Cryptosporidium spp., in order to automate the necessary steps to prevent the spread of this disease among animals and its possible transmission to humans with the consequent health and economic damages.

En conclusión, se determinó que la frecuencia de infección por Cryptosporidium spp., en terneros de predios lecheros supera al 50% en provincia de Valdivia utilizando tanto la tinción de ZN como AU cuyos rendimientos y concordancia entre ambas pruebas fue buena. Finalmente fue posible detectar que el número de predios con criptosporidiosis correspondió al 100% de los predios analizados, observándose en el mapa una distribución uniforme asociada a los ambientes que son capaces de sostener una lechería de alta producción.

In conclusion, it was determined that the frequency of infection by Cryptosporidium spp., in calves of dairy farms exceeds 50% in the Valdivia province using both the ZN stain and AU stain whose performance and concordance between the two tests was appropriate. Finally, it was possible to detect that the number of farms with cryptosporidiosis corresponded to 100% of the farms analyzed, observing a uniform distribution in the map associated with environments that are capable of sustaining a high production dairy.

Agradecimientos

Acknowledgments

Este estudio fue realizado gracias a la financiación del proyecto DID UACH Nº S-2010-19 y FONDECYT 1121035.

This study was carried out thanks to the financing of the project DID UACH Nº S-2010-19 and FONDECYT 1121035.

REFERENCES 1. Taylor M, Coop R, Wall R. Veterinary Parasitology. Oxford, United Kingdom: Blackwell; 2007. 2. Thompson R, Olson M, Zhu G, Enomoto S, Abrahamsen M, Hijjawi N. Cryptosporidium and Cryptosporidiosis. Adv Parasitol 2005; 59:78-139. 3. Chalmers R, Campbell B, Crouch N, Davles A. Clinical laboratory practices for detection and reporting of Cryptosporidium in community cases of diarrhoea in the United Kingdom. Euro Surveill 2008; 15:1-5. 4. Romero R, Pedrozo R, Vera E. La cryptosporidiosis en los terneros recién nacidos. Su etiología, patogenia, síntomas, tratamiento y profilaxis. Revista de ciencia y tecnología 2001; 3:99-108. 5. Díaz-Lee A, Mercado R, Onuoha E, Ozaki L, Muñoz P, Muñoz V, Martínez F, Fredes F. Cryptosporidium parvum in diarrheic calves detected by microscopy and identified by immunochromatographic and molecular methods. Vet Parasitol 2010; 176:139-144. 6. Muñoz P, Fredes F, Díaz-Lee A, Mercado R, Ozaki L. Detección de Cryptosporidium spp. en terneras de lecherías de la Región Metropolitana mediante Ziehl Neelsen y confirmada por inmunocromatografía y ensayo molecular. Arch Med Vet 2011; 43:111-116.

7. Fayer R, Xiao L. Cryptosporidium and Cryptosporidiosis. New York, USA. Ed CRC Press, 2007. 8. De Quadros R, Marques S, Amendoeira C, De Souza L, Amendoeira P, Comparin C. Detection of Cryptosporidium oocysts by Auramine and Ziehl Neelsen staining methods. Parasitol Latinoam 2006; 61:117-120. 9. Fredes F, Raffo E, Muñoz P. First report of Cryptosporidium spp. oocysts in stool of Adélie penguin from the Antarctic using acid-fast stain. Antarct Sci 2007; 19(4):437-438. 10. Dohoo I, Martin W, Stryhn H. Veterinary Epidemiologic Research. Edward Island, Canadá. AVC Inc. 2003. 11. Hänscheid T, E Valadas. Diagnosis of Cryptosporidiosis using PCR or auramine O with LED fluorescent microscopy: Wich end of the stick? Acta Trop 2009; 109:247-248. 12. Brook E, Christley R, French N, Hart C. Detection of Cryptosporidium oocyst in fresh and frozen cattle faeces: comparision of three methods. Let Appl Microbiol 2008; 46:26-31.

Rev.MVZ Córdoba 19(1):3962-3969, 2014. ISSN: 0122-0268 ORIGINAL

Effect of sugarcane silage on productive parameters of replacement Holstein-Friesian heifers Efecto del ensilado de caña de azúcar en los parámetros productivos de vaquillas Holstein-Friesian para reemplazo José Reyes G,1 Ph.D, Oziel Montañez-Valdez,1* Ph.D, Candido Guerra M,2 Ph.D, José Palma G,3 Ph.D. University of Guadalajara, Centro Universitario del Sur, Departamento de Desarrollo Regional. Ave. Enrique Arreola Silva 883, Ciudad Guzman, Jalisco. 49000. Mexico. 2University of Guadalajara, Centro Universitario de la Costa Sur, Autlan de Navarro, Jalisco. Departamento de Desarrollo Regional 3Universidad de Colima, Centro Universitario de Investigacion y Desarrollo Agropecuario. Carretera Colima-Manzanillo. Km 40. Colima, Mexico. *Correspondence: montanez77@hotmail.com 1

Received: June 2013; Accepted: October 2013.

ABSTRACT Objective. Measure the productive parameters of Holstein-Friesian females from weaning to 470 days old, comparing feeding through sugarcane silage (SCS) and corn silage (CS) in a concentrated fodder ratio of 70:30. Materials and methods. Twenty-eight post-weaning calves were used, with an average age of 80±16 days old and an initial weight of 79.5±12.9 kg. The T-Student test was used for the comparison of means, where calves were divided into two groups of 14, one for each treatment. The body weight BW (kg), wither height WH (cm), body condition BC (1 to 5 scale), daily weight gain DWG (kg) and feed conversion FC (kg) was measured every 30 days. Results. Differences were found between treatments, where heifers fed with SCS showed better BC (3.12), FC (7.4) as compared to the CS treatment. No significant differences were found in terms of DWG (0.666 and 0.743 kg/d). Conclusions. Feeding based on sugarcane silage allows for an improved body condition and feed conversion of animals having with this an acceptable and cost-effective production performance in the raising of dairy replacements. Key words: Corn, feeding of animals, silage, replacement (Source: NAL Thesaurus) .

RESUMEN Objetivo. Medir los parámetros productivos de hembras Holstein-Friesian desde el destete hasta los 470 días de edad, comparando la alimentación con ensilado de caña de azúcar (ECA) y ensilado de maíz (EM) en una proporción forraje concentrado de 70:30. Materiales y métodos. Se utilizaron 28 becerras, con una edad promedio de 80±16 días y un peso inicial de 79.5±12.9 kg. Se utilizó la prueba de comparación de medias T- Student, donde se dividieron las becerras en dos grupos de 14, uno para cada tratamiento. Cada 30 días se midió el peso corporal, PC (kg); altura a la cruz, AC (cm); condición corporal, CC (escala de 1 a 5); ganancia diaria de peso, GDP (kg); y conversión alimenticia, CA (kg). Resultados. Se encontraron diferencias entre los tratamientos, donde las vaquillas

3962

Reyes - Effect of sugarcane silage on productive parameters

3963

alimentadas con ECA mostraron mejor CC (3.12), CA (7.4) en comparación con el tratamiento EM. No se encontraron diferencias significativas en cuanto a la GDP (0.666 y 0.743 kg/d). Conclusiones. La alimentación basada en ensilaje de caña de azúcar permite una mejora en la condición corporal y en la conversión alimenticia de los animales teniendo con esto un comportamiento productivo aceptable y económicamente rentable en la crianza de reemplazos lecheros. Palabras clave: Alimentación de animales, ensilado, maíz, reemplazo (Fuente: NAL Thesaurus).

INTRODUCCIÓN

INTRODUCTION

La recría es un componente vital de las explotaciones lecheras modernas, al proporcionar un abasto consistente y económico de reemplazos de alta calidad al hato, este objetivo se logra con la implementación de sistemas de crianza eficientes tanto en nutrición como en sanidad, que garanticen este fin, adecuándolos a la región y explotación en particular (1). En este sentido, Schingoethe y García (2), señalan que uno de los principales factores que limita el desarrollo de la ganadería lechera es la crianza de vaquillas de reemplazo, por lo que es imprescindible buscar alternativas de solución y diseñar sistemas de producción acorde con la realidad socio-económica, que en el caso de la industria lechera resulten en una producción eficiente, atractiva y económicamente costeable para el productor, además de accesible a toda la población y que permita la cría económica de los reemplazos para la preservación de estos sistemas.

Breeding is a vital component of modern dairy farms, as it provides a consistent and costeffective supply of high-quality replacements, this goal is achieved through the implementation of efficient breeding systems both in nutrition as in health to ensure this purpose, adapting the same to the particular region and exploitation (1). In this sense, Schingoethe and Garcia (2) point out that one of the main factors limiting the development of dairy farming is the raising of replacement heifers, so it is essential to seek alternative solutions and design production systems according to the socio-economic reality, which in the case of the milk industry result in efficient, attractive and economically affordable production for the producer, as well as being accessible for the entire population and allow the cost-effective breeding of replacements for the preservation of these systems.

En la producción bovina los forrajes juegan un papel crítico, dado a que son la fuente más económica de nutrientes, entre estos, los ensilajes son reconocidos por su baja variación en calidad alimenticia (3,4). Por tanto, el ensilado de cultivos forrajeros podría ser una opción que contribuya de manera importante para optimizar el funcionamiento de los sistemas de producción animal (reemplazos lecheros) en zonas tropicales y subtropicales. Aunque es necesaria una suplementación apropiada para mejorar la producción, preferentemente de consumo lento con aportes adecuados de nitrógeno, lípidos y minerales para corregir sus limitantes (5,6).

In bovine production fodder plays a critical role, since it is the most economical source of nutrients, among these silages are renowned by their low variation in nutritional quality (3,4). Therefore, the silage of fodder crops could be an option that contributes significantly to optimize the operation of animal production systems (dairy replacements) in tropical and subtropical areas. Although appropriate supplements are required to improve production, preferably slow consumption with appropriate inputs of nitrogen, lipids and minerals to correct constraints (5,6).

La caña de azúcar es posiblemente el cultivo herbáceo de mayor rendimiento en biomasa por unidad de área y de tiempo. Supera a otras plantas de altos rendimientos como el maíz y el trigo. Su capacidad de mantener una alta digestibilidad con la madurez creciente, le proporciona una ventaja importante como alimento para los rumiantes, especialmente durante la época seca cuando la mayoría de otros forrajes son poco disponibles y de baja calidad (6,7). La falta de información referente al desarrollo de vaquillas Holstein-Friesian futuros reemplazo de

Sugarcane is possibly the herbaceous crop with the highest performance in terms of biomass per area and time unit. It outperforms other highyield plants such as corn and wheat. Its ability to maintain high digestibility with growing maturity provides an important advantage as food for ruminants, especially during the dry season when most other fodders are unavailable and of low quality (6,7). The lack of information concerning the development of Holstein-Friesian heifers that will be the future replacement of animals in production and their development with local

3964

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

animales en producción y su desarrollo con recursos forrajeros y alimentos locales, inducen a desarrollar éste tipo de trabajos por lo que el objetivo de este estudio fue evaluar el sistema de alimentación basados en ensilado de caña de azúcar en el desarrollo de becerras Holstein-Friesian.

MATERIALES Y MÉTODOS Sitio de estudio. Este estudio se realizó en el Rancho Agropecuario “DOS PIVOTES” dedicado a la producción de leche y pie de cría (vaquillas para reemplazo y sementales), y producción de caña de azúcar para la industria. El rancho se ubica al suroeste del Municipio de Zapotlán El Grande, del Estado de Jalisco, México; con coordenadas geográficas de 19°27’13” de latitud norte y meridianos 103°27’57” de longitud oeste, con una altitud de 1.520 m. El clima es semicálido, con una precipitación anual promedio de 732 mm distribuida en los meses de Junio a Septiembre, y lluvias invernales o cabañuelas de manera ocasional. Su temperatura media es de 20.2°C (8).

fodder and food leads to the development of this type of work, hence the objective of this study was to evaluate the feeding system based on sugarcane silage in the development of HolsteinFriesian heifers.

MATERIALS AND METHODS Study site. This study was carried out in the Agricultural Farm “DOS PIVOTES” engaged in the production of milk and breeding stock (replacement heifers and stallions), and the production of sugarcane for the industry. The ranch is located to the southwest of the Municipality of Zapotlan El Grande, in the State of Jalisco, Mexico; with geographic coordinates 19°27’13” north latitude and meridians 103°27’57” west longitude, with an altitude of 1.520 m. The climate is warm, with average annual rainfall of 732 mm distributed in the months of June to September, and occasional winter or summer rainfall. Its average temperature is 20.2°C (8).

Procedimientos. Se utilizaron 28 becerras de la raza Holstein-Friesian con una edad inicial promedio de 80±16 días y peso vivo en promedio de 79.5±12.9 kg. Cada 30 días se midió el peso corporal, el pesaje de las vaquillas se llevó a cabo mediante la medición del perímetro torácico con cinta graduada en centímetros y empleo de la tabla de conversión para peso vivo, la altura a la cruz, con una regla vertical metálica de 1.5 m y una escuadra deslizable del mismo material, la condición corporal (CC) escala de 1 a 5, de acuerdo a Edmonson et al (9), la ganancia diaria de peso GDP (kg), consumo (g MS/kg PV0.75)y conversión alimenticia (CA), durante un período de 470 días. Los animales fueron desparasitados con ivermectina. A los tres meses de edad se aplicó la bacterina BrucelR RB51-PLUS contra brúcela y se reforzó la vacunación un mes después. Entre cuatro y cinco meses de edad se administró la vacuna contra complejo respiratorio (ExpressTM 10 HS), Pasterella (One-ShotTM) y Clostridium (BarvacTM)(10).

Procedures. Twenty-eight Holstein-Friesian calves were used with an initial average age of 80±16 days old and an average live weight of 79.5±12.9 kg. The body weight was measured every 30 days, the weighing of the heifers was carried out through the measurement of the thoracic perimeter with a tape in centimeters and the use of a live weight conversion table, the wither height was measured with a metallic vertical ruler of 1.5 m and a sliding set-square of the same material, body condition (BC) with a 1 to 5 scale according to Edmonson et al (9), daily weight gain DWG (kg), consumption (g MS/kg PV0.75) and feed conversion (FC), during a period of 470 days. Animals were treated with ivermectin. At three months of age the bacterin BrucelR RB51-PLUS for brucella was applied and the vaccination was strengthened one month later. Between four and five months old, a vaccine for bovine respiratory disease complex was administered (ExpressTM 10 HS), Pasterella (OneShotTM) and Clostridium (BarvacTM)(10).

Las becerras fueron manejadas en dos lotes distribuidas al azar; en donde se propuso una relación de forraje:suplemento (70:30), base seca y se ofertó un consumo a razón del 3% de su peso corporal en materia seca. El tratamiento testigo fue el sistema de alimentación tradicional del Rancho con base en ensilado de maíz (Zea mays), rastrojo de maíz, heno de pasto Rhodes (Chloris gayana), concentrado comercial al 16.5% de proteína mediante una ración integral y el experimental con ensilado de caña de azúcar (Saccharum officinarumm) y un suplemento activador del rumen (SAR; Tabla 1) de forma separada del forraje. A los alimentos utilizados se les analizó su composición

Heifers were handled in two lots distributed randomly; where a fodder:supplement ratio of (70:30) was proposed, dry base and a consumption rate of 3% of their body weight in dry base was suggested. The control treatment was the traditional feeding system of the Ranch based on corn silage (Zea mays), corn stover, Rhodes grass hay (Chloris gayana), commercial concentrate with 16.5% protein through a full portion and the experimental system with sugarcane silage (Saccharum officinarumm) and a supplement for the activation of rumen (SAR; Table 1) separately from the fodder. The foods used were analyzed for their chemical

3965

Reyes - Effect of sugarcane silage on productive parameters Table 1. Percentage composition of the supplement for the activation of rumen.

Ingredient Lime Cement Alfalfa meal Soy Ammonium sulfate Urea Cottonseed meal Cracked corn Molasses Fish meal Overweight fata Trace mineralsb Table salt EM (Mcal Kg MS-1) Enertrouw Brand;

% 4.40 1.10 14.90 9.90 0.40 4.40 5.02 17.20 21.10 4.10 11.00 4.40 1.70 2.60

Table 2. Chemical composition of the ingredients used in diets for the development of replacement Holstein-Friesian heifers. Component

a d

ECAa

EMb

SARc

CCd

RMe

H. Rhodes

28.37

28.00

90.00

88.00

94.00

92.50

8.73

8.54

27.20

16.50

4.50

2.70

NNP

1.13

0.99

2.96

0.80

FDN

61.63

67.25

---

76.00

82.39

FDA

57.32

---

6.09

47.25

43.17

---

51.02

4.07

4.50

---

EMf

2.04

2.30

2.50

1.90

1.80

Sugarcane silage; b Corn silage; c Supplement for the activation of rumen; Commercial concentrate; e Corn stover; f Metabolizing energy Mcal/kg

Zn, Ca, P, S, Cu, Co, I y Se

química de acuerdo a la AOAC (Tabla 2)(10). Para el cálculo de la energía metabolizable se utilizó la fórmula:

composition according to the AOAC (Table 2) (10). The following formula was used for the calculation of the metabolizing energy:

1.81+0.064×%Proteína Bruta=Mcal EM kg-1 MS (11).

1.81+0.064×%Gross Protein=Mcal EM kg-1 MS (11).

Análisis estadístico. Los datos obtenidos fueron analizados por medio de una prueba de T Student (12).

Statistical analysis. The obtained data were analyzed using the T Student test (12).

RESULTADOS

RESULTS

Los resultados obtenidos se muestran en la tabla 3. Se observó un mayor consumo en la estrategia de ensilado de maíz; sin embargo, la relación en el consumo de forraje-concentrado para el sistema con base en ensilado de caña de azúcar se mantuvo homogénea hasta el final del experimento.

The results obtained are shown in table 3. Higher consumption was observed with the corn silage strategy; however, the ratio in the consumption of fodder-concentrate for the system based on sugarcane silage remained homogenous until the end of the experiment.

Los animales jóvenes tuvieron un menor consumo del forraje, el cual se incrementó en la medida que el animal creció. La conversión alimenticia fue mejor para la estrategia de ensilado de caña; la evolución del consumo expresada en materia seca se observó un consumo inicial similar para los dos sistemas, pero a partir de los 200 días de edad se registró un mejor consumo en materia seca total para el sistema con ensilado de maíz, aunque esto no se vio reflejado en una GDP significativamente mayor, teniendo así mejor conversión alimenticia él ECA; demostrando con ello que su utilización puede ser más ventajosa que el EM. Los resultados reproductivos muestran una variación en cuanto al comportamiento productivo en relación a la estrategia productiva empleada según la etapa de desarrollo del ganado.

Young animals had a lower consumption of fodder, which increased as the animal grew. The feed conversion was better for the sugarcane silage strategy; the evolution of consumption expressed in dry base was observed as a similar initial consumption for the two systems, but after 200 days of age better consumption was recorded in total dry base for the corn silage system, although this was not reflected in a significantly higher DWG, thus the SCS having better feed conversion; thereby demonstrating that its use may be more advantageous than CS. Reproductive results show a variation in terms of productive behavior in relation to the productive strategy employed according to the development stage of cattle.

En la primera etapa que llega a los 350 días de edad, tanto el peso (p<0.035) como la condición corporal (p<0.001), tuvieron diferencia significativa, en estas variables, el sistema con ensilado de maíz resultó con mayores valores. Para la segunda etapa que termina a los 470 días de edad, en la condición corporal (p<0.01) se observó diferencia favorable

In the first stage that ends at 350 days of age, both the weight (p<0.035) and body condition (p<0.001) had significant differences in these variables, the corn silage system resulted in higher values. For the second stage ending at 470 days of age, a favorable difference in the body condition (p<0.01) was observed

3966

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

al sistema basado con ensilado de maíz, y en las demás variables no existió diferencia significativa. Los resultados de consumo de g MS/kg de peso metabólico, conversión alimenticia e índice de consumo en las dos etapas, se anotan en la tabla 3, sin diferencia (p>0.05) en la primera etapa para las tres variables. En la segunda etapa en las tres variables en estudio existió diferencia (p<0.01), con mayores valores para el consumo tanto en g MS/kg PV0.75 e índice de consumo; sin embargo, la mejor conversión alimenticia se obtuvo con el sistema de ensilado de caña. Con relación a las variables económicas, costo de alimentación/d y costo de alimentación/kg, fueron diferentes (p<0.001), observando que el sistema con ensilado de caña de azúcar, mostró los menores costos de alimentación en las dos etapas evaluadas, teniendo con ello que el uso de ECA puede tener los mismos parámetros que con el uso de EM, pero económicamente resulta más rentable.

in comparison to the corn silage system, and the other variables showed no significant difference. The results of consumption of g MS/kg of metabolic weight, feed conversion and consumption rate in the two stages, are shown in table 3, with no difference (p<0.05) in the first stage for the three variables. In the second stage there was a difference in the three variables under study (p<0.01), with higher values for consumption both in MS/kg PV0.75 and consumption rate; however, the best feed conversion was obtained with the sugarcane silage system. With regard to the economic variables, feeding cost/d and feeding cost/kg, these were different (p<0.001), noting that the sugarcane silage system showed the lowest feeding costs in the two stages evaluated, having as result that the use of SCS may have the same parameters as the use of CS, but it is more profitable economically.

Table 3. Average productive performance of different variables in Holstein-Friesian heifers in two feeding systems until puberty.

ECAa

EMb

EEMc

Initial weight (kg)

78.8

80.2

4.885

0.774

Final weight (kg)

249.7b

287.1a

16.786

0.350

88.3

87.5

1.526

0.593

117.3

120.8

1.871

0.078

Initial BC

2.9

2.3

0.068

0.862

Final BC

2.6b

3.4a

0.102

0.001

DWG (kg)

0.6

0.8

0.097

0.244

Weaning to puberty (80 to 350 days)

Initial height (cm) Height (cm)

Consumption g MS/kg PV

81.0

97.6

3.060

0.079

Feed conversion

6.2

6.8

0.205

0.086

Feeding cost/d*

0.63b

0.76a

0.217

0.001

Feeding cost/kg for weight gain*

0.99

1.04

0.793

0.103

0.75

Puberty to service (351 to 470 days) Initial weight (kg)

249.7b

287.1a

16.786

0.035

Final weight (kg)

337.9

366.5

20.154

0.168

Initial height (cm)

117.3

120.8

1.871

0.078

Height (cm)

126.6

128.5

1.878

0.308

Initial BC

2.6b

3.4a

0.102

0.001

Final BC

3.1b

3.7a

0.086

0.001

DWG (kg)

0.73

0.69

0.101

0.352

86.8b

108.7a

1.172

0.001

Feed conversion

8.7b

12.9a

0.161

0.001

Feeding cost/d

0.79b

0.99a

0.151

0.001

Feeding cost/kg for weight gain*

1.08b

1.43a

0.919

0.001

Consumption g MS/kg PV0.75

Sugarcane silage;

Corn silage;

Standard error of means; d Probability. * Expressed in US dollars.

Reyes - Effect of sugarcane silage on productive parameters

3967

DISCUSIÓN

DISCUSSION

La utilización de ensilado de caña más un suplemento estratégico hace posible obtener un esquema económicamente competitivo en el desarrollo de becerras como futuros reemplazos en la ganadería lechera, comparado con la alimentación tradicional de ensilado de maíz. Aún al considerar que al final de la observación (470 días), el sistema basado en ensilado de maíz fue superior en AC y CC, estos resultados pueden ser atribuidos a la calidad de la ración base, pues el valor de energía calculado para el ensilado de caña resulto inferior al compararlo con ensilado de maíz y con un mayor contenido de la fracción fibra detergente ácido, que haría menos disponible la fibra consumida, además de un mayor consumo, pues fue superior en 1.6 kg MS/d. Por otra parte, dada la perennidad y rendimiento de biomasa del cultivo de caña de azúcar permite incrementar el número de becerras a desarrollar con ensilado de caña.

The use of sugarcane silage plus a strategic supplement makes it possible to obtain an economically competitive scheme in the development of heifers as future replacements in dairy farming, when compared to the traditional feeding with corn silage. Even considering that at the end of the observation period (470 days), the corn silage system was superior in WH and BC, these results can be attributed to the quality of the base ration, since the energy value calculated for sugarcane silage was lower when compared with corn silage and with a higher content of the acid detergent fiber fraction, which would make the fiber consumed less available, in addition to increased consumption, as it was higher by 1.6 kg MS/d. On the other hand, given the durability and performance of the biomass of sugarcane crops it is possible to increase the number of heifers to be developed with sugarcane silage.

En el aspecto productivo ambas estrategias con ensilado se ubican en las recomendaciones de diferentes autores de no sobrepasar ganancias de peso de entre 0.700 a 0.800 kg/d en la etapa prepuber (1,13). Con ello se descarta el efecto negativo que en animales prepúberes pueden tener con altos niveles nutricionales sobre el desarrollo de la glándula mamaria (engrasamiento) y consecuentemente sobre la producción láctea (14,15). Sin embargo, con el ensilado de maíz la mejora en la condición corporal posiblemente se atribuya a un mayor engrasamiento, pues resultó en 27% superior al del sistema con ensilado de caña de azúcar y el tratamiento basado en ensilado de maíz fue superior a las recomendaciones de CC 2.4 a los siete meses de edad, de 2.8 a los 11 y 3.0 a los 16 meses, comparada con 2.9, 3.3 y 3.6 para el sistema basado en EM, y de 2.6, 2.6 y 3.1 para ECA respectivamente. En este contexto, puede explicarse que la energía suministrada en exceso de los requerimientos impactó mayoritariamente la condición corporal (16,17). Osnaya (18), reporta al trabajar en el desarrollo de reemplazos para ganado Holstein con tres estrategias de alimentación: pastoreo, pastoreo más suplementación y sistema intensivo, las GDP fueron de 0.508, 0.694 y 0.560 kg, respectivamente. En este sentido, cuando se compararon los resultados del sistema de ensilado de caña con trabajos de pasturas tropicales, resultaron con mayores ganancias a los indicados por Plaza et al (19), pues estos autores encontraron rangos de GDP de 0.496 a 0.563 kg/d para la época de lluvias y de 0.395 a 0.455 kg/d en la época seca, al utilizar pasto bermuda (Cynodon dactylon var. 68) con becerras Holstein de 90 días de edad y 88 kg de peso vivo de manera inicial. De forma parecida, el trabajo de

In the productive aspect, both silage strategies are within the recommendations of different authors of not exceeding weight gains from 0.700 to 0.800 kg/d in the prepubertal stage (1,13). This rules out the negative effect on prepubertal animals with high nutritional levels of the development of the mammary gland (greasing) and consequently on the milk production (14,15). However, the improvement in the body condition with corn silage could be possibly attributed to a higher greasing, which resulted 27% higher than the sugarcane silage system and the corn silage treatment was superior to the recommendations of a BC of 2.4 at seven months of age, of 2.8 at 11 months and 3.0 at 16 months, compared to 2.9, 3.3 and 3.6 for the CS system, and 2.6, 2.6 and 3.1 for SCS respectively. In this context, it can be explained that the energy supplied in excess of the requirements mainly impacted the body condition (16,17). Osnaya (18), reports that when working on the development of replacements for Holstein cattle with three feeding strategies: grazing, grazing plus supplementation and intensive system, DWG were 0.508, 0.694 and 0.560 kg, respectively. In this sense, when comparing the results of the sugarcane silage system with tropical pastures, these resulted in higher returns than those indicated by Plaza et al (19), as these authors found DWG ranges from 0.496 to 0.563 kg/d for the rainy season and from 0.395 to 0.455 kg/d during the dry season, when using bermuda grass (Cynodon dactylon var. 68) with Holstein heifers of 90 days of age and 88 kg of initial live weight. Similarly,

3968

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Zamora et al (20), en pastoreo de estrella (Cynodon nlemfuensis) y suplementación obtuvieron GDP de 0.584 kg/d en esta fase del desarrollo de becerras Holstein. Resultados superiores al de este trabajo encontraron Plazas y González (21) al comparar dos sistemas de crianza de becerras Holstein para reemplazo; estabulado y pastoreo desde el nacimiento hasta seis meses de edad, utilizando dos tratamientos de alimentación con base en pasto Kikuyo (Pennisetum clandestinim), ensilado de maíz y concentrado, y leche hasta los tres meses de edad, reportando valores de 1.004 y 0.974 kg/d.

the work of Zamora et al (20), in grazing (Cynodon nlemfuensis) and supplementation obtained a DWG of 0.584 kg/d in this stage of the development of Holstein heifers. Plazas and González (21) found results superior to this work when comparing two breeding systems for replacement Holstein heifers; feedlot and grazing from birth to six months of age, using two feeding treatments based on Kikuyu grass (Pennisetum clandestinim), corn silage and concentrate, and milk until three months of age, reporting values of 1.004 and 0.974 kg/d.

En este contexto, resulta atractiva la posibilidad de implementar la alimentación con ensilado de la caña en animales en crecimiento, puesto que tendría un mayor impacto en el periodo de sequía. Asimismo, el consumo de MS, resultó similar al reportado para vaquillas Holstein para diferentes pesos corporales (22). Por lo cual, una posibilidad de incrementar el consumo con este tipo de estrategias es a través de mejorar las características forrajeras de la caña o incrementar el aporte del suplemento.

In this context, the possibility of implementing sugarcane silage feeding in growing animals is attractive, since it would have a greater impact on the drought period. Likewise, the consumption of MS was similar to that reported for Holstein heifers with different body weights (22). Therefore, one possibility of increasing consumption with this type of strategy is through the improvement of the fodder characteristics of sugarcane or the increase of the contribution of the supplement.

El sistema con ECA, mostró ser más económica en el 13%, comparado con el sistema de EM, lo cual implica un ahorro en la alimentación y por consecuencia en la producción de vaquillas de remplazo, reduciendo los costos en 16.8% en la primera etapa (hasta antes del destete) y de hasta el 18% en la segunda etapa de este estudio, esto como resultado de emplear forrajes adaptados a las condiciones locales y con una alta productividad como es la caso del ensilado de caña de azúcar. En conclusión el sistema con base en ensilado de maíz produce una mayor condición corporal, relacionada con el engrasamiento; afectando con ello la eficiencia reproductiva. Se generó una alternativa de desarrollo de becerras HolsteinFriesian al utilizar un sistema basado en ensilado de caña de azúcar y un suplemento de consumo lento para obtener hembras de reemplazo desde el destete hasta gestación para la industria lechera.

The SCS system proved to be more economical in 13%, as compared with the CS system, which means savings in feeding and therefore in the production of replacement heifers, reducing costs in 16.8% in the first stage (prior to weaning) and up to 18% in the second phase of this study, this is the result of the use of fodder crops adapted to local conditions and with high productivity as it is the case of sugarcane silage. In conclusion the corn silage system produces a higher body condition, related to greasing, thereby affecting reproductive efficiency. An alternative for the development of HolsteinFri e si an he i fe rs was ge ne rate d usi ng a system based on sugarcane silage and slowconsumption supplement for replacement females from weaning until gestation for the dairy industry.

REFERENCES 1. Vetharaniam I, Davis SR, Upsdell M. Modeling the effect of energy status on mammary gland growth and lactation. J Dairy Sci 2003; 86:3148-3156.

Schingoethe DJ, García A. Alimentación y manejo de becerras y vaquillas lecheras. ExEx [en línea] 2004 [acceso 25 de julio de 2013]; ExEx4020S. URL disponible en: http:// pubstorage.sdstate.edu/AgBio_Publications/ articles/ExEx4020S.pdf.

Reyes - Effect of sugarcane silage on productive parameters

3969

3. Silveira PE, Franco FR. Conservación de forrajes: Segunda parte. REDVET [en línea] 2006; [acceso 25 de julio de 2013]; 7(11). URL disponible en: http://www.veterinaria. org/revistas/redvet/n111106/110605.pdf

14. Daniels KM, McGillard ML, Boyle PL, Meyer MJ, Van Amburgh ME, Capuco AV, et al. Effect of increasing energy and protein intake on mammary development in heifer calves. J Dairy Sci 2005; 88:595–603.

4. Santos MV, Gomez CA, Perea JP, García A, Guim A, Perez HM. Fatores que afetam o valor nutritivo da silagens de forrageiras tropicais. Arch Zootec 2010; 59:25-43.

15. Meyer MJ, Capuco AV, Ross DA, Lintault LM, Van Amburgh ME. Developmental and nutritional regulation of the prepubertal heifer mammary gland: I. Parenchyma and fat pad mass and composition. J Dairy Sci 2006; 89:4289–4297.

5. Martín PC. La alimentación del ganado vacuno con caña de azúcar y sus subproductos. La Habana, Cuba: EDICA (Editorial del Instituto de Ciencia Animal); 2004. 6. Juárez LF, Vilaboa AJ, Díaz RP. La caña de azúcar (Saccharum officinarum): una alternativa para la sustitución de maíz (Zea mays) en la alimentación de bovinos de engorda. Sitio Argentino de Producción Animal [en línea] 2009 [acceso 25 de julio de 2013]; URL disponible en: http://www. produccion-animal.com.ar/informacion_ tecnica/invernada_o_engorde_a_corral_o_ feedlot/69-cana_azucar.pdf 7.

Pardo NA. Manual de Nutrición Animal. Colombia: Editorial Grupo Latino; 2007.

8. Instituto Nacional de Estadística y Geografía (INEGI). Anuario estadístico del estado de Jalisco. México: [en línea] 2010. [fecha de acceso 20 de noviembre de 2013] URL disponible en: http://www3.inegi.org.mx/ sistemas/mexicocifras/default.aspx?e=14 9. Edmonson AJ, Lean IJ, Weaver LD, Farver T, Webster G. A body condition scoring chart for Holstein dairy cows. J Dairy Sci 1989; 72:68-78.

16. Pedroso AD, Nussio LG, Paziani SDF, Loures DRS, Igarasi MS, Coelho RM, et al. Fermentation and epiphytic microflora dynamics in sugar cane silage. Sci Agric 2005; 62:427-432. 17. Suksombat W, Junpanichcharoen P. Feeding of sugar cane silage to dairy cattle during the dry season. Asian-Aust J Anim Sci 2005; 18:1125-1129. 18. Osnaya GF. Efecto del sistema de pastoreo rotacional en la crianza de vaquillas HolsteinFriesian sobre la eficiencia reproductiva. [Tesis Doctoral]. Colima, México: Universidad de Colima; 2000. 19. Plaza J, Martínez X, Ybalmea R, Enriquez V. Vermisol o la urea para el control parasitario de terneras en pastos tropicales. Rev Cub Cienc Agric 2000; 34:293-297. 20. Zamora A, Plaza J, Lara A. Nota acerca de un sistema de alimentación y manejo de novillas lecheras. Rev Cub Cienc Agríc 2000; 34:119-123.

10. AOAC. Official Methods of Analysis (18th) Association of Official Analytical Chemists. Arligton (VA), Washington DC: AOAC; 2006.

21. Plazas R, y González M. Comparación de dos sistemas de cría de terneras Holstein, pastoreo y estabulación en la finca Villa María municipio Firavitoba – Boyacá. Conexión Agropecuaria 2012; 2:15-24.

11. Martín PC, Palma JM. Manual para fincas y ranchos ganaderos. Colima, México: AgroSystems Editing; 1999.

22. NRC. Nutrient Requirements of Dairy Cattle. 7th Revised Edition. Washington DC: National Academy Press; 2007.

12. SAS. User guide: statics. Versión 8.0 Edition. Cary (NC): SAS institute Inc; 2009. 13. Gabler MT, Heinrichs AJ. Dietary protein to metabolizable energy rations on feed efficiency and structural growth of prepubertal Holstein heifers. J Dairy Sci 2003; 86:268-274.

Rev.MVZ Córdoba 19(1):3970-3983, 2014. ISSN: 0122-0268 ORIGINAL

Risk factors for ovarian postpartum resumption in Holstein cows, under high tropical conditions Factores que afectan la reactivación ovárica postparto en vacas Holstein, en el trópico alto Humberto Guáqueta M,* MV, Jorge Zambrano V, Ph.D, Claudia Jiménez E, DVSc. Universidad Nacional de Colombia, School of Veterinary Medicine and Animal Husbandry, Department of Sciences for Animal Health, Animal Reproduction And Herd Health Research Group. Edificio 561B, Carrera 30 No. 45-03 Bogota, Colombia. *Correspondence: hguaquetam@unal.edu.co Received: April 2013; Accepted: November 2013.

ABSTRACT Objective. To evaluate the factors associated with postpartum ovarian resumption and follicular dynamics in Holstein cows under high altitude conditions (2,600 masl). Materials and methods. Forty-five Holstein cows were studied between 14 days before and 120 days after calving. Uterine involution, follicular dynamics, serum progesterone and peripartum pathologies were evaluated; additionally, body condition (BC), calving type, milk yield, were also evaluated. According to hormonal and reproductive findings, cows were classified into two groups: early ovarian resumption (EOR) or delayed ovarian resumption (DOR). Results. The occurrence of the first follicular for EOR animals (n=31) was produced on average 9.58±3.45 days postpartum and was similar to the DOR group (n=10) [10.8±4.83 days; p>0.05)]. The first postpartum ovulation occurred at 21.55±5.90 days (EOR) and was significantly delayed (48.7±27.85 days) for DOR animals (p<0.05). Thirty-six point five percent of the cows (n=f) had normal estrus cycles (18 to 24 days), while 63.5% (n=26) showed dysciclia. The factors associated with ovarian resumption and cyclicity were the loss of BC [OR=3.3, CI 95% (1.2-13.3) (p<0.05)] and lameness [OR= 9.0, CI 95% (1.2-13.3) (p<0.05)]. Conclusions. Although the emergence of postpartum follicular waves was observed early, under the experimental conditions of this study there are factors that may affect the first ovulation favoring the occurrence of anovulatory conditions. The determinant factors were low body condition and lameness. Key words: Anovulation, ovarian follicle, postpartum (Source: DeCS).

RESUMEN Objetivo. Evaluar los factores asociados con la reactivación ovárica y la dinámica folicular postparto en vacas de la raza Holstein bajo condiciones de altura (2600 msnm). Materiales y métodos. Cuarenta y cinco vacas Holstein fueron estudiadas entre 14 días preparto y 120 días posteriores al mismo. Fueron evaluadas la involución uterina, dinámica folicular, progesterona sérica y presentación de patologías en el periparto; adicionalmente la condición corporal (CC), tipo de parto y producción de leche. De acuerdo con los hallazgos reproductivos y hormonales, las vacas se agruparon en dos grupos: reactivación ovárica temprana (ROT) o retardada (ROR). Resultados. La emergencia de la primera onda folicular para animales ROT (n=31), ocurrió en promedio 9.58±3.45 días postparto y fue

3970

Guáqueta - Risk factors for avarian postpartum resumption in Holstein cows

3971

similar a los ROR (n=10) [10.8±4.83 días (p>0.05)]. La primera ovulación postparto se observó a los 21.55±5.90 días (ROT) y fue significativamente más demorada (48.7±27.85 días) para los animales ROR (p<0.05). El 36.5% de los animales (n=f) presentaron ciclos estrales normales (18 a 24 días), mientras que el 63.5% (n=26) mostraron disciclia. Los factores asociados con la reactivación ovárica y la ciclicidad fueron la pérdida de CC [OR= 3.3, IC 95% (1.2-13.3) (p<0.05)] y la presentación de cojeras [OR= 9.0, IC 95% (1.2-13.3) (p<0.05)]. Conclusiones. Aunque la emergencia de ondas foliculares postparto se presentó de manera rápida, bajo las condiciones experimentales del presente estudio, existen factores que afectan la primera ovulación favoreciendo la presentación de condiciones anovulatorias. La presentación de cojeras, y la pérdida de CC postparto fueron factores determinantes. Palabras clave: Anovulación, folículo ovárico, postparto (Fuente: DeCS).

INTRODUCCIÓN

INTRODUCTION

La eficiencia reproductiva es un reto para las ganaderías y los productores de leche en el mundo. Uno de los principales problemas en los hatos es el retraso en el reinicio de la actividad ovárica después del parto. Para obtener el intervalo entre partos (IEP) ideal de doce meses, los animales deben concebir dentro de los 85 días posteriores al parto, lo cual requiere que hayan normalizado su ciclicidad (1). Esto constituye un evento crítico para lograr un desempeño reproductivo eficiente y minimizar las pérdidas económicas representadas en el incremento en el número de días abiertos y servicios por concepción.

Reproductive efficiency is a challenge for breeders and milk producers around the world. One of the main problems for farms is the delay in the resumption of postpartum ovarian activity. To obtain the ideal interval between calving (IBC) of twelve months, animals must conceive within 85 days after partum, which requires the normalization of their cyclicity (1). This is a critical event for achieving efficient reproductive performance and minimizing economic losses represented in the increase in the number of open days and services per conception.

Los patrones de crecimiento y dinámica de los folículos han sido descritos ampliamente en bovinos postparto. Mientras que en algunos animales no se evidencia actividad ovárica normal (anestro), otros muestran ondas de desarrollo y crecimiento de folículos que no son ovulados, generando diferentes tipos de anestro (2,3).

Growth patterns and follicle dynamics have been widely described in postpartum bovines. While some animals did not show normal ovarian activity (anestrus), others show development and growth waves of follicles that are not ovulated, generating different types of anoestrus (2,3).

Algunos autores han descrito la emergencia de la primera onda (4,5); otros, han determinado el diámetro y tamaño de las estructuras ováricas con respecto a la fase de desarrollo de la misma (6). También se han investigado los efectos que tienen la presentación de patologías frecuentes en bovinos de leche (mastitis, retención de membranas fetales, metritis, hipocalcemia puerperal, cetosis y cojeras) durante el postparto sobre la dinámica ovárica y la fertilidad, reportándose relaciones importantes entre la presentación de dichas patologías y el pobre desempeño reproductivo (7-9).

Some authors have described the emergence of the first wave (4,5); others have determined the diameter and size of the ovarian structures with respect to the development phase of the same (6). The effects of common pathologies in dairy bovines have also been investigated (mastitis, retention of fetal membranes, metritis, puerperal hypocalcemia, ketosis and lameness,) on ovarian dynamics and fertility during postpartum, reporting important relationships between the occurrence of such pathologies and poor reproductive performance (7-9).

En Colombia se han realizado algunas investigaciones referentes a la dinámica folicular y reactivación ovárica postparto, aunque la mayoría de ellas han sido principalmente con animales Bos indicus (10,11). Son escasos en el país los trabajos orientados a caracterizar la dinámica folicular y ovárica durante el postparto en bovinos Holstein de alta producción y selección genética (12,13).

In Colombia there have been some investigations relating to follicular dynamics and postpartum ovarian resumption, although most of them have been mainly with Bos indicus animals (10,11). The studies conducted in the country for characterizing follicular and ovarian dynamics during postpartum in high yield Holstein bovines and genetic selection are scarce (12,13).

3972

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Los objetivos del presente estudio fueron evaluar de manera prospectiva algunos de los factores asociados con la reactivación ovárica postparto en un hato especializado de vacas de la raza Holstein, bajo condiciones de trópico alto y caracterizar los patrones de reactivación ovárica y la dinámica folicular postparto.

MATERIALES Y MÉTODOS Sitio de estudio y animales. El estudio se realizó en una explotación lechera de la Sabana de Bogotá, a una altura de 2565 msnm., con precipitación anual de 698 mm y temperatura promedio de 14°C, que corresponde a una región del trópico situada a más de 2000 msnm, con temperaturas bajas y cambios significativos entre el día y la noche (14). En un hato de 230 animales de Holstein bajo un sistema de pastoreo rotacional kikuyo (Pennisetum clandestinum) y ryegrass (Lollium multiflorum), suplementados con concentrado y sales minerales comerciales y ordeñados dos veces al día. Del total de animales (n=230) se escogió una muestra de 45, los cuales fueron evaluados por primera vez dos semanas antes del parto, registrándose su estado general de salud y condición corporal; también se llevó un registro de todos los eventos de salud y tipo de parto. A partir de ese momento, fueron objeto de un examen clínico-reproductivo cada tercer día, hasta el momento en que recibieron su primera inseminación postparto o hasta que completaron 120 días del parto. Condición corporal. La condición corporal (CC) fue evaluada durante todo el periodo del estudio utilizando una escala de 1-5 (1=delgada, 5=obesa) (15). Los días más importantes usados en el analisis de la CC fueron, dos semanas antes de la fecha esperada de parto y los días 30 y 60 postparto (2).

The objectives of this study were to prospectively evaluate some of the factors associated with postpartum ovarian resumption in a specialized Holstein cow farm, under high tropical conditions and characterize postpartum ovarian resumption patterns and follicular dynamics.

MATERIALS AND METHODS Study site and animals. The study was conducted in a dairy farm in the Sabana de Bogota, at a height of 2565 meters, with annual rainfall of 698 mm and average temperature of 14°C, which corresponds to a region of the tropics located above 2,000 masl, with low temperatures and significant changes between day and night (14). In a farm of 230 Holstein cows under a kikuyo (Pennisetum clandestinum) and ryegrass (Lollium multiflorum) rotational grazing system, supplemented with concentrate and commercial mineral salts and milked twice a day. Of the total number of animals (n=230) a sample of 45 was chosen, which were evaluated for the first time two weeks before partum, recording their general health and body condition; a record of all health events and type of calving was also made. From that moment, they were subject to clinicalreproduction examination every other day, until they received their first postpartum insemination or until 120 days from calving have been completed. Body condition. The body condition (BC) was assessed during the entire period of the study using a scale from 1 to 5 (1=thin, 5=obese) (15). The most important days used in the BC analysis were two weeks before the expected date of partum and day 30 and 60 postpartum (2).

Producción de leche. La producción de leche fue registrada por medio de los medidores del equipo de ordeño (Westfalia-Surge ® , mini True-test® Wellington, New Zealand). La información pertinente al monitoreo productivo y reproductivo del hato fue almacenada en el software Interherd®, Versión 2-10-10, de InterAgri-Animal Information Management Systems Limited, UK. (Pan Livestock Services). Se recolectaron los datos correspondientes al promedio diario de producción de leche al día 28 y 60 post-parto; así como la producción final ajustada a 305 días para cada uno de los animales.

Milk production. Milk production was recorded using the gauges of the milking equipment (Westfalia-Surge®, mini True-test® Wellington, New Zealand). The information relevant to the productive and reproductive monitoring of the farm was stored in the Interherd ® software, Version 2-10-10, of InterAgri-Animal Information Management Systems Limited, UK. (Pan Livestock Services). The data corresponding to the daily average of milk production at day 28 and 60 postpartum was collected; as well as the final production adjusted to 305 days for each animal.

Dinámica folicular y seguimiento de la ovulación. Con el fin de agrupar los animales con relación al momento de la reactivación ovárica, se utilizó el promedio general y la desviación estándar

Follicular dynamics and ovulation monitoring. In order to group animals in relation to the time of ovarian resumption, the general average and standard deviation

Guáqueta - Risk factors for avarian postpartum resumption in Holstein cows

3973

(32 ± DE) de los días a la primera ovulación postparto. Este dato se utilizó como punto de corte para agrupar los animales en dos categorías: aquellos con reactivación ovárica temprana y ovulación antes del día 32 (ROT); y aquellos con reactivación ovárica retardada (ROR) ya que su ocurrencia sucedió posterior al día 32 postparto. La duración del ciclo estral, posterior a la primera ovulación, fue considerada como normal cuando los ciclos tuvieron una duración entre 18 y 24 días, o alterada (disciclia) cuando los intervalos entre dos estros consecutivos fueron menores a 17 o mayores de 25 días (3, 6). El reinicio de la actividad ovárica fue determinado por la emergencia de la primera onda folicular post parto (folículos con diámetros ≥ 5 mm); los folículos dominantes fueron seguidos por ultrasonido hasta cuando presentaron atresia u ovulación. La ovulación fue definida como la desaparición del folículo preovulatorio procedente de la última onda de desarrollo folicular y la subsiguiente aparición de un cuerpo lúteo (CL) (16), así como el incremento en los niveles de progesterona (P4) sérica ≥1 ng/ml (17).

(32±DE) of the days of the first postpartum ovulation was used. This data was used as a cutoff point for grouping animals into two categories: those with early ovarian resumption and ovulation before day 32 (EOR); and those with delayed ovarian resumption (DOR) since its occurrence happened after day 32 postpartum. The duration of the estrous cycle after the first ovulation was considered normal when cycles lasted between 18 and 24, or altered (dysciclia) when the interval between two consecutive estrous were less than 17 or greater than 25 days (3,6). The resumption of ovarian activity was determined by the emergence of the first postpartum follicular wave (follicles with diameters ≥ 5 mm); dominant follicles were followed with ultrasound until atresia or ovulation. Ovulation was defined as the disappearance of the preovulatory follicle from the last follicular d e ve l o p m e n t wave a n d t h e s u b s e q u e n t emergence of a corpus luteum (CL) (16), as well as the increase in serum progesterone (P4) levels ≥ 1 ng/ml (17).

El seguimiento clínico reproductivo se llevó a cabo mediante palpación rectal y ultrasonografía cada tercer día; éstas fueron realizadas con un equipo portátil (Agroscan-L ® ECM, France) equipado con transductor lineal de 5.0 MHz. Todos los folículos ≥5 mm., así como las estructuras luteales fueron registrados en mapas ováricos, adaptados de acuerdo con la metodología descrita en trabajos previos (4,5) y algunos modelos sugeridos (18). El tamaño de los folículos y cuerpos lúteos con diámetros mayores de 5 mm fue registrado de acuerdo con las metodologías descritas en estudios similares (19-21). Las estructuras ováricas observadas desde una sola imagen congelada fueron medidas cuando se visualizó el área máxima aparente en cada una de ellas. El volumen del cuerpo lúteo (VCL) se calculó por medio de la fórmula VCL=4/3 x π x r³, donde el radio (r) fue calculado con la fórmula r=(L/2+A/2)/2 (21). La actividad luteal fue evidenciada por la observación de dos muestras consecutivas de progesterona sérica con concentraciones superiores a 1 ng/ml (20-22). Los datos obtenidos fueron normalizados con relación al momento de la primera ovulación post parto. El anestro fue definido como la ausencia de actividad luteal después de haber realizado el seguimiento ultrasonográfico y confirmado por los niveles basales de progesterona en sangre (<1 ng /ml) y ausencia de cuerpo lúteo (6, 23).

The monitoring of the reproductive clinical was carried out by rectal palpation and ultrasonography every other day; these were performed with a portable equipment (Agroscan-L® ECM, France) equipped with a 5.0 MHz linear transducer. All follicles ≥5 mm as well as luteal structures were recorded in ovarian maps, adapted in accordance with the methodology described in previous studies (4.5) and some suggested models (18). The size of follicles and corpus luteum with diameters larger than 5 mm was recorded in accordance with the methodologies described in similar studies (19-21). Ovarian structures observed from a single frozen image were measured when the maximum apparent area in each of them was visualized. The volume of the corpus luteum (VCL) was calculated using the formula VCL=4/3 x π x r³, where the radius (r) was calculated with the r=(L/2+A/2)/2 (21). Luteal activity was evidenced by the observation of two consecutive samples of serum progesterone with concentrations higher than 1 ng/ml (20-22). Data was normalized with respect to the time of the first postpartum ovulation. Anestrus was defined as the absence of luteal activity after ultrasound and confirmed by basal progesterone levels in blood (<1 ng/ml) and absence of corpus luteum (6,23).

Muestras de sangre y orina. Durante las evaluaciones se recolectaron muestras de sangre por punción de la vena coccígea, utilizando tubos al vacío sin anticoagulante (Vacutainer®,

Blood and urine samples. During the evaluations, blood samples were collected by puncturing the coccygeal vein, using vacuum tubes without anticoagulant (Vacutainer ® , Becton-Dickinson, Rutherford, NJ, USA).

3974

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Becton-Dickinson, Rutherford, NJ, USA). Una vez colectadas fueron refrigeradas y transportadas hasta el laboratorio donde se centrifugaron a 3000 rpm durante 20 minutos para separar el suero, que fue fraccionado y almacenado en tubos Eppendorf a -70°C hasta realizar la medición de las concentraciones de calcio y progesterona.

Once collected, they were refrigerated and transported to the laboratory where they were centrifuged at 3000 rpm for 20 minutes to separate the serum, which was fractioned and stored in Eppendorf tubes at -70°C until the measurement of calcium and progesterone concentrations.

Durante la primera y segunda semana postparto se colectaron dos muestras de orina con intervalos de siete días entre ellas, con el fin de determinar los niveles de cuerpos cetónicos por medio de tiras reactivas (Bayer, Reagent strips for Urianalysis: Multistix® 10SG. Siemens Healthcare Diagnostics Inc. Los Angeles, CA 90045 USA).

During the first and second week postpartum, two urine samples were collected with intervals of seven days between them, in order to determine the levels of ketones using reagent strips (Bayer, Reagent strips for Urianalysis: Multistix® 10SG. Siemens Healthcare Diagnostics Inc. Los Angeles, CA 90045 USA).

Medición de progesterona sérica. La medición de los niveles séricos de progesterona se realizó por la técnica de radioinmunoanálisis en fase sólida (RIA), utilizando los kits Coat-A-Count Progesterone® (Siemens Healthcare Diagnostics Inc. Los Angeles, CA 90045 USA), con una sensibilidad analítica de 0.02 ng/ml. y una reactividad cruzada del 100% para P4 pero muy baja con otros esteroides de producción natural o medicamentos presentes en la muestra. Las concentraciones de progesterona fueron medidas en alícuotas separadas según los procedimientos sugeridos por los productores del kit, en el Laboratorio de hormonas de la Facultad de Medicina Veterinaria y de Zootecnia de la Universidad Nacional de Colombia. Los resultados obtenidos fueron impresos, expresados en niveles de radiactividad, por lo que posteriormente debieron ser transcritos al software RIAPC® para permitir su cuantificación en nanogramos por mililitro (ng/ml). Los Coeficientes de variación intra-ensayo e interensayo fueron de 7.8% y 4.7% respectivamente.

Serum progesterone measurement. The measurement of serum progesterone levels was carried out through the solid-phase radioimmunoassay technique (RIA), using the kits Coat-A-Count Progesterone ® (Siemens Healthcare Diagnostics Inc. Los Angeles, CA 90045 USA), with an analytical sensitivity of 0.02 ng/ml. and cross reactivity of 100% for P4 but very low with other naturally produced steroids or drugs present in the sample. Progesterone concentrations were measured in aliquots separated according to the procedures suggested by the producers of the kit, in the hormone laboratory of the Faculty of Veterinary Medicine and Animal Husbandry of Universidad Nacional de Colombia. The results were printed, expressed in radioactivity levels, so they had to be subsequently transcribed to the RIAPC® software to allow their quantification in nanograms per milliliter (ng/ml). Intra-assay and inter-assay variation coefficients were 7.8% and 4.7%, respectively.

Detección de estros e inseminación artificial. La detección de estros se realizó por el método de observación visual, tres veces al día, en períodos de al menos 15 minutos cada uno, donde se registró cualquier actividad de monta o intentos de la misma, así como alguno de los signos del estro (descargas vaginales o presencia de moco, olfateo y seguimiento de otras vacas). El estro fue definido como la permanencia de un animal para ser montado por otro durante algunos segundos, conducta denominada monta estática (24). El período de espera voluntario (PEV) establecido en la finca fue de 50 días. Todos los animales que cumplían con el PEV habiendo aprobado las evaluaciones reproductivas previas, fueron inseminados una vez detectados en estro, de acuerdo con el sistema am/pm (24,25). Descripción de las variables. Las variables se categorizaron de la siguiente manera: 1) condición corporal (CC) pre y postparto (escala de 1-5); 2) concentración sérica de calcio pre y postparto

Detection of estrus and artificial insemination. The detection of estrus was performed through the visual observation method, three times a day, in periods of at least 15 minutes each, where any breeding activity of or attempts thereof were registered, as well as some of the signs of estrus (vaginal discharges or presence of mucus, sniffing and following of other cows). Estrus was defined as the permanence of an animal to be mounted by another for a few seconds a conduct known as static breeding (24). The voluntary waiting period (VWP) established in the farm was 50 days. All animals that met the VWP, having approved the previous reproductive assessments, were inseminated once detected in estrus, in accordance with the am/pm system (24,25). Description of variables. Variables were categorized as follows: 1) body condition (BC) before and after partum (1-5 scale); 2) calcium

Guáqueta - Risk factors for avarian postpartum resumption in Holstein cows (mg/dL), 3) tipo de parto (normal o distócico); 4) número de partos (primer y segundo parto contra animales de tercer o más partos); 5) diámetro de las estructuras ováricas (folículos ≥ 5mm y cuerpos lúteos (mm); 6) diámetro de de los cuernos a nivel de la bifurcación (mm); 7) producción diaria de leche (Kg/leche/vaca/día); 8) presentación de enfermedades puerperales: hipocalcemia, cetosis, retención de placenta, metritis puerperal, mastitis, quistes ováricos, cojeras, y fiebre; 9) aplicación de tratamientos post-parto 10) concentraciones séricas de progesterona (ng/ml en sangre) y 11) días a la primera ovulación postparto. Análisis estadístico. La información obtenida en los exámenes ultrasonográficos de los ovarios y las concentraciones séricas de progesterona fueron analizadas inicialmente realizando estadística descriptiva, comparación de promedios y estableciendo diferencias entre los grupos de animales. Los datos fueron normalizados con relación al momento de la ovulación y posteriormente analizados utilizando el Modelo General Lineal de medidas repetidas. El análisis de los factores asociados con la reactivación ovárica postparto como CC, calcio sérico, tipo de parto, número de partos, presentación de enfermedades metabólicas periparto (hipocalcemia o cetosis), presentación de patologías y la producción de leche se llevó a cabo primero a través de un análisis univariado con tablas de contingencia de 2x2; luego se seleccionaron las variables que resultaron significativas a través de la prueba de Chi cuadrado (p<0.05), dichas variables fueron incluidas en un modelo final de Regresión Logística Binaria para determinar las variables asociadas con la primera ovulación postparto. La fortaleza de la asociación se estimó a través del cálculo del Odds Ratio (OR) con su respectivo intervalo de confianza del 95%. Todo valor p<0.05 fue considerado significativo. Los análisis estadísticos fueron realizados por medio del software SPSS® versión 17.0.

RESULTADOS

3975

serum concentration before and after partum (mg/dL), 3) calving type (normal or dystocias); 4) number of births (first and second birth versus animals with three or more births); 5) diameter of ovarian structures (follicles ≥ 5mm and corpora lutea (mm), 6) diameter of horns at the fork (mm); (7) daily milk production (Kg/milk/cow/day); 8) occurrence of puerperal disease: hypocalcemia, ketosis, retained placenta, puerperal metritis, mastitis, ovarian cysts, lameness and fever; 9) application of postpartum treatments; 10) serum progesterone concentrations (ng/ml in blood); and 11) days to the first postpartum ovulation. Statistical analysis. The information obtained from the ultrasound tests of ovaries and serum progesterone concentrations were initially analyzed by descriptive statistics, comparison of averages and establishing differences between the animal groups. The data was normalized with respect to the time of ovulation and subsequently analyzed using the repeated measures General Linear Model. The analysis of the factors associated with postpartum ovarian resumption such as CC, serum calcium, calving type, number of births, peripartum metabolic diseases (hypocalcemia or ketosis), pathologies and milk production, was first carried out through a univariate analysis with 2 x 2 contingency tables; then the variables that were significant according to the Chi square test (p<0.05) were selected, these variables were included in a final Binary Logistic Regression model to determine the variables associated with the first postpartum ovulation. The strength of the association was estimated by calculating the Odds Ratio (OR) with its respective 95% confidence interval. Every p<0.05 value was considered significant. Statistical analyses were performed using SPSS® software version 17.0.

RESULTS

Dinámica folicular y primera ovulación postparto. La emergencia de la primera onda folicular postparto se observó en promedio al día 10.1±3.45. El 39% de los animales (n=16) presentó dicha emergencia entre los días 4 y 8 postparto, mientras que en el 46.3% (n= 19) se observó entre los días 9 y 13, y en el 14.6% (n=6) sucedió entre el día 14-20. Todos los animales reiniciaron su dinámica folicular antes del día 20 postparto.

Follicular dynamics and first postpartum ovulation. The emergence of the first postpartum follicular wave was observed on average on day 10.1±3.45. Thirty-nine percent of animals (n=16) showed such emergence between days 4 and 8 postpartum, while in 46.3% (n=19) it was observed between days 9 and 13, and in 14.6% (n=6) it took place between day 14-20. All the animals resumed their follicular dynamics before day 20 postpartum.

El promedio de días a la primera ovulación fue de 24.26±7.84 (rango de 13-41). Con fines del

The average number of days to the first ovulation was 24.26±7.84 (range from 13 to 41). For

3976

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

análisis estadístico y con base en este promedio más una desviación estándar, se definió el día 32 como promedio de días a la primera ovulación postparto, el cual fue utilizado como punto de corte para definir dos categorías: Los animales ROT (n=31) y los animales ROR (n=10), (Tabla 1).

statistical analysis purposes and based on this average plus one standard deviation, day 32 was defined as the average number of days to the first postpartum ovulation, which was used as a cutoff point for defining two categories: EOR animals (n=31) and DOR animals (n=10), (Table 1).

En general, el intervalo entre el parto y la primera ovulación, y el parto y las ovulaciones siguientes (segunda, tercera y cuarta) entre los individuos ROT y ROR fueron estadísticamente diferentes (p<0.05). Sin embargo, no se observaron diferencias significativas en cuanto a los intervalos entre dos ovulaciones consecutivas (interovulatorios) entre los animales con ROT y ROR (p>0.05). Los individuos del grupo ROT presentaron menor diámetro del folículo ovulatorio tanto en el primero como en los cuatro ciclos subsiguientes (18.07±5.0 mm, 21±4.4 mm, 21.8±3.2 mm y 21.9±3.2 mm), comparados con los del grupo ROR durante los mismos períodos (23.1±5.2 mm, 23.8±5.9 mm, 24.8±8.8 mm y 35.4±10.4 mm). Esta diferencia en el diámetro del folículo ovulatorio no fue significativa al momento de la primera ovulación posparto, pero si en las tres ovulaciones sub-siguientes (p≤0.05).

Overall, the interval between calving and the first ovulation, and calving and the following ovulation (second, third and fourth) between EOR and DOR individuals, were statistically different (p<0.05). However, there were no significant differences in the interval between two consecutive ovulations (interovulatory) between animals with EOR and DOR (p>0.05). Individuals in the EOR group had a smaller ovulatory follicle diameter both in the first as in the subsequent four cycles (18.07±5.0 mm, 21±4.4 mm, 21.8±3.2 mm and 21.9±3.2 mm), when compared with those of the DOR group during the same periods (23.1±5.2 mm, 23.8±5.9 mm, 24.8±8.8 mm and 35.4±10.4 mm). This difference in ovulatory follicle diameter was not significant at the time of the first postpartum ovulation, but it did in the three subsequent ovulations (p≤0.05).

De un total de 146 ovulaciones registradas por ultrasonido, solamente se visualizaron 53 estros, lo cual corresponde a un porcentaje de detección de 36%.

Of a total of 146 ovulations recorded with ultrasound only 53 estrus were visualized, which corresponds to a detection percentage of 36%.

Actividad ovárica post-ovulación. Un total de veintisiete animales (65.9%) mostraron ciclicidad normal después de la primera ovulación postparto con presentación de ciclos estrales de 18-24 días de duración, mientras que el (34.16%), (n=14) se mostraron acíclicos durante los primeros 67 días, incluyendo anovulación por condiciones quísticas ováricas (n=2), anovulación por CL persistente (n=8) y desarrollo folicular con incapacidad para alcanzar un diámetro ovulatorio (n=4).

Post-ovulation ovarian activity. A total of twenty-seven animals (65.9%) showed normal cyclicity after the first postpartum ovulation with estrus cycles of 18-24 days, while 34.16% (n=14) were acyclic during the first 67 days, including anovulation by ovarian cystic conditions (n=2), Anovulation by persistent CL (n=8) and follicular development with inability to achieve ovulatory diameter (n=4).

Table 1. Differences in postpartum follicular dynamics in Holstein cows that showed Early Ovarian Resumption (EOR) as compared to those that showed Delayed Ovarian Resumption (DOR) in the high tropics (Sabana de Bogota). Variable Detection of first follicles ≥4mm (days)

EOR

DOR

Average ±SEM

Value P

9.58 ±0.6

10.8 ±1.5

0.3 b 0.01 a

First postpartum ovulation (days)

21.55 ±1.1

48.7 ±8.8

Ovulatory follicle diameter (mm)

18.07 ±0.9

23.18 ±1.7

0.5

Second postpartum ovulation (days)

47.19 ±3.7

69.8 ±9.1

0.01

Interval between 1st and 2nd ovulation (days)

25.65 ±3.3

21.1 ±0.7

0.4

Ovulatory follicle diameter (mm)

21 ±0.8

23.81 ±1.9

0.02

Third postpartum ovulation (days)

67 ±4.1

93.14 ±13.3

0.01

Interval between 2nd and 3rd ovulation (days)

20 ±1.1

21.43 ±1.0

0.5

Ovulatory follicle diameter (mm)

21.81 ±0.6

24.8 ±3.4

0.03

Fourth postpartum ovulation (days)

79.88 ±3.2

104.67 ±8.1

0.05

Interval between 3 and 4 ovulation (days)

20.69 ±1.1

22 ±5.1

0.7

Ovulatory follicle diameter (mm)

21.98 ±0.9

35.4 ±7.4

0.05

b a b a a b a a b a

Average ± SEM values reported; Values for p<0.05 were considered statistically significant; EOR= Early Ovarian Resumption (First Ovulation < 32 d); DOR= Delayed Ovarian Resumption (First Ovulation > 32 d)

Guáqueta - Risk factors for avarian postpartum resumption in Holstein cows Volumen del CL y niveles de P4 sérica. No se observaron diferencias estadísticas en las concentraciones séricas de P4 entre los animales del grupo ROT comparados con aquellos del grupo ROR, durante los 15 días posteriores a su primera ovulación post parto (p>0.05); sin embargo, éste último grupo se caracterizó por la presentación de fases luteales prolongadas (niveles sostenidos de P4≥1 ng/ml) por períodos comprendidos entre 24 y 32 días (Figura 1). El volumen máximo del CL fue de 5.000±400 mm³ entre los días 12 y 16 del ciclo siguiente a la primera ovulación post parto en los animales ROT. Los animales ROR presentaron CL con duración prolongada, cuyo máximo volumen fue 8.000 ± 400 mm³ y el cual se mantuvo por más de 30 días posteriores a la primera ovulación (p<0.05) (Figura 2).

3977

CL volume y and serum P4 levels. There were no statistical differences in serum P 4 concentrations amid animals in the EOR group as compared with those of the DOR group, during the 15 days following their first postpartum ovulation (p>0.05); however, the latter group was characterized by prolonged luteal phases (sustained levels of P4≥1 ng/ml) for periods between 24 and 32 days (Figure 1). The maximum CL volume was 5.000 ± 400 mm³ between days 12 and 16 of the cycle following the first postpartum ovulation in EOR animals. DOR animals showed CL with prolonged duration, the maximum volume of which was 8.000 ± 400 mm³ and remained for more than 30 days after the first ovulation (p<0.05) (Figure 2).

No hubo diferencias estadísticas en la CC preparto entre el grupo ROT (3.3±0.19) y ROR (3.2±0.27) (p>0.05); sin embargo se observaron diferencias entre ellos durante el posparto. Los animales ROR perdieron más CC (2.3±0.24) que los animales ROT (2.5±0.15) cuando la evaluación se hizo al día 28 (p≤0.05); aunque al día 60 postparto ya no se

There were no statistical differences in the prepartum BC in the EOR (3.3±0.19) and DOR group (3.2±0.27) (p>0.05); however, differences between them during postpartum were observed. DOR animals lost more BC (2.3±0.24) than EOR animals (2.5±0.15) when the evaluation was carried out on day

Volumen mm3

Body condition. A decrease in the body condition (BC) of all animals in the study was observed during the first 60 dpp. The prepartum BC averaged 3.3±0.22 (range from 2.9 to 3.7), while the averages on days 28 and 60 postpartum were [2.5±0.18 (range from 1.9 to 2.9) and 2.4±0.24 (range from 1.8 to 2.8), (p<0.05)].

Serum progesterone concentrations (ng/ml)

Condición corporal. Se observó una disminución en la condición corporal (CC) en todos los animales del estudio durante los primeros 60 dpp. El promedio de la CC preparto fue de 3.3±0.22 (rango de 2.9 -3.7), mientras que los promedios en los días 28 y 60 post parto fueron de [2.5±0.18 (rango de 1.9-2.9) y 2.4±0.24 (rango de 1.8-2.8), (p<0.05)].

EOR DOR

Days after the first postpartum ovulation

Figure 1. Serum progesterone levels in Holstein cows with early ovarian resumption a c t i v i ty ( E O R ) r e s t a r t a n d d e l aye d ovarian resumption activity (DOR), after the first postpartum ovulation. Serum progesterone concentrations (ng/ml), ± EEP, in animals with EOR (n=31) and DOR (n=10). Data were normalized from the first postpartum ovulation.

EOR

DOR

Days after the first postpartum ovulation

Figure 2. Differences in the average volume of the corpus luteum (mm³) after the first postpartum ovulation in Holstein cows under high tropical conditions. Average volumes of corpus luteum (mm³), ± EEP, in animals with early ovarian resumption activity, EOR (n=31) and delayed ovarian resumption activity, DOR (n=10). Data were normalized from the first postpartum ovulation.

3978

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

detectó esta diferencia, ROT (2.3±0.18) vs. ROR (2.2±0.19) (p>0.05). Producción de leche. El promedio de producción de leche al día 28, en los animales ROT fue de 32.65±6.1 litros, similar al de los animales ROR, que tuvieron un promedio de 33.30±5.6 litros (p>0.05). Los promedios de producción al día 60 fueron de 36.61±6.9 y 35.50±4.6 litros para los animales del grupo ROT y ROR respectivamente (p>0.05). Tampoco se observaron diferencias significativas en las lactancias ajustadas a 305 días para los animales del grupo ROT (8404.9±1619 litros) frente al grupo ROR (8282.4±1535 litros) (p>0.05). Factores asociados a la primera ovulación post-parto. La prevalencia observada de las patologías asociadas con el periparto fue la siguiente: 34.1% de los animales presentó fiebre durante su primera semana postparto (n=14); 19.5% hipocalcemia clínica (vacas caídas) (n=8); 58.5% hipocalcemia subclínica (n=24); 26.8% distocia (n=11); 24.3% retención de placenta (n=10); 14.6% metritis puerperal (n=6); 36.5% endometritis (n=15); 29.2% quistosis ovárica (n=12); 34.1% mastitis (n=14) y 21.9% cojera (n=9). El análisis univariado mostró que la presentación de fiebre durante la primera semana postparto, bajos niveles de calcio sérico durante el mismo período, presentación de enfermedades metabólicas (hipocalcemia o cetosis), aplicación de tratamientos posteriores al parto, presentación de otras patologías del puerperio como retención de membranas fetales, metritis puerperal, mastitis, o quistes ováricos, no estuvieron estadísticamente asociados con la presentación de la primera ovulación postparto y posterior reinicio de la ciclicidad (p>0.05). Asimismo, la presentación de cetosis fue excluida tanto en el análisis univariado, como del multivariado, debido a que ninguno de los animales arrojó resultados positivos a ella. En segundo lugar se observó que la presentación de distocia (OR 2.2; IC 0.5-10.5; p<0.5), la disminución de la CC (<2.5) (OR 3.3; IC 1.1-13.8; p<0.05) y la presencia de cojeras (OR10.3; IC 1.292.2; p<0.05) fueron factores asociados con el retraso en la presentación de la primera ovulación postparto (Tabla 2). El modelo final del análisis multivariado de regresión logística binaria, determinó que los factores de riesgo asociados al retardo de la primera ovulación postparto fueron, la pérdida de condición corporal hasta alcanzar un puntaje inferior a 2.5 (OR=3.3, IC 95% (1.2-13.3) (p<0.05) y la presentación de cojeras (OR=9.0, IC 95% (1.2-13.3) (p<0.05). (Tabla 3).

28 (p≤0.05); although by day 60 postpartum this difference was no longer detected, EOR (2.3±0.18) vs. DOR (2.2±0.19) (p>0.05). Milk production. Milk production on day 28 in EOR animals averaged 32.65±6.1 liters, similar to DOR animals that averaged 33.30±5.6 liters (p>0.05). Production averages on day 60 were 36.61±6.9 and 35.50±4.6 liters for animals of the EOR and DOR group respectively (p>0.05). There were no significant differences in lactations adjusted to 305 days for animals of the EOR group (8.404.9±1.619 liters) as compared with the DOR group (8.282.4±1.535 liters) (p>0.05). Factors associated with the first postpartum ovulation. The prevalence observed of pathologies associated with peripartum was as follows: 34.1% of animals had fever during their first postpartum week (n=14); 19.5% showed clinical hypocalcaemia (down cows) (n=8); 58.5% subclinical hypocalcemia (n=24); 26.8% dystocia (n=11); 24.3% retained placenta (n=10); 14.6% puerperal metritis (n=6); 36.5% endometritis (n=15); 29.2% ovarian cystosis (n=12); 34.1% mastitis (n=14) and 21.9% lameness (n=9). The univariate analysis showed that fever during the first postpartum week, low serum calcium levels during the same period, metabolic diseases (ketosis or hypocalcemia), application of postpartum treatments, other puerperium pathologies such as retention of fetal membranes, puerperal metritis, mastitis, or ovarian cysts, were not statistically associated with the first postpartum ovulation and subsequent cyclicity resumption (p>0.05). Likewise, ketosis was excluded both from the univariate and the multivariate analysis, since none of the animals showed positive results. Secondly, it was noted that the presentation of dystocia (OR=2.2; CI 0.5-10.5; p<0.5), the decrease of BC (<2.5) (OR=3.3; CI 1.113.8; p<0.05) and the presence of lameness (OR=10.3; CI 1.2-92.2; p<0.05) were factors associated with delays in the first postpartum ovulation (Table 2). The final multivariate binary logistic regression analysis model determined that the risk factors associated with the delay of the first postpartum ovulation were, loss of body condition until reaching a score of less than 2.5 (OR=3.3, CI 95% (1.2-13.3) (p<0.05) and lameness (OR=9.0, CI 95% (1.2-13.3) (p<0.05). (Table 3).

3979

Guáqueta - Risk factors for avarian postpartum resumption in Holstein cows

Table 2. Univariate analysis of variables associated with the first ovulation before day 32 postpartum in high yield dairy Holstein cows in the Sabana de Bogota. OR

IC 95%

Prepartum body condition

Factors

0.8

0.16-4.4

0,840

Body condition on day 32 postpartum (<2.5)

3.3

1.1-13.8

0.041*

Serum calcium (day 3 postpartum)

1.1

0.26-4.2

0,945

Serum calcium (day 6 postpartum)

1.6

0.3-7.7

0,576

Dystocia

2.2

0.5-10.5

0.029*

Number of births

1.2

0.3-5.0

0.79

No postpartum fever (normal T°)

1.9

0.5-7.3

0.326

Downer

0.8

0.2-3.9

0.817

Postpartum treatments

1.7

0.5-6.0

0.397

Retained placenta

2.5

0.5-11.4

0.233

Puerperal metritis

1.9

0.3-11.7

0.489

Milk production (≥35 Liters per day)

1.1

0.26-4.2

0.94

Milk production (305 days)

0.6

0.2-2.1

0.427

Lameness

10.3

1.2-92.2

0.016*

Mastitis

1.9

0.5-7.3

0.326

Ovarían Cysts

1.4

0.3-5.0

0.699

* Values for p≤0.05 were considered statistically significant.

Table 3. Multivariate analysis of factors associated with the first postpartum ovulation before day 32 in Holstein cows in the Sabana de Bogota. Factor

CI 95%

Body condition below 2.5 (day 32 pp)

3.3

1.2-13.3

0.048

Lameness

9.0

1.2-85.2

0.05

* Values for p£0.05 were considered statistically significant.

DISCUSIÓN

DISCUSSION

La presente investigación evaluó la dinámica folicular en bovinos lecheros bajo condiciones de trópico alto, antes y después de la primera ovulación post parto, así como el grado de asociación con algunas de las patologías más frecuentemente reportadas durante el periparto. Los resultados del estudio permitieron dilucidar los patrones de reactivación ovárica y determinar algunos factores de riesgo asociados con la reactivación ovárica postparto bajo dichas condiciones.

This research evaluated the follicular dynamics in dairy cattle under high tropical conditions, before and after the first postpartum ovulation, as well as the degree of association with some of the most frequently pathologies reported during peripartum. The results of the study allowed to elucidate ovarian resumption patterns and determine some risk factors associated with postpartum ovarian resumption under such conditions.

La emergencia de la primera onda folicular se observó en promedio al día 10.1±3.45 (rango de 4-22) post-parto, concordando con resultados previos que han reportado la aparición del primer folículo dominante, que no siempre es ovulatorio, a los 7.0±0.9 d (26) y a los 11.6±2.0 d (rango de 5-39) después del parto (17,27). En este estudio, dieciséis de los animales (39.2%) presentaron la emergencia de la primera onda de desarrollo folicular temprano (días 4 a 8), diecinueve de ellos (46.3%), entre los días 9 y 13 y finalmente seis animales (14.6%) lo hicieron entre los 14 y 22 días postparto; mostrando una distribución acorde con los resultados de otros estudios (5-6).

The emergence of the first follicular wave was observed on average on day 10.1±3.45 (range from 4 to 22) postpartum, this being consistent with previous results that reported the emergence of the first dominant follicle, which is not always ovulatory, at day 7.0±0.9 (26) and 11.6±2.0 (range from 5 to 39) after partum (17,27). In this study, sixteen of the animals (39.2%) showed the emergence of the first early follicular wave development (days 4 to 8), nineteen of them (46.3%) between days 9 and 13, and finally six animals (14.6%) between day 14 and 22 postpartum; showing a distribution consistent with the results of other studies (5-6).

El promedio de los días a la primera ovulación en el presente estudio fue de 24.26 ± 7.84; estos

The days to the first ovulation in this study averaged 24.26 ± 7.84; these results are

3980

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

resultados son un poco menores a los descritos por otros investigadores en latitudes diferentes (27), y bajo distintos sistemas productivos (pastoreo vs. estabulaciones).

slightly lower than those described by other researchers in different latitudes (27), and under different production systems (grazing vs. housing).

El porcentaje de detección de estros observados en este estudio fue del 36%, lo cual coincide con otros trabajos (28). La proporción de animales clasificada en anestro, utilizando para ello la presentación de estro detectado, fue del 64% (26 /41), esto difiere del resultado obtenido de clasificar los animales basándose en los hallazgos del ultrasonido (presencia de CL) y con la medición de P4, lo cual arrojó resultados más bajos, correspondiendo al 11% (5/41) de los animales. Esta problemática contribuye a incrementar los porcentajes de animales que comúnmente son reportados en anestro, cuando en ocasiones se puede tratar de problemas asociados con una inadecuada detección de estros, y no estrictamente por la presentación de ovarios inactivos o anestro verdadero (3), o con alteraciones en el desarrollo folicular, como anovulación, y ausencia de CL, situación que también ha sido planteada por otros autores (29). Es posible especular que estas diferencias se pueden atribuir a la presentación de ovulaciones sin manifestación de signos de estro (24), o a la presentación de estros de baja intensidad y corta duración, haciendo que su expresión y comportamiento no sea evidente (23), debido probablemente a los cambios en el metabolismo de las hormonas esteroidales y el fluido folicular, propuestos por algunos autores en vacas de alta producción lechera (15,22).

The percentage of detection of estrus observed in this study was 36%, which coincides with other studies (28). The proportion of animals classified in anestrus, using for this purpose the estrus detected, was 64% (26/41), this differs from the result obtained by classifying animals based on ultrasound findings (CL present) and with the measurement of P 4, which yielded lower results corresponding to 11% (5/41) of animals. This problem contributes to increase the percentage of animals that commonly are reported in anestrus, when sometimes there can be problems associated with the inadequate detection of estrus, and not strictly by inactive ovaries or true anestrus (3), or alterations in the follicular development, such as anovulation and absence of CL, a situation that has also been raised by other authors (29). It is possible to speculate that these differences can be attributed to ovulations without manifestation of estrus signs (24), or the presentation of low-intensity and shortduration estrus, making their expression and behavior not evident (23), probably due to changes in the metabolism of steroidal hormones and follicular fluid, proposed by some authors in high yield dairy cows (15,22).

El volumen del CL en los animales con ROR fue mayor que en aquellos con ROT, lo cual no parece afectar las concentraciones de P4 durante los primeros 16 días posteriores a la primera ovulación, debido probablemente a que sus niveles de producción fueron altos y por tanto la progesterona se metabolizaría de manera similar (21). Tampoco se observaron diferencias estadísticas en las concentraciones séricas de P4 entre los animales con ROT y ROR, durante el mismo período de tiempo (p>0.05); sin embargo, éste último grupo se caracterizó por la presentación de fases luteales prolongadas. Estos datos concuerdan con un reporte previo (17) en el cual dos terceras partes de los animales presentaron reactivación de la ciclicidad ovárica post parto retardada.

The CL volume in animals with DOR was higher that those with EOR, which does not seem to affect P 4 concentrations during the first 16 days after the first ovulation, probably due to the fact that production levels were high and therefore progesterone would metabolize in a similar manner (21). There were no statistical differences in serum concentrations of P 4 among animals with EOR and DOR during the same period of time (p>0.05); however, the latter group was characterized by prolonged luteal phases. These data are consistent with a previous report (17), in which two-thirds of the animals presented delayed postpartum ovarian cyclicity resumption.

En este estudio se pudo observar una disminución en el puntaje de CC en las vacas durante los primeros 60 días postparto, lo cual no pareció afectar la ocurrencia de la primera onda folicular, ya que se observó que todos los animales iniciaron el reclutamiento de folículos antes del día 20. Por el contrario, el retorno a la ciclicidad luego de la primera ovulación postparto se vio afectado pudiéndose observar que los animales cuya CC descendió a un valor menor o igual a 2.5 al día 32

In this study was observed a decrease in the BC score of cows during the first 60 days postpartum, which did not appear to affect the occurrence of first follicular wave, since it was observed that all animals started producing follicles before day 20. Conversely, the return to cyclicity after the first postpartum ovulation was affected, allowing to observe that animals whose BC dropped to a value less than or equal to 2.5 on day 32 postpartum, were 3.3 times more likely to have delayed ovulation

Guáqueta - Risk factors for avarian postpartum resumption in Holstein cows post parto, tuvieron 3.3 veces más probabilidades de presentar ovulación retardada (OR= 3.3, IC 95% (1.2-13.3) (p<0.05). Este período es crítico debido a la mayor demanda de nutrientes requeridos para la producción de leche (2), y la movilización de grasa de las reservas corporales por el desfase que ocurre entre las demandas metabólicas y el consumo de materia seca en el postparto temprano (15,29), especialmente si el manejo nutricional durante el período de transición no es adecuado (1) situación común en algunos sistemas de pastoreo. En el presente estudio el principal problema encontrado en los animales estuvo relacionado con las diversas alteraciones en la ciclicidad posterior a la primera ovulación, dentro de las cuales se pudo observar en primer lugar anovulación por condiciones quísticas del ovario; en algunos casos probablemente asociados con disturbios o desequilibrios energéticos o nutricionales (2, 29). En segundo lugar, se observó la incapacidad del folículo para alcanzar diámetro ovulatorio, situación que se ha reportado asociada con folículos que alcanzan el estado de dominancia pero no producen concentraciones suficientes de E2 capaces de estimular los picos preovulatorios de LH (3, 28), y que probablemente puedan estar también relacionadas con las fases luteales prolongadas. Por ultimo, se observó anovulación por persistencia del CL, posiblemente como consecuencia de la presentación de patologías. En ese sentido, se ha descrito que la primera fase de reactivación ovárica suele iniciarse desde la primera semana post-parto en animales con parto normal, pero se retrasa en aquellos que han sufrido partos distócicos, retención de membranas fetales y enfermedades metabólicas que impiden la secreción normal de prostaglandinas, manteniendo niveles altos de progesterona permitiendo la extensión de la fase luteal (16). De manera interesante en este estudio, la presentación de distocia fue un factor asociado con el retraso de la primera ovulación (p<0.05) en el análisis univariado, sin embargo, y probablemente por la baja frecuencia de presentación de casos, no resultó asociado en el modelo final, pero bien merece ser considerado como un factor de riesgo. Igualmente se observó que aquellos animales que presentaron cojeras tuvieron nueve veces más posibilidades de presentar ROR OR=9, IC 95% (1.2-85.2) (p≤0.05); lo cual coincide con reportes previos (30, 7). Otras patologías como la mastitis (8), metritis puerperal (16) y distocias (9) han sido asociadas con alteración del desempeño reproductivo en bovinos (1). La explicación más posible de este fenómeno se ha relacionado con niveles elevados de citoquinas, proteínas de fase aguda y cortisol, los cuales tienen un efecto negativo sobre la oportuna liberación de LH y progesterona (31) alterando el microambiente folicular.

3981

(OR = 3.3, CI 95% (1.2-13.3) (p<0.05). This period is critical due to the increased demand for nutrients required for milk production (2), and the mobilization of fat from body reserves by the gap occurring between metabolic demands and the intake of dry material in early postpartum (15,29), especially if the nutritional handling during the transition period is not appropriate (1), a common situation in certain grazing systems. In this study the main problem found in animals was associated with various alterations in cyclicity subsequent to the first ovulation, where anovulation could be first observed by cystic ovary conditions; in some cases probably associated with energy or nutritional disturbances or imbalances (2, 29). Secondly, the inability of the follicle to achieve ovulatory diameter was observed, a situation that has been reported as associated with follicles that reach dominance state but do not produce sufficient E2 concentrations capable of stimulating preovulatory LH highs (3, 28), and may probably be also related to prolonged luteal phases. Finally, anovulation by CL persistence was observed, possibly as a result of the emergence of pathologies. In this regard, it has been described that the first ovarian resumption phase usually starts from the first postpartum week in animals with normal calving, but is delayed in those that have suffered dystocic calving, retention of fetal membranes and metabolic diseases that prevent the normal secretion of prostaglandins, maintaining high progesterone levels and allowing the extension of the luteal phase (16). Interestingly in this study, the presentation of dystocia was a factor associated with the delay in the first ovulation (p<0.05) in univariate analysis, however, and probably due to the low frequency of cases, it was not associated in the final model, but it deserves to be considered as a risk factor. It was also noted that animals with lameness were nine times more likely to show DOR OR=9, CI 95% (1.2-85.2) (p≤0.05); which coincides with previous reports (30, 7). Other pathologies such as mastitis (8), puerperal metritis (16) and dystocia (9) have been associated with the alteration of the reproductive performance of cattle (1). The most possible explanation of this phenomenon has been associated with elevated levels of cytokines, acute-phase proteins and cortisol, which have a negative effect on the timely release of LH and progesterone (31) altering the follicular microenvironment.

3982

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Los resultados obtenidos bajo las condiciones del presente trabajo mostraron que la buena condición corporal durante el periparto es un factor que favorece la ovulación temprana, mientras que las cojeras son un factor de riesgo para que se presenten ovulaciones tardías en los sistemas de pastoreo especializado en trópico de altura. Agradecimientos A la ganadería Inversiones Los Sauces Bermúdez y Cía. S.C.A., a la Dra. Ingrid Guerra, y todo el personal de las fincas “El Coclí” y “Los Sauces” por su colaboración.

The results obtained under the conditions of this study showed that proper body condition during peripartum is a factor that favors early ovulation, while lameness is a risk factor for the occurrence of late ovulation in specialized grazing systems in high tropical areas. Acknowledgements To Ganaderia Inversiones Los Sauces Bermudez y Cia. S.C.A., to Dr. Ingrid Guerra, all the personnel of the farms “El Cocli” and “Los Sauces” for their collaboration.

REFERENCES 1. Wullepit N, Hostens M, Ginneberge C, Fievez V, Opsomer G, Fremaut D, et al. Influence of a marine algae supplementation on the oxidative status of plasma in dairy cows during the periparturient period. Prev Vet Med 2012; (103):298-303. 2. Shrestha HK, Nakao T, Suzuki T, Akita M, Higaki T. Relationships between body condition score, body weight, and some nutritional parameters in plasma and resumption of ovarian ciclicity postpartum during pre-service period in high producing dairy cows in a subtropical region in Japan. Theriogenology 2005; (64):855-866. 3. G ü m e n A , W i l t b a n k M C . L e n g t h o f progesterone exposure needed to resolve large follicle anovular conditions in dairy cows. Theriogenology 2005; (63):202-218. 4. Vassena R, Adams GP, Mapletoft R, Pierson RA, Singh J. Ultrasound image characteristics of ovarian follicles in relation to oocyte competence and follicular status in cattle. Anim Reprod Sci 2003; (76):25-41. 5. Noseir W. Ovarian follicular activity and hormonal profile during estrous cycle in cows: the development of 2 versus 3 waves. Reprod Biol Endocrinol 2003; (1):2-6. 6. Adams GP, Jaiswal R, Singh J, Malhi P. Progress in understanding ovarian follicular dynamics in cattle. Theriogenology 2008; (69):72–80. 7. Garbarino EJ, Hernández JA, Shearer JK, Risco CA, Thatcher WW. Effect of lameness on ovarian activity in postpartum holstein cows. J Dairy Sci 2004; (87):4123-4131.

8. Santos JE, Cerri RL, Ballou MA, Higginbotham GE, Kirk JH. Effect of timing of first clinical mastitis occurrence on lactational and reproductive performance of Holstein dairy cows. Anim Reprod Sci 2004; (80):31-45. 9. Ahmadzadeh A, Frago F, Shafii B, Dalton JC, Price JC, McGuire MA. Effect of clinical mastitis and other diseases on reproductive performance of Holstein cows. Anim Reprod Sci 2007; (10):1016-24. 10. Pinzón C. “Evaluación de los niveles de progesterona y la dinámica folicular en vacas Holstein postparto en el trópico bajo (Estudio de caso)”. Tesis de Grado; Bogotá. Universidad Nacional de Colombia. Facultad de Medicina Veterinaria y de Zootecnia, 2001. 11. Olivera M, Henao D, Carrillo LM. Comportamiento durante el calor y dinámica folicular interestral en vacas BON (Blanco Orejinegro). Rev Col Cienc Pec 2003; 17(1):39-44. 12. Ceballos A, Villa NA, Betancourth T, Roncancio D. Determinación de la concentración de calcio, fósforo y magnesio en el periparto de vacas lecheras en Manizales, Colombia. Rev Col Cienc Pec 2004; 17(2):125-133. 13. Galvis RD, Agudelo D, Saffon A. Condición corporal, perfil de lipoproteínas y actividad ovárica en vacas Holstein en lactancia temprana. Rev Col Cienc Pec 2007; 20(1):6-29. 14. Instituto Geográfico Agustín Codazzi (IGAC). Cundinamarca, características geográficas. Santafé de Bogotá. 2004.

Guáqueta - Risk factors for avarian postpartum resumption in Holstein cows 15. Leroy JL, Vanholder T, Delanghe JR, Opsomer G, Van Soom A, Bols PE, et al. Metabolic changes in follicular fluid of the dominant follicle in high Fielding Dairy cows early postpartum. Theriogenology 2004; (62):1131-1143. 16. Walsh RB, Kelton DF, Duffield TF, Leslie KE, Walton JS, LeBlanc SJ. Prevalence and risk factors for postpartum anovulatory condition in dairy cows. J Dairy Sci 2007; (90):315-324. 17. Shrestha HK, Nakao T, Higaki T, Suzuki T, Akita, M. Resumption of postpartum ovarian cyclicity in high producing Holstein cows. Theriogenology 2004; 61(4):637-649. 18. Zambrano JL. Studies in the superovulatory response to gonadotropins and folliculogenesis of water buffalo (Bubalus bubalis). [Tesis de Doctorado] Davis, Estados Unidos: Universidad de California; 2009.

3983

24. Palmer M, Olmos G, Boyle L, Mee J. Estrus detection and estrus characteristics in housed and pastured Holstein-Friesian cows. Theriogenology 2010; (74):255-264. 25. Pérez-Marin CC, España F. Oestrus expression and ovarian function in repeat breeder cows, monitored by ultrasonography and progesterone assay. Reprod Dom Anim 2007; (42):449-456. 26. Tanaka T, Arai M, Ohtani S, Uemura S, Kuroiwa T, Kim S, et al. Influence of parity on follicular dynamics and resumption of ovarian cycle in postpartum dairy cows. Anim Reprod Sci 2008; (108):134-143. 27. Sakaguchi M, Sasamoto Y, Suzuki T, Takahashi Y, Yamada Y. Postpartum ovarian follicular dynamics and estrous activity in lactating dairy cows. J Dairy Sci 2004; (87):2114-2121.

19. Fortune JE, Rivera GM, Yang MY. Follicular development: the role of the follicular microenvironment in selection of the dominant follicle. Anim Rep Sci 2004; (82):109-126.

28. Lopez H, Satter LD, Wiltbank MC. Relationships between level of milk production and estrous behavior of lactating dairy cows. Anim Reprod Sci 2004; (81):209-223.

20. Hannan MA, Fuenzalida MJ, Siddiqui MA, Shamsuddin M, Beg MA, Ginther OJ. Diurnal variation in LH and temporal relationships between oscillations in LH and progesterone during the luteal phase in heifers. Theriogenology 2010; (74):1491-1498.

29. Reist M, Erdin D, VonEuw D, Tschümperlin K, Leuenberger H, Hammon H, et al. Postpartum reproductive function: association with energy, metabolic and endocrine status in high yielding dairy cows. Theriogenology. 2003; (59):1707-1723.

21. López H, Sartori R, Wiltbank M. Reproductive hormones and follicular growth during development of one or multiple dominant follicles in cattle. Biol Reprod 2005; (72):788-795.

30. Garbarino EJ, Hernandez JA, Shearer JK, Risco CA, Thatcher WW. Effect of lameness on ovarian activity in postpartum Holstein cows. J Dairy Sci 2004; (87):4123-4131.

22. Wiltbank W, López H, Sartori R, Sangsritavng S, Gümen A. Changes in reproductive physiology of lactating dairy cows due to elevated steroid metabolism. Theriogenology 2006; (65):17-29. 23. López H, Sartori R, Wiltbank M. Type of estrus cows. Theriogenology 2004; (81):209-223.

31. Bertoni G, Trevisi E, Han X, Bionaz M. Effects of inflammatory conditions on liver activity in puerperium period and consequences for performance in Dairy cows. J Dairy Sci 2008; (91):3300-3310.

Rev.MVZ Córdoba 19(1):3984-3989, 2014. ISSN: 0122-0268 ORIGINAL

Some ecological aspects of free-living Haemaphysalis juxtakochi Cooley, 1946 (Acari: Ixodidae) in Panama Algunos aspectos ecológicos de fases de vida libre de Haemaphysalis juxtakochi Cooley, 1946 (Acari: Ixodidae) en Panamá Gleydis García G,1 Lic, Angélica Castro DF,1 Lic, Sergio Bermúdez C,1* M.Sc, Santiago Nava,2 Ph.D. Instituto Conmemorativo Gorgas de Estudios de la Salud, Ciudad de Panamá, Panamá 081602593. 2Instituto Nacional de Tecnología Agropecuaria, Estación Experimental Agropecuaria Rafaela y Consejo Nacional de Investigaciones Científicas y Técnicas, CC 22, CP 2300 Rafaela, Santa Fe, Argentina. *Correspondencia: bermudezsec@gmail.com 1

Received: February 2013; Accepted: November 2013.

ABSTRACT Objective. To describe the seasonal variation and perform a comparative analysis on habitat preference of Haemaphysalis juxtakochi in Panama. Materials and methods. Ticks were collected from the vegetation, using a white cloth, between January 2009 and March 2010, in four site located in Summit Municipal Park (SMP), two in wooded area (WA) and two in grasslands (GR).The ticks were determined as larvae, nymphs and adults of H. juxtakochi. The number of ticks collected in each area was employed to describe the seasonal distribution of both immature and adult stages, and the non-parametric Mann-Whitney U test. Results. A total of 2.338 ticks in WA and 560 ticks in GR were collected. The major peak of adults from May to July, nymphs peaked from January to April and the peak of larvae abundance from December and January. There was a significant difference in the number of ticks collected in the two areas for each tick stage (larvae, mean number (MN) in WA 120.14, MN in GR 57.07, P: 0.02; nymphs, MN in WA 46.42, MN in GR 16.38, P: 0.018; adults, MN in WA 6.64, MN in GR 1.78, P: 0.02). Conclusions. The results suggest that H. juxtakochi maintains a one-year cycle in the study areas. This cycle would be characterized by the immature population peaks in the dry season; while adults are distributed throughout year, with a peak in the transition from the rainy and dry. Moreover, H. juxtakochi was more abundant in forests than in grasslands, which could lead to a better adaptation to forested conditions. Key works: Abundance, distribution, environment, host, stages, ticks (Source: DeCYT).

RESUMEN Objetivo. Describir la variación estacional y realizar un análisis comparativo de la preferencia de hábitat de H. juxtakochi en Panamá. Materiales y métodos. Se recolectaron mensualmente garrapatas de la vegetación utilizando una tela blanca, entre enero de 2009 y marzo de 2010 en cuatro sitios establecidos en el Parque Municipal Summit (PMS), dos en área de pastizales (AP) y dos en área boscosa (AB). Las garrapatas fueron identificadas como larva, ninfa y adulto de H. juxtakochi. El

3984

García - Some ecological aspects of free-living Hemaphysalis juxtakochi in Panama

3985

número de garrapatas recolectadas en cada área fue empleado para describir la distribución estacional de ambos estadios inmaduros y adultos, y se compararon con la prueba no paramétrica Mann-Whitney U. Resultados. Se recolectó un total de 2.338 garrapatas en AP y 560 garrapatas en AB. El mayor pico de garrapatas adultas fue de mayo hasta julio, los picos de ninfas fueron de enero hasta abril y los picos de abundancia de larvas desde diciembre hasta enero. Hubo diferencias significativas en el número de garrapatas recolectadas en las dos áreas para cada estadio (número promedio de larvas en AB 120.14, en AP 57.07, P: 0.02; número promedio de ninfas en AB 46.42, en AP 16.38, P:0.018; número promedio de adultos en AB 6.64, en AP 1.78, P: 0.02). Conclusiones. Los resultados sugieren que H. juxtakochi mantiene un ciclo de un año en las áreas de estudio. Este ciclo estaría caracterizado por picos poblacionales de ejemplares inmaduros en la época seca; mientras que los adultos se distribuyen a lo largo de todo año, con un pico en la transición entre la época lluviosa y seca. Por otra parte, H. juxtakochi fue más abundante en bosques que en pastizales, lo cual podría suponer mejores adaptaciones a condiciones boscosas. Palabras clave: Abundancia, ambiente, distribución, estadio, garrapatas, huésped (Fuente: DeCS).

INTRODUCCIÓN

INTRODUCTION

El riesgo espacial y temporal de adquirir una enfermedad transmitida por garrapatas está estrechamente asociado a la distribución, abundancia y la dinámica estacional de los vectores (1). Por lo tanto, el conocimiento de la ecología de las garrapatas es esencial para hacer inferencias epidemiológicas sobre el riesgo de este tipo de enfermedades en una región en particular. La información sobre la ecología de las garrapatas en Panamá es escasa, aun cuando se han realizado estudios sobre su distribución y las relaciones parasíticas con sus hospederos (2-7). De esta manera, no existen caracterizaciones de aspectos ecológicos como la distribución estacional y la preferencia de hábitat de las garrapatas panameñas. Fairchild et al (3) presentan algunas generalizaciones sobre factores ambientales limitantes para la distribución de garrapatas en Panamá, pero sin ningún escrutinio analítico.

T h e s p a t i a l a n d t e m p o ra l r i s k o f t i c kborne disease is closely associated with the distribution, abundance and seasonal dynamics of the vector ticks (1). Therefore, knowledge of ecology of ticks is essential to make epidemiological inferences about the risk of tick-borne diseases in a particular region. Information on ecology of ticks in Panama is scarce. Although studies about host-association and distribution of ticks were carried out in this country (2-7), there are not characterizations of ecological aspects as seasonal distribution and habitat preference of Panamanian ticks. Fairchild et al (3), present some generalizations concerning environmental limiting factors for tick distribution in Panama, but without an analytical scrutiny.

Una de las garrapatas con mayor distribución en Panamá es Haemaphysalis juxtakochi (8). Esta especie se ha registrado en varias localidades de Panamá, especialmente en las provincias de Panamá, Colón, Chiriquí, incluso en la isla principal del Parque Nacional Coiba (4-6,8,9). En Panamá los hospederos que se han listado para esta especie incluyen al tapir Tapirus bairdii (macho y hembra), Odocoileus virginianus (macho, hembra, ninfa y larva), Coendou rothschildi (ninfa), Nasua nasua (ninfa) y “pecarí” (ninfa) (4,9). Por otro lado, desde el punto de vista de salud pública, esta especie se ha encontrado parasitando animales domésticos como perros y cabras, además de humanos (5,6). En Panamá, similar a otros países del Neotropico donde se ha reportado, no se tienen datos sobre la ecología de esta especie (10). Por lo tanto, el objetivo de este estudio fue describir la variación estacional y realizar un análisis comparativo sobre la preferencia de hábitat de H. juxtakochi en Panamá.

One of the ticks with widely distributed in Panama is Haemaphysalis juxtakochi (8). This species was recorded in several localities from Panama, Colón, Chiriquí Provinces, even in Coiba Island National Park (4-6,8,9). The host recorded for H. juxtakochi in Panama were Tapirus bairdii (male and female), Odocoileus virginianus (male, female, nymph and larva), Coendou rothschildi (nymph), Nasua nasua (nymph) and “peccary” (nymph) (4,9). The records with sanitary relevance correspond to domestic mammals as dogs, goats, even humans (5,6). There is not information about the ecology of H. juxtakochi not only in Panama, but neither also in the Neotropics, in spite of its wide distribution in this Biogeographic region (10). Therefore, the aim of this work was to describe the seasonal variation and perform a comparative analysis on habitat preference of H. juxtakochi in Panama.

3986

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

MATERIALES Y MÉTODOS

MATERIALS AND METHODS

Área de estudio. El estudio se realizó en el Parque Municipal Summit (PMS), el cual se encuentra localizado en la orilla oriental del Canal de Panamá, a 15 millas de Ciudad de Panamá (9°3’59,91’’ N, 79°38’45,98’’ O). Este parque posee un clima húmedo tropical de acuerdo a la clasificación de Holdridge (11), con una temperatura media de 27ºC; por lo cual la fisonomía que caracteriza el PMS está dada por un bosque húmedo tropical, además de áreas desmontadas que han sido pobladas con la herbácea introducida Saccharum spontaneum, además de otras malezas. Adicionalmente, el PMS está rodeado por el Parque Nacional Soberanía, el cual tiene una superficie aproximada de 1.945 hectáreas de bosque húmedo primario y secundario y posee una alta diversidad, incluyendo 105 especies de mamíferos, 525 de aves, 134 de reptiles y anfibios (4).

S t u d y a r e a . T h e s t u d y wa s c o n d u c t e d in Summit Municipal Park (SMP), which is located on the eastern edge of the Pa n a m a C a n a l , 1 5 m i l e s f r o m Pa n a m a City (9°3’59.91’’ N, 79°38’45.98’’ W). The climate is tropical wet as classified by Holdridge (11), and the average temperature is 27ºC; whereby the physiognomy which characterizes the SMP is given by the tropical rainforest, cleared patches that have been populated with Saccharum spontaneum, and introduced herbaceous and mixed plains. SMP is surrounded by Soberania National Park, which has an approximate area of 1945 hectares of primary and secondary rain forest and has a high diversity, including 105 species of mammals, 525 of birds, 134 of reptiles and amphibians (4).

Recolección de las garrapatas. Las garrapatas se recolectaron mensualmente de enero 2009 hasta marzo 2010, utilizando una tela blanca (45x45 cm) que se arrastró sobre la vegetación, además de revisar el envés de hojas. Todas las garrapatas fueron preservadas en etanol al 96%. Se seleccionaron cuatro sitios para la toma de muestras, dos en área boscosa (AB) y dos en área de pastizales (AP), donde se establecieron cuadrículas de 100 m2 para llevar a cabo el muestreo de las garrapatas. En cada sitio se tomaron muestras de 0800-1000 horas. La escogencia de H. juxtakochi para este estudio se basó en que la misma es la única especie presente en áreas boscosas de Panamá, cuyos tres estadios pueden ser identificados con certeza. Las garrapatas fueron determinadas de acuerdo a Cooley (8) y Kohls (9).

Ticks collecting. Ticks were monthly collected from vegetation between January 2009 and March 2010, using cloth flags (45 x 45 cm) and looking individuals on the undersides of leaves. All ticks were preserved in 96% ethanol. Four sites were selected for sampling, two in wooded area (WA) and two in grasslands (GR), where grids of 100 m2 were established to carry out the sampling of ticks. Each site was sampled to 0800-1000 hours. Because in Panama only be established with certainty the identification of the three stages of H. juxtakochi, the study was emphasized in this species. The ticks were determined following Cooley (8) and Kohls (9). Statistical analyses. The number of ticks collected in each area was employed to describe the seasonal distribution of both immature and adult stages, and the non-parametric MannWhitney U test with a level of significance of 0.05 was used to compare number of ticks between WA and GR. Temperature and relative humidity were measured monthly in each site (Figure 1).

RESULTS

Figure 1. Te m p e ra t u r e a n d h u m i d i ty S u m m i t Municipal Park, during, 2009-2010.

Immature and adults of H. juxtakochi were collected in both areas, 2338 ticks in WA (1278 larvae, 984 nymphs, 76 adults) and 560 ticks in GR (342 larvae, 195 nymphs, 23 adults). The seasonal variation (expressed as the number of specimens collected in each month, and considering ticks from WA and GR together) in the number of larvae, nymphs and adults of this tick species is presented in figure 2. Although there is a major peak of adults from May to July, they were found during the whole year. Contrarily, larvae and nymphs showed a more

García - Some ecological aspects of free-living Hemaphysalis juxtakochi in Panama

3987

600 500

Number of larvae

Análisis estadísticos. El número de garrapatas recolectadas en cada área se empleó para describir la distribución estacional de los estadios inmaduros y adultos y se utilizó la prueba no paramétrica de Mann-Whitney U con un nivel de significancia del 0.05 para comparar el número de garrapatas entre AB y AP. Mensualmente se registró la temperatura y humedad relativa en cada sitio (Figura 1).

400 300 200 100 0 JAN MAR APR MAY JUN

RESULTADOS

A pesar todos los estadios de H. juxtakochi fueron encontrados en AB y AP, hubo una diferencia significativa en el número de garrapatas recolectadas en las dos áreas para cada estadio de las garrapata (número promedio de larvas en AB 120.14, número promedio en AP 57.07, P: 0.02; número promedio de ninfas en AB 46.42, número promedio en AP 16.38, P: 0.018; número promedio de adultos en AB 6.64, número promedio en AP 1.78, P: 0.02).

DISCUSIÓN Nuestros resultados sugieren que H. juxtakochi tiene un ciclo de vida anual, al menos en las áreas de estudio. Las larvas que se encontraban activas desde septiembre a marzo debieron haber mudado a ninfas entre enero y abril, y éstas se desarrollaron en garrapatas adultas que alcanzaron un pico de abundancia desde mayo hasta julio. Dado que es posible encontrar adultos durante todo el año, es probable que las condiciones ambientales en el área de estudio sean adecuadas para una larga supervivencia de estos. Así, el periodo en que los adultos está presentes en el ambiente probablemente esté relacionado con el aumento

AUG SEP

OCT NOV DEC

JAN

FEB MAR

OCT NOV DEC

JAN

FEB MAR

OCT NOV DEC

JAN

FEB

Months

Number of nymphs

120 100 80 60 40 20 0 8

JAN MAR APR MAY JUN

JUL

AUG SEP

Months

Number of adults

Se recogieron inmaduros y adultos de H. juxtakochi en ambas áreas, 2.338 garrapatas en AB (1.278 larvas, 984 ninfas, 76 adultos) y 560 garrapatas en AP (342 larvas, 195 ninfas, 23 adultos). La variación estacional (expresada como el número de especímenes recolectados en cada mes y teniendo en cuenta las garrapatas de AB y AP en conjunto) en el número de larvas, ninfas y adultos de esta especie de garrapata se presenta en la figura 2. Aunque se presenta un pico importante adultos desde mayo hasta julio, estos se encontraron durante todo el año. Por el contrario, las larvas y ninfas mostraron un patrón estacional más pronunciado. Las larvas fueron recolectadas desde septiembre hasta marzo, con un pico de abundancia en diciembre y enero, mientras que las ninfas mostraron un pico desde enero a abril.

JUL

140

6 5 4 3 2 1 0 JAN MAR APR MAY

JUN

JUL

AUG

SEP

MAR

Months

Figure 2. Monthly number of larvae, nymphs, and adults of Haemaphysalis juxtakochi collected on vegetation in Summit Municipal Park, Panama.

pronounced seasonal pattern. Larvae were collected from September to March, with the peak of abundance in December and January, while nymphs peaked from January to April. Although all stages of H. juxtakochi were found in both WA and GR, there was a significant difference in the number of ticks collected in the two areas for each tick stage (larvae, mean number (MN) in WA 120.14, MN in GR 57.07, P: 0.02; nymphs, MN in WA 46.42, MN in GR 16.38, P: 0.018; adults, MN in WA 6.64, MN in GR 1.78, P: 0.02).

DISCUSSION Our results suggest that H. juxtakochi has a one-year life cycle, at least in the studies areas. Larvae which were active from September to March emerged into the nymphs present in the environment from January to April, and these nymphs develop into the adult ticks that reach the peak of abundance from May to July.

3988

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

en el número de sus hospederos. En el caso de los inmaduros, éstos parasitan principalmete pequeños mamíferos y aves (Bermúdez datos sin publicar). Hasta ahora, en el PMS no se conoce cómo varían las poblaciones de mamíferos o aves a lo largo de las estaciones, conociéndose únicamente el aumento en el número de aves durante la temporada de migración (aprox. noviembre-abril) (12). Es posible esbozar dos hipótesis para explicar estos resultados. Una de estas está relacionada con el uso de hospederos, ya que la dispersión de las garrapatas depende de la movilidad de los vertebrados. Haemaphysalis juxtakochi es una especie que parasita una amplia gama de hospederos y los adultos se han reportado parasitando mamíferos medianos y grandes pertenecientes a las familias Cervidae, Bovidae, Camelidae, Equidae, Tapiridae, Tayasuidae, además de Canidae, Felidae, Leporidae and Dasypodidae (13). Los estadios inmaduros también parecen ser parásitos oportunistas, ya que se han encontrado asociados a diferentes especies de mamíferos (familia Cervidae, Tayassuidae, Procyonidae, Sciuridae, Leporidae, Dasyproctidae y Erethizontidae) y aves (familias Turdidae, Emberizidae, Corvidae y Falconidae) (13). En Panamá, los principales hospederos de los adultos de H. juxtakochi son artiodáctilos, especialmente venado de cola blanca y pecaríes (Bermúdez datos sin publicar), y de éstos, el venado de cola blanca parece ser muy común en la ribera occidental del Canal de Panamá, habitando áreas forestales y pastizales (14). Así, la capacidad de H. juxtakochi de parasitar hospederos con diferentes preferencias ecológicas, permitiría rechazar la hipótesis que el uso del hospedero determina un mayor número de garrapatas en AB. Una segunda hipótesis más plausible se basa en las diferencias en las condiciones microclimáticas en AB y AP (12). Es probable que las condiciones microclimáticas en AB sean mejores que en AP para el desarrollo de las fases no parasitarias (muda de larvas y ninfas ingurgitadas, oviposición de hembras ingurgitadas, incubación de huevos, búsqueda de hospederos). Esta hipótesis concuerda con la idea general de que las garrapatas Ixodidae, mantienen un comportamiento más ambiente-específico que hospedero-específico (12); sin embargo, deben diseñarse otros estudios experimentales sobre el estadio no parasitario de H. juxtakochi para probar esta segunda hipótesis, además de ser complementada con más datos sobre los estados parasitarios.

Because adults were found during the whole year, it is probable that the environmental conditions in the study area are suitable for a long survival of these stages. Thus, the period in that adults are found in the environment is probably related to the recruitment rates associated to host density. In the case of the immature, small mammals and birds are parasitized for immature (Bermúdez unpublished data). So far, in SMP it is no known as populations of mammals or birds vary throughout the seasons, knowing only the increase in the number of birds during the migration season (aprox. November-April), (12). Two hypotheses can be sketched out to explain these results. One of this is related to host usage, because tick dispersion depends of host mobility. Haemaphysalis juxtakochi is a tick species with a wide range of hosts and there are records of adults parasitizing large and medium size mammal species belonging to different families such as Cervidae, Bovidae, Camelidae, Equidae, Tapiridae, Tayassuidae, Leporidae and Dasypodidae (13). The immature stages also appear to be catholic feeders, because they were found associated to different species of mammals (families Cervidae, Tayassuidae, Procyonidae, Sciuridae, besides Felidae, Canidae, Leporidae, Dasyproctidae, and Erethizontidae) and birds (families Turdidae, Emberizidae, Corvidae, Falconidae) (13). In Panama, the principal hosts of H. juxtakochi adults are Artiodactyla, especially white-tailed deer and peccaries (Bermúdez unpublished data), and of these, the white-tailed deer appear to be very common in west bank of the Panama Canal, wandering through forest and grass areas (14). Thus, this capacity of H. juxtakochi to feed on hosts with different ecological preferences and, in several cases, a considerable vigility, allows rejecting the hypothesis that host usage determines a major number of ticks in WA. A second and more plausible hypothesis is based in the differences in microclimatic conditions between WA and GR (12). It is probable that microclimatic conditions in WA are better than those of GR to the development of the non-parasitic phase (moulting of engorged larvae and nymphs, oviposition of engorged females, incubation of eggs, host-seeking). This hypothesis agrees with the general idea of Ixodidae ticks are more habitat-specific than host-specific (12); however, further experimental studies on nonparasitic phase of H. juxtakochi should be designed to test this second hypothesis, besides complement with more data about parasitic phases.

García - Some ecological aspects of free-living Hemaphysalis juxtakochi in Panama

3989

Agradecimientos

Acknowledgements

Este estudio fue patrocinado parcialmente por la Secretaría Nacional de Ciencia y Tecnología (COL07-045) y el ICGES. Agradecimientos especiales para el personal de la Autoridad Nacional del Ambiente, Parque Municipal Summit y Autoridad del Canal de Panamá por los respectivos permisos. A Red Iberoamericana de Investigación y Control de Enfermedades Rickettsiales (RIICER). Adicionalmente, agradecemos a INTA y CONICET por las asistencias financieras a SN.

This work was partially sponsored by Secretaria Nacional de Ciencia y Tecnología (grant COL-07045) and ICGES. Special thanks to personnel of the Autoridad Nacional del Ambiente, Parque Municipal Summit and Autoridad del Canal de Panama by the permission. To Red Iberoamericana de Investigación y Control de Enfermedades Rickettsiales (RIICER). Additionally, we acknowledge to INTA and CONICET for the financial assistances to SN.

REFERENCES 1.

Bowman AS and Nuttall PA. Ticks biology, disease and control, New York: Cambridge University Press; 2008.

Dunn LH. The ticks of Panamá, their hosts, and the disease they transmit. Am J Trop Med 1923; 3:41-104.

Fairchild GB, Kohls GM, Tipton VJ. The ticks of Panama (Acarina: Ixodoidea). In: Wenzel WR and Tipton VJ editores. Ectoparasites of Panama. Chicago: Field Museum of Natural History; 1966; 167-219.

Kohls GM. Records and new synonymy of new world Haemaphysalis ticks, with description of the nymph and larva of H. juxtakochi Cooley. J Parasitol 1960; 46:355-361.

10. Guglielmone AA, Estrada-Peña A, Keirans JE & Robbins RG. Ticks (Acari: Ixodida) of the Neotropical Zoogeographic Region. Special Publication, International Consortium on Ticks Tick–borne Diseases Atalanta, Houten, The Netherlands 2003; 173:80-81. 11. Holdridge L. Life zone ecology. San Jose, Costa Rica: Trop. Sci. Center; 1967.

Bermudez SE, Miranda RJC, Smith DC. Ticks species (Ixodida) in the Summit Municipal Park and adjacent areas, Panama City, Panama. Exp Appl Acarol 2010; 52(4):439-48.

Bermudez SE, Miranda RJC. Distribution of ectoparasites of Canis lupus familiaris L. (Carnivora: Canidae) from Panama. Rev MVZ Córdoba 2011; 16(1):2274-2282.

12. Saracco F, DeSante D, Alvarez C, Morales S, Milá B, Kaschube D, Michel N. Monitoreo de sobrevivencia invernal aparente de aves migratorias en el Neotrópico: Informe preliminar sobre los primeros dos años (2003-04) del programa Monitoreo de Sobrevivencia Invernal (MoSI). California: The Institute of Birds Populations; 2004.

Bermudez SE, Castro A, Esser H, Liefting Y, García G, Miranda RJ. Ticks (Ixodida) on humans in Panama, Panama (2010-2011). Exp Appl Acarol 2012; 58(1):81-881.

13. Nava S, Guglielmone AA. A meta-analysis of host specificity in Neotropical hard ticks (Acari: Ixodidae). Bull Entomol Res 2013; DOI: 10.1017/S0007485312000557.

Murgas IL, Castro AM, Bermúdez SE. Current status of Amblyomma ovale (Acari: Ixodidae) in Panama. Ticks and Tick-Borne Dis 2012; 4(1-2):164-166.

C o o l e y R A . T h e g e n e ra B o o p h i l u s , Rhipicephalus, and Haemaphysalis (Ixodoidea) of the New World. Bull Nat Inst Health 1946; (187):1-54.

14. Springer M, Carver A, Nielsen C, Correa N, Ashmore J, Ashmore J, Lee J. Relative abundance of mammalian species in a central Panamanian rainforest. Rev Lat Conserv 2013; 3(1):19-26.

Rev.MVZ Córdoba 19(1):3990-4002, 2014. ISSN: 0122-0268 ORIGINAL

Relationship between apoptosis and the BH2 domain sequence of the VP5 peptide of infectious pancreatic necrosis virus Relación entre apoptosis y secuencia del dominio BH2 del peptido VP5 del virus de la necrosis pancreatica infecciosa Cesar Ortega S,1* Ph.D, Sylvia Rodríguez S,2 Ph.D, Juan Carlos Espinoza,3 M.Sc, Juan Kuznar,3 Ph.D, Alex Romero,4,5 Ph.D, Ricardo Enríquez,4 Ph.D. Universidad Autonoma del Estado de México, Faculty of Veterinary Medicine and Animal Husbandry, Advanced Animal Health Research and Study Center. Toluca, Mexico, AP. 4-56. 2Biologic Research Center (High Council for Scientific Research) c/ Ramiro de Maeztu 9 Madrid 28040, Spain. 3 Universidad de Valparaiso, Faculty of Sciences, Biochemistry and Virology Laboratory. Gran Bretaña 1111, Valparaíso, Chile. 4Universidad Austral de Chile, Faculty of Veterinary Sciences, Biotechnology and Aquatic Pathology Laboratory. Valdivia, Chile. 5Centro FONDAP: Interdisciplinary Center for Aquaculture Research (INCAR), Chile. *Correspondence: cos_mx@hotmail.com 1

Received: March 2013; Accepted: September 2013.

ABSTRACT Objective. To determine whether the level of apoptosis induced by infectious pancreatic necrosis virus (IPNV) is related to the amino acid sequence of the BH2 domain of the VP5 protein and the level of infectivity. Materials and methods. Three IPNV strains were used, the VP2 protein gene was amplified for genotyping and the VP5 sequence was also obtained. The infectivity of the strains was calculated using the viral titer obtained at 12, 24, 36 and 45 hpi in CHSE-214 cells. The percentage of apoptosis in infected cells was visualized by TUNEL assay and immunohistochemistry (caspase 3 detection). Results. The V70/06 and V33/98 strains corresponded to genotype Sp, while V112/06 to VR-299; the amino acid analysis of the V70/06 strain allows its classification as middle virulent strain and V33/98 and V112/06 strains as low virulent ones; infection with the V112/06 strain produced a lower viral titer (p<0.05). The VP5 gene of the 3 strains showed four homologous domains to Bcl-2, however, the BH2 domain was truncated in V70/06 and V33/98 (12 kDa), being complete (15kDa) in V112/06, which also showed the Trp155 residue, equivalent to Trp188 considered as a critical factor for the function of Bcl-2. The average apoptosis was below 12%, showing no differences between strains (p>0.05). Conclusions. The results showed that the differences in the BH2 sequence of the VP5 protein, infectivity and the VP2 sequence are not associated with the modulation of apoptosis. Key words: Apoptosis, Infectivity, IPNV, VP5 (Sourse: MeSH).

RESUMEN Objetivo. Determinar si el nivel de apoptosis inducido por cepas del virus de la necrosis pancreática infecciosa (IPNV) tiene relación con la secuencia aminoacídica del dominio BH2 de la proteína VP5 y el nivel de infectividad. Materiales y métodos. Se utilizaron tres cepas de IPNV; el gen de la proteína VP2 fue amplificado para genotipificación y se obtuvo la secuencia de VP5. La infectividad

3990

Ortega - Relationship between apoptosis and the BH2

3991

de las cepas se calculó mediante el título viral obtenido a 12, 24, 36 y 45 hpi en células CHSE-214. Los porcentajes de apoptosis en células infectadas se visualizaron mediante ensayo TUNEL e inmunohistoquímica (detección de caspasa 3). Resultados. Las cepas V70/06 y V33/98 correspondieron a genotipo Sp, mientras que V112/06 a VR-299; el análisis aminoacídico relacionó a V70/06 como cepa de mediana virulencia y a V33/98 y V112/06 de baja virulencia; la infección con V112/06 produjo menor título viral (p<0.05). El gen VP5 de las 3 cepas presentó los cuatro dominios homólogos a Bcl-2; sin embargo, el dominio BH2 fue truncado en V70/06 y V33/98 (12 kDa); siendo completo (15kDa) en V112/06, que además, presentó el residuo Trp155, equivalente a Trp188 considerado factor crítico para la función de Bcl-2. El promedio de apoptosis fue inferior a 12%, no se observaron diferencias entre cepas (p>0.05). Conclusiones. Los resultados mostraron que las diferencias en la secuencia de BH2 de la proteína VP5, la infectividad y en la secuencia de la proteína VP2 no están asociadas con la modulación de apoptosis. Palabras clave: Apoptosis, infectividad, IPNV, VP5 (Fuente: MeSH).

INTRODUCCIÓN

INTRODUCTION

El virus de la necrosis pancreática infecciosa (IPNV) ocasiona una enfermedad contagiosa de distribución mundial que afecta principalmente a salmónidos jóvenes (1); la especie, la edad y el estado de salud de los animales afectados y la virulencia de la cepa son factores que influyen sobre la signología clínica y el nivel de mortalidad (2,3).

The infectious pancreatic necrosis virus (IPNV) causes a contagious globally distributed disease that mainly affects young salmonids (1); the species, age and health condition of animals affected and the virulence of the strain are factors that influence the clinical signs and mortality level (2,3).

El genoma de IPNV consiste de dos segmentos de ARN de doble cadena (dsRNA). El segmento A presenta dos marcos de lectura abiertos (ORFs); el ORF mayor codifica una poliproteína 5´-pVP2-NSVP3´, que es escindida co-traduccionalmente por la proteasa no estructural (NS) o VP4, generando las proteínas estructurales VP2 y VP3, que respectivamente integran la superficie externa e interna de la cápside viral; el ORF menor codifica un péptido NS conocido como VP5 el cual no forma parte del virión y ha sido implicado en la inhibición de apoptósis, favoreciendo así la supervivencia viral. El segmento B presenta un solo ORF que codifica una ARN polimerasa dependiente de ARN (RdRp), conocida como VP1 (3,4).

The IPNV genome consists of two doublestranded RNA segments (dsRNA). Segment A exhibits two open reading frames (ORFs); the highest ORF encodes a polyprotein 5´-pVP2NS-VP3´, which is cotranslationally divided by the nonstructural protease (NS) or VP4, generating structural proteins VP2 and VP3, which respectively comprise the external and internal surface of the viral capsid; the lower ORF encodes an NS peptide known as VP5 which is not part of the virion and has been implicated in the inhibition of apoptosis, thus promoting viral survival. The Segment B shows a single ORF encoding a polymerase RNA dependent on RNA (RdRp), known as VP1 (3,4).

El papel de las proteínas de IPNV como factor de virulencia no está plenamente determinado, pero se sugiere que a través de alguno de sus productos, el virus podría modular ciertos procesos celulares para favorecer la supervivencia de su progenie, además, de alterar mecanismos de defensa para establecer la infección (5,6). Sano et al (7), relacionaron la virulencia de IPNV con productos del genoma del segmento A, y posteriormente, Song et al (4) identificaron que variaciones en los residuos 217 y 221 en la secuencia aminoacídica de la proteína VP2 influyen en el nivel de virulencia de las cepas. La función de VP5 es incierta, pero debido a que presenta cuatro dominios homólogos con proteínas celulares anti-apoptóticas Bcl-2 (BH) se considera factor de virulencia que podría modular esta forma de muerte celular (6,8,9), asociado a la secuencia aminoacídica del dominio BH2 (10).

The role of IPNV proteins as virulence factor is not fully determined, but it is suggested that through any of its products, the virus could modulate certain cellular processes to favor the survival of its progeny, in addition, to alter defense mechanisms for establishing the infection (5,6). Sano et al (7), related the virulence of IPNV with products of the genome of segment A, and subsequently, Song et al (4) identified that variations in residues 217 and 221 in the amino acid sequence of the VP2 protein influence the virulence level of strains. The function of VP5 is uncertain, but since it shows four homologous domains with anti-apoptotic cellular proteins Bcl2 (BH) it is considered as virulence factor that could modulate this form of cell death (6,8,9), associated with the amino acid sequence of the BH2 domain (10).

3992

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

La apoptósis es un proceso de muerte celular genéticamente controlado, implicado en regular el desarrollo y la homeostasis de los tejidos; también es un mecanismo de defensa que puede estimularse por reacciones inmunes o cuando existe daño celular por enfermedad o agentes tóxicos. Este proceso puede iniciarse mediante estimulación celular externa (vía extrínseca o mediada por receptor) o interna (vía intrínseca o mitocondrial); en ambas vías participan un grupo conservado de cisteína-proteasas específicas de aspartato denominadas caspasas que se sintetizan como zimógenos, los cuales deben sufrir fragmentación proteolítica para activarse. La activación de la caspasa iniciadora desencadena un programa de muerte secuencial, donde las caspasas ejecutoras alteran proteínas del citoesqueleto y la matriz nuclear. La activación de caspasa 3 libera el inhibidor de una DNAasa citoplasmática (CAD) que da lugar a la fragmentación internucleosomal del ADN (9,11,12). Ante infecciones virales, la modulación de apoptósis se ha asociado a productos del virus, que pueden manipular ciertos procesos de las células para permitir la supervivencia de su progenie (13-15). Hong et al (5), reportaron que el efecto citopático (CPE) que muestran células infectadas con IPNV es un proceso post apoptótico, relacionado con represión del gen del factor de supervivencia Mcl-1, un miembro de la familia de proteínas antiapoptóticas Bcl-2; en contraste, Espinoza et al (13), reportan que sólo el 12% de la población celular infectada con una cepa de serotipo VR299 presentó apoptósis, prevaleciendo la muerte celular por necrosis. Santi et al (10), no observaron diferencias en el porcentaje de apoptósis en células infectadas con cepas recombinantes de serotipo Spjarup (Sp), incluyendo una cepa que no expresaba VP5, sugiriendo que sustituciones o ausencias de ciertos residuos de la secuencia del dominio BH2 u otro(s) factor(es) del virus podrían influir en el desarrollo de esta forma de muerte celular. Ante estos antecedentes, este estudio se realizó para relacionar el nivel de inducción de apoptósis con la secuencia del dominio BH2 y con el nivel de infectividad de tres cepas de campo de IPNV.

Apoptosis is a genetically controlled cell death process, involved in regulating the development and homeostasis of tissues; it is also a defense mechanism that can be stimulated by immune reactions or when there is cell damage by disease or toxic agents. This process can be initiated by external (extrinsic or receptor-mediated) or internal (intrinsic or mitochondrial) cell stimulation; both involve a preserved group of specific aspartate cysteineproteases called caspases that are synthesized as zymogens, which must undergo proteolytic fragmentation to activate. The activation of the initial caspase triggers a sequential death program, where executing caspases alter proteins of the cytoskeleton and nuclear matrix. The activation of caspase 3 releases the inhibitor of a cytoplasmic DNase (CAD) that gives rise to the internucleosomal fragmentation of DNA (9,11,12). In viral infections, the modulation of apoptosis has been associated with products of the virus, which can manipulate certain cells processes to allow the survival of their progeny (13-15). Hong et al (5) reported that the cytopathic effect (CPE) showed by cells infected with IPNV is a post apoptotic process, related to the suppression of the gene of the survival factor Mcl-1, a member of the antiapoptotic protein family Bcl-2; in contrast, Espinoza et al (13), reported that only 12% of the cell population infected with a strain of serotype VR-299 showed apoptosis, with cell death by necrosis taking precedence. Santi et al (10), observed no differences in the percentage of apoptosis in cells infected with recombinant strains of Spjarup serotype (Sp), including a strain that did not express VP5, suggesting that replacements or absences of certain residues of the sequence of the BH2 domain or other factor(s) of the virus could influence the development of this form of cell death. With this background, this study was undertaken to relate the induction level of apoptosis with the BH2 domain sequence and with the level of infectivity of three field strains of IPNV.

MATERIALES Y MÉTODOS

MATERIALS AND METHODS

Células y virus. Se utilizaron células Chinook salmon embryo (CHSE-214) para propagación de IPNV y en los ensayos para evaluar apoptósis. Las células se cultivaron a 20ºC en medio de cultivo Minimal Essential Medium con sales de Eagle (E-MEM), suplementado con 100 UI de penicilina/ml, 100 µg de estreptomicina/ ml y 10% (v/v) de suero fetal bovino (SFB). Una vez formada la monocapa, las células se mantuvieron en E-MEM suplementado con 2% (v/v) de SFB.

Cells and virus. Chinook salmon embryo (CHSE214) cells were used for the propagation of IPNV and in assays to assess apoptosis. Cells were cultured at 20ºC in a Minimal Essential Medium with Eagle (E-MEM) salts, supplemented with 100 IU of penicillin/ml, 100 µg of streptomycin/ml and 10% (v/v) of fetal bovine serum (FBS). Once the monolayer has been formed, cells were kept in E-MEM supplemented with 2% (v/v) of FBS.

Ortega - Relationship between apoptosis and the BH2

3993

Las cepas de virus utilizadas fueron obtenidas de casos clínicos de necrosis pancreática infecciosa (IPN). El virus V33/98 fue aislado en 1998 a partir de juveniles de salmón del Atlántico (Salmo salar) cuya infección ocasionó un 80% de mortalidad; el virus V70/06 se obtuvo en 2006 de juveniles de S. salar en los que se observó mortalidad inicial alta con evolución a baja mortalidad y cronicidad, mientras que el virus V112/06, se aisló de crías de trucha arcoíris (Oncorhynchus mykiss) donde se observó un 40% de mortalidad (16). Los virus se reactivaron por inoculación en células CHSE-214 pre-confluentes en E-MEM con 2% (v/v) de SFB; al presentar extenso efecto citopático (CPE), el cultivo se congeló por 24 h y posteriormente se descongeló y centrifugó durante 10 min a 4000 rpm a 4ºC; el título viral se calculó por el método de Reed y Muench (17).

The virus strains used were obtained from clinical cases of infectious pancreatic necrosis (IPN). The V33/98 virus was isolated in 1998 from juvenils of Atlantic salmon (Salmo salar) the infection of which caused a mortality of 80%; the V70/06 virus was obtained in 2006 from juvenils of S. salar in which high initial mortality was observed with evolution to low mortality and chronicity, while the V112/06 virus was isolated from rainbow trout fries (Oncorhynchus mykiss) where a mortality of 40% was observed (16). The virus was reactivated by inoculation in pre-confluent CHSE-214 cells in E-MEM with 2% (v/v) of FBS; when showing an extensive cytopathic effect (CPE), the culture was frozen for 24 h and then thawed and centrifuged for 10 min at 4,000 rpm at 4°C; the viral titer was calculated by the ReedMuench method (17).

Los siguientes códigos de acceso al GenBank se utilizaron para alineamiento y comparación de la proteína VP5 de IPNV: AAK71697 VP5 Ab/E1S; AY379740 VP5 de 12.1 kDa/Sp; Q69CI1 VP5 15 Kda IPNV/Sp; AAA92630 VP5 IPNV/VR-299; P10415 Bcl2 Humana-Apoptósis regulator.

The following access codes to the GenBank were used for the alignment and comparison of the VP5 protein of IPNV: AAK71697 VP5 Ab/E1S; AY379740 VP5 of 12.1 kDa/Sp; Q69CI1 VP5 15 Kda IPNV/Sp; AAA92630 VP5 IPNV/VR-299; P10415 Bcl2 Humana-Apoptosis regulator.

Amplificación de los genomas de VP2 y VP5 por RT-PCR. El RNA viral, fue aislado de sobrenadantes de cultivo celular mediante extracción en columna según especificaciones del Viral RNA mini Kit Q1Aamp® (Cat. No. 52904; QiAGEN Alemania). El ARN eluído en 50 µl de agua desionizada estéril tratada con dietil pirocarbonato se cuantificó por espectrofotometría y se congeló a –80ºC hasta su utilización.

Amplification of VP2 y VP5 genomes by RTPCR. The viral RNA was isolated from cell culture supernatants by column extraction according to specifications of the Viral RNA mini Kit Q1Aamp® (Cat. No. 52904; QiAGEN Germany). The RNA diluted in 50 µl of sterile deionized water treated with diethyl pyrocarbonate was quantified by spectrophotometry and frozen at -80°C until use.

La obtención y amplificación de cDNA se realizó utilizando 0,25 µg de Random primers (Promega) en 20 µl de solución de reacción. La amplificación de un producto génico de 1180 pb correspondiente a parte de la secuencia codificante de VP2 se realizó en un termociclador Gene Amp PCR System 2400® (Perkin Elmer) en un volumen de 50 µl; los primers utilizados para amplificación de VP2 y los parámetros de ciclos fueron iguales a lo descrito en Ortega et al (16). La amplificación del gen VP5 se realizó con cantidades de reactivos y ciclos similares como para VP2, sustituyendo los primers específicos para amplificar un producto de 450 pb: Fwd-5´ATGGCGAAGCCCTTTCTAAC-3´ y Rev-5´ACAGACTTCCTTCGAAGGTG-3´; ambos productos se sometieron a electroforesis en gel de agarosa al 1% con bromuro de etidio, aplicando corriente de 80 mA por 30 min en cámara SUB-CELL GT® y fuente de poder POWER-PAC 200® (BIORAD). Los geles se analizaron en transiluminador TFX-20.M ® (VILBER LOURMAT), detectando fragmentos de 1180 pb y 450 pb, correspondientes a VP2 y VP5, respectivamente.

The obtaining and amplification of cDNA was carried out using 0.25 µg of Random primers (Promega) in 20 µl of reagent solution. The amplification of a gene product of 1180 pb corresponding to a portion of the VP2 coding sequence was carried out in a thermal cycler Gene Amp PCR System 2400® (Perkin Elmer) in a volume of 50 µl; the primers used for the amplification of VP2 and cycle parameters were the same as described in Ortega et al (16). The amplification of the VP5 gene was carried out with quantities of reagents and similar cycles as for VP2, replacing specific primers to amplify a product of 450 pb: Fwd5´ATGGCGAAGCCCTTTCTAAC-3´ and Rev5´ACAGACTTCCTTCGAAGGTG-3´; both products were subjected to electrophoresis in agarose gel at 1% with ethidium bromide, applying a current of 80 mA for 30 min in a camera SUB-CELL GT® and power supply POWER-Cap 200® (BIO-RAD). The gels were analyzed in a transilluminator TFX20.M® (VILBER LOURMAT), detecting fragments of 1.180 bp and 450 bp, corresponding to VP2 and VP5, respectively.

3994

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Los segmentos de cDNA con parte de la secuencia codificante de VP2 y VP5 se extrajeron desde el gel de agarosa de acuerdo a instrucciones del proveedor de E.Z.N.A.® Gel Extraction Kit (OMEGA BIO-TEK) y una vez purificados, se enviaron a secuenciar. Las secuencias nucleotídicas obtenidas se tradujeron mediante ExPASy y la secuencia aminoacídica deducida de ambas proteínas se comparó con secuencias obtenidas en NCBI, utilizando el software Molecular Evolutionary Genetics Analysis version 4.0 MEGA4 (4,16).

Segments of cDNA with a portion of the VP2 and VP5 coding sequence were extracted from the agarose gel according to the instructions of the supplier of the E.Z.N.A.® Gel Extraction Kit (OMEGA BIO-TEK) and once purified, were sent to be sequenced. The nucleotide sequences obtained were translated using ExPASy and the amino acid sequence deduced of both proteins was compared with sequences obtained from NCBI, using the Molecular Evolutionary Genetics Analysis software version 4.0 MEGA4 (4,16).

Determinación del título viral en sobrenadante de cultivo de células. Para determinar diferencias en el nivel de infectividad y de replicación de los virus utilizados se inocularon células CHSE-214 a una multiplicidad de infección MDI=0.1 en botellas de cultivo de 25 cm2 y después de 12, 24, 36 y 45 h de incubación a 15°C las botellas se congelaron y descongelaron en dos ocasiones; el contenido fue centrifugado a 4.000 rpm por 10 min a 4°C y los sobrenadantes se titularon de acuerdo con el método de Reed y Muench (17). Los títulos obtenidos se representaron por el promedio de tres muestras con barra indicadora de desviación estándar.

Determination of the viral titer in cell culture supernatant. For determining differences in the level of infectivity and replication of the viruses used, CHSE-214 cells were inoculated to a infection multiplicity MDI=0.1 in 25 cm2 culture bottles and after 12, 24, 36 and 45 h of incubation at 15°C, the bottles were frozen and thawed twice; the content was centrifuged at 4.000 rpm for 10 min at 4°C and the supernatants were tittered in accordance with the Reed and Muench method (17). The titers obtained were represented by the average of three samples with a standard deviation indicator bar.

Detección de inducción de apoptósis en células CHSE-214. Células CHSE-214 con confluencia de 90% en cubreobjetos circulares de vidrio fueron infectadas por triplicado a MDI=10 con cada una de las cepas; tres cubreobjetos no fueron infectados para usarse como control negativo. Después de 8, 12 y 18 h de incubación a 15°C, las muestras se lavaron en PBS pH 7.2 y se fijaron durante 15 min en paraformaldehído al 4%. La apoptósis fue detectada por identificación de la fragmentación de ADN mediante ensayo TUNEL (Terminal Transferase Uridyl Nick End Labelling) de acuerdo a instrucciones del proveedor Apoptósis Detection Kit (USBiological T9162-180), y también por detección de caspasa 3 mediante ensayo inmuno-histoquímico, siguiendo recomendaciones del fabricante del producto Anti-ACTIVE® Caspase-3 pAb. Las muestras se analizaron bajo microscopio confocal; el número de células positivas en una muestra de aproximadamente 300 células fue obtenido, y se representó como el promedio de tres muestras independientes ± error estándar de la media (SEM). Los datos se analizaron mediante test de Friedman, con significancia estadística definida en valores de p<0.05.

RESULTADOS A 36 horas post-infección (hpi) las tres cepas de virus ocasionaron múltiples focos de efecto citopático (CPE) en las células infectadas; mediante inmunofluorescencia indirecta (IFAT) se demostró la presencia y distribución intracitoplasmática del

Detection of apoptosis induction in CHSE214 cells. CHSE-214 cells with a confluence of 90% in circular glass coverslips were infected by triplicate at MDI=10 with each of the strains; three coverslips were not infected to be used as negative control. After 8, 12 and 18 h of incubation at 15°C, the samples were washed in PBS pH 7.2 and fixed for 15 min in paraformaldehyde at 4%. Apoptosis was detected by the identification of the DNA fragmentation by TUNEL assay (Terminal Transferase Uridyl Nick End Labeling) according to instructions from the supplier Apoptosis Detection Kit (USBiological T9162-180), and also by detection of caspase 3 by immuno-histochemical assay, following the recommendations of the manufacturer of the product Anti-ACTIVE® Caspase-3 pAb. Samples were analyzed under a confocal microscope; the number of positive cells in a sample of approximately 300 cells was obtained, and was represented as the average of three independent samples ± standard error of the mean (SEM). Data were analyzed by the Friedman test, with statistical significance defined by p<0.05 values.

RESULTS Thirty-six hours after the infection (hpi), the three virus strains caused multiple cytopathic effect foci (CPE) in infected cells; the presence and intracytoplasmic distribution of the viral antigen (VP3 protein) was diffusely detected by indirect immunofluorescence (IFAT) showing areas of aggregation or inclusion bodies. The detection

Ortega - Relationship between apoptosis and the BH2 antígeno viral (proteína VP3) en forma difusa con áreas de agregación o cuerpos de inclusión. La detección del antígeno fue más tardía en V112/06. Las células sin infectar utilizadas como control negativo no mostraron fluorescencia (Figura 1).

Figure 1. Demonstration of intracytoplasmic expression of the IPNV VP3 protein in CHSE-214 cells infected with the virus V70/06, V112/06 and V33/98. Control, non-infected cells.

Los fragmentos génicos de 1180 y 450 pb, correspondientes a las proteínas VP2 y VP5 de IPNV fueron detectados mediante RT-PCR en las células infectadas con las tres cepas (No mostrado). La secuencia aminoacidica de VP2 fue comparada con la secuencia de las cepas de referencia Sp (Genbank AJ829474) y VR-299 (L40584); la secuencia de las cepas V70/06 (Genbank GU072916) y de V33/98 (Genbank GU072915) correspondieron al genogrupo Sp, con el que presentan porcentajes de identidad de 98 y 96%, respectivamente; la secuencia de la cepa V112/06 (Genbank GU072914) mostró un porcentaje de identidad de 96% con el genogrupo VR-299. El análisis de la secuencia de VP2 demuestra que los residuos implicados en la virulencia o infectividad de IPNV en la cepa V70/06 correspondieron a Pro217 y Ala-221; Ala-217 y Thr-221 para V112/06, y finalmente Pro-217 y Thr-221 para V33/98 (Tabla 1).

3995

of the antigen occurred later in V112/06. Noninfected cells used as negative control showed no fluorescence (Figure 1). The gene fragments of 1180 and 450 pb, corresponding to the VP2 and VP5 proteins of IPNV, were detected by RT-PCR in cells infected with the three strains (not shown). The amino acid sequence of VP2 was compared with the sequence of the Sp (Genbank AJ829474) and VR-299 strains (L40584); the sequence of the V70/06 (Genbank GU072916) and V33/98 strains (Genbank GU072915) corresponded to genogroup Sp, which show identity percentages of 98 and 96%, respectively; the sequence of the V112/06 strain (Genbank GU072914) showed a identity percentage of 96% with genogroup VR-299. The analysis of the VP2 sequence shows that the residues involved in the virulence or infectivity of the IPNV in the V70/06 strain corresponded to Pro-217 and Ala-221; Ala-217 and Thr-221 for V112/06, and finally Pro-217 and Thr-221 for V33/98 (Table 1). Regarding VP5, the genes of the three strains showed the four homology domains with Bcl-2, and initiated translation at codon 16. However, the VP5 ORF in V112/06 was 394 pb, coding 131 aa (15 kDa); while in V70/06 and V33/98 the ORF was composed of 351 pb, coding a truncated protein of 116 aa (13 kDa). The multiple alignment of VP5 sequences of V70/06 (JQ247979), V112/06 (JQ253903) and V33/98 (JQ253902), with the partial sequence of human protein Bcl-2 (P10415) and VP5 of strains E1S, 12 kDa and 15 kDa (10), was similar in BH4, BH1, and BH3 domains. However, the BH2 domain was only complete in V112/06, and partially truncated in V70/06 and V33/98. Residues 115 and 122 of VP5, which are homologous to residues Trp188 and Trp195 of Bcl-2 and that are considered critical to the antiapoptotic function of this protein, were Trp115 and Arg122 for V112/06; while V70/06 and V33/98 only showed Arg115 (Table 2).

Table 1. Multiple alignment of the deduced amino acid sequence of 60 residues of the hypervariable region of the IPNV VP2 protein. Residues 217 and 221 are shown in yellow, residue 243 characteristic of genotype in blue, residue 247 in green.

Sp [195] CTAAIAPRRYEIDLPSQRLPPVPATGALTTLYEGNADIVNSTTVTGDINFSLAEQPAIET V70/06 [195] CTAAIAPRRYEIDLPSQRLPPVPATGALTTLYEGNADIVNSTTVTGDINFSLAEQPAVET V33/98 [195] CTAATAPRRYEIDLPSQRLPPVPATGTLTTLYEGNADIVNSTTVTGDINFSLAEQPAVET VR-299 [195] CTAAIAPRRYEIDLPSERLPTVAATGTPTTIYEGNADIVNSTAVTGDITFQLEAEPVNET Jasper [195] CTAAIAPRRYEIDLPSERLPTVAATGTPTTIYEGNADIVNSTAVTGDITFQLEAEPVNET V112/06[195] CTAAIAPRRYEIDLPSERLPTVAATGTPTTIYEGNADIVNSTTVTGDVTFQLAAEPANET Ab [195] CTAAIAPRRYEXDLPSERLPTVAATGTPTTIYXGXGDIVNSTTVTGDISFSLANNPTADI **** ****** ****:***.*.***: **:* * .******:****:.*.* :*. :

[254] [254] [254] [254] [254] [254] [254]

3996

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Table 2. Sequence and structural homology of human protein Bcl-2 with protein VP5 of virus V70/06, V112/06, V33/98 and reference strains. Cepa BH3 BH1 BH2 Bcl-2 [97] E1S [59] 12kDa [45] 15kDa [45] V70/06 [43] V112/06[45] V33/98 [45] VR299 [60]

LRQAGDDF 104 —133 VVEELFRDGVNWGRIVAFFEF 153--184 HLHTWIQDNGGWD-AFVELY [202] LRSLGLRK 65 --84 LQMECEPDGTRVRPVAGDVTG 104--125 HAAGWA-LCPEWDHQCCNLR [143] LRGLRIRK 52 --70 LQMECEPDGAGVRPVAGDVAG 90-----------------------------LRGLRIRK 52 —-70 LQMECEPDGAGVRPVAGDVAG 90--111 HTTGRS-LCSERDAQRCHLR [129] LRGLRIRK 50 —-68 LQMECEPDGAGVRPVAGDVAG 88--109 HTTGRS-LCS---------- [117] LRGLRLRK 52 —-70 LQVESEPDGTGIRPVVGNITG 90--111 EPSRWALLCTQRDTECIHLP [130] LRGLRIRK 52 —-70 LQMECEPDGAGVRPVAGDVAG 90--111 HTTGRS-L------------ [117] LRGIRIRK 67 —-85 LQVESEPDGTRIRPVARDVTG 105--126 NPSRWS-VCTQWDPERCHLR [144]

BH4 domain excluded. The residues deemed critical in the apoptosis mechanism of Bcl-2 are shown in blue. Access codes to GenBank for VP5 of IPNV AAK71697 (E1S), AAQ75358 (12 kDa), Q69CI1 (15 kDa), AAA92630 (VR-299), P10415 (human Bcl-2)

El alineamiento múltiple de las secuencias de VP5 de V70/06 (JQ247979), V112/06 (JQ253903) y V33/98 (JQ253902), con la secuencia parcial de la proteína Bcl-2 humana (P10415) y con VP5 de las cepas E1S, 12 kDa y 15 kDa (10), fue similar en los dominios BH4, BH3 y BH1. Sin embargo, el dominio BH2 únicamente fue completo en V112/06, y fue parcialmente truncado en V70/06 y V33/98. Los residuos 115 y 122 de VP5, que son homólogos a los residuos Trp188 y Trp195 de Bcl-2 y que se consideran críticos para la función antiapoptótica de esta proteína, fueron Trp115 y Arg122 para V112/06; mientras que V70/06 y V33/98 solo presentaron Arg115 (Tabla 2). En general, los títulos virales de las tres cepas se incrementaron conforme se extendió la infección. A las 12 hpi las células infectadas con V70/06 y V112/06 presentaron un título viral ≤ a 1x100.66 TCID50/mL, mientras que en las infectadas con V33/98 fue de 1x103.5. A 24 y 36 hpi, V70/06 presentó mayores títulos que las otras dos cepas, pero a 45 hpi su título fue similar a V33/98 (1x107.5). Los títulos en V112/06 fueron menores a 36 y 45 hpi (Figura 2). El porcentaje de apoptósis obtenido en las células infectadas con las tres cepas fue similar (p>0.05); no se observó incremento progresivo entre los tiempos analizados, y en ningún caso el porcentaje fue mayor a 12%. En las células infectadas con V70/06, el porcentaje de apoptósis tuvo un incremento entre las 8 y 12 hpi, sin variación posterior (Figura 3). Las células usadas como control negativo, que no fueron infectadas presentaron menor porcentaje de apoptósis con respecto a las muestras infectadas.

In general, the viral titers of the three strains were increased as the infection spread. At 12 hpi, cells infected with V70/06 and V112/06 showed a viral titer ≤ 1x100.66 TCID50/mL, while in those infected with V33/98 it was 1x103.5. At 24 and 36 hpi, V70/06 showed more titers than the other two strains, but at 45 hpi its titer was similar to V33/98 (1x107.5). The titers in V112/06 were lower at 36 and 45 hpi (Figure 2).

Time (hpi)

Figure 2. Viral titers associated with cultures of CHSE-214 cells infected with IPNV strains at MOI=0.1; expressed as TCID50/ml.

% apoptotic cells

Con respecto a VP5, los genes de las tres cepas presentan los cuatro dominios de homología con Bcl-2, e inician la traducción en el codón 16. Sin embargo, el ORF de VP5 en V112/06 fue de 394 pb, codificando 131 aa (15 kDa); mientras que, en V70/06 y V33/98 el ORF estuvo compuesto de 351 pb, codificando una proteína truncada de 116 aa (13 kDa).

Time (hpi)

Figure 3. Percentage of apoptotic cells after infection with IPNV at MOI=10, evaluated by TUNEL assay.

Ortega - Relationship between apoptosis and the BH2

3997

caspase

overlapping

infection control IPNV

% apoptotic cells

Figure 4. Confocal microscopy pictures for apoptosis detection by TUNEL assay. The dUTP-FITC is observed as fluorescent green and the propidium iodide as fluorescent red. The overlapping image indicates positive TUNEL cells (arrow). Bar 10 µm.

Time (hpi)

Figure 5. Percentage of cells in apoptosis after infection with IPNV at MOI=10, evaluated by detection of caspase 3.

La figura 4 representa muestras positivas a la reacción del ensayo TUNEL y células positivas a la infección por IPNV. El perfil de activación de caspasa 3 evaluado mediante inmuno-ensayo (Figura 5) fue similar entre las tres cepas; pese a que a las 18 hpi es posible observar un ligero incremento con respecto a la lectura anterior, no se mostraron diferencias entre los tiempos evaluados (Figura 6), y el porcentaje de células en apoptósis no sobrepasó el 12% en los tiempos analizados (p>0.05).

DISCUSIÓN Varios productos de genes de virus ARN que afectan peces han sido reportados como reguladores de apoptósis (14); debido a que la proteína VP5 de IPNV presenta cuatro dominios de homología con proteínas de la subfamilia Bcl-2 (BH) de actividad antiapoptótica, se ha sugerido que durante su

overlapping

infection control IPNV

Figure 6. Confocal microscopy pictures for detection of caspase 3 in CHSE-214 cells infected with isolates of IPNV V70/06, V112/06 and V33/98. The anti-caspase 3 antibody is shown in fluorescent green and the propidium iodide in fluorescent red. The orange coloration of the overlapping images (Arrows) indicates cells positive to apoptosis. Bar 10 mm.

The percentage of apoptosis obtained in cells infected with the three strains was similar (p>0.05); there was no gradual increase between the times analyzed, and in any case the percentage was not greater than 12%. In cells infected with V70/06, the percentage of apoptosis increased between 8 and 12 hpi, without further variation (Figure 3). Cells used as negative control and not infected showed a lower percentage of apoptosis with respect to infected samples. Figure 4 shows positive samples to the reaction of the TUNEL assay and positive cells to the IPNV infection. The activation profile of caspase 3 examined by immunoassay (Figure 5) was similar among the three strains; despite the fact that at 18 hpi it is possible to observe a slight increase with respect to the previous reading, there were no differences between evaluated times (Figure 6), and the percentage of cells in apoptosis did not exceed 12% in the analyzed times (p>0.05).

DISCUSSION Several products of RNA virus genes affecting fish have been reported as regulators of apoptosis (14); since that VP5 protein of IPNV has four homology domains with proteins of the subfamily Bcl-2 (BH) with antiapoptotic activity, it has

3998

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

replicación el virus podría inhibir la apoptósis para multiplicarse. En este estudio, la proteína VP5 de las cepas utilizadas presentaron los cuatro dominios BH que son característicos de proteínas antiapoptóticas tipo Bcl-2. Sin embargo, el dominio BH2 que es considerado crítico para la actividad antiapoptótica fue truncado en V70/06 y V33/98, y fue completo en la cepa V112/06; pese a esto, no se observaron diferencias en el nivel de inducción de apoptósis entre las cepas, y el promedio no superó el 12% en los tiempos evaluados. Esto indica que el tamaño de VP5 no influye en la inducción de apoptósis, y está acorde con lo reportado por Santi et al (10), quienes observaron que IPNV puede inducir apoptósis independientemente del tamaño y expresión de la proteína VP5. Una situación similar se ha reportado con el virus de la peste porcina africana que contiene una proteína homóloga al inhibidor de apoptósis de baculovirus (IAP) que no es necesaria para el crecimiento viral in vitro, no modula la virulencia y tampoco influye en la inducción de apoptósis. Como posible explicación a lo anterior, Cuconati y White (18), indicaron que algunas proteínas Bcl2 virales pueden tener actividad antiapoptótica aun careciendo de alguno de los dominios BH, pero que el dominio BH2 es elemento clave para heterodimerizar con los promotores de muerte BAX y BAK. Para el caso de IPNV, dicha interacción se realizaría a través del residuo Trp155 de VP5 que correspondería al residuo Trp188 de Bcl-2, que es considerado un residuo crítico para cumplir la función anti-apoptótica; de acuerdo con esto, las cepas que expresan Trp-155 en VP5 deberían inhibir la apoptósis. En este sentido, Santi et al (10), propusieron que el hecho de no observar diferencias en el nivel de inducción entre las cepas de IPNV utilizadas en su estudio, pudo deberse a la ausencia del residuo Trp155. Sin embargo, pese a que en el presente estudio, VP5 de V112/06 presentó el residuo Trp-115 en BH2, no mostró diferencia de inducción con respecto a las otras cepas, por lo que la secuencia o sustitución de este residuo no es un factor crítico en la modulación de apoptósis. El resultado obtenido en este estudio mostró que la proteína VP5 de IPNV no participaría en la modulación de apoptósis, contrario a lo observado en la infección con el virus de la enfermedad infecciosa de la bursa (IBDV), que codifica una proteína homóloga que contiene una región transmembrana, pero carece de dominios de homología con Bcl-2, presenta un dominio PEST que usualmente está presente en proteínas de vida corta y de expresión temprana que cumplen actividad reguladora (19). Durante la replicación de IBDV, VP5 se acumula en la membrana celular,

been suggested that during replication the virus could inhibit the apoptosis to permit the viral replication. In this study, the VP5 protein of the strains used showed the four BH domains characteristic of Bcl-2 antiapoptotic proteins. However, the BH2 domain, which is considered critical to the antiapoptotic activity, was truncated at V70/06 and V33/98, and was complete in the V112/06 strain; despite this, there were no differences in the induction level of apoptosis between strains, and the average did not exceed 12% in the times evaluated. This indicates that the size of VP5 has no influence on the induction of apoptosis and is consistent with what was reported by Santi et al (10), who observed that IPNV may induce apoptosis regardless of the size and expression of the VP5 protein. A similar situation has been reported with the virus of the African swine fever that contains a homologous protein to the inhibitor of apoptosis of baculovirus (IAP) that is not necessary for in vitro viral growth, does not modulates virulence and has no influence on the induction of apoptosis. As a possible explanation for the above, Cuconati and White (18), pointed out that certain viral Bcl-2 proteins may have antiapoptotic activity even lacking some of the BH domains, but that the BH2 domain is a key element for heterodimerization with the BAX and BAK death promoters. In the case of IPNV, this interaction would take place through the residue Trp155 of VP5 that would correspond to residue Trp188 of Bcl-2, considered a critical residue for fulfilling the antiapoptotic function; accordingly, strains that express Trp-155 in VP5 should inhibit apoptosis. In this regard, Santi et al (10) proposed that the fact of not observing differences in the induction level among IPNV strains used in her study, could be due to the absence of the Trp155 residue. However, although in the present study the VP5 of V112/06 showed the Trp-115 residue in BH2, there was no difference in terms of induction with respect to other strains, so the sequence or substitution of this residue is not a critical factor in the modulation of apoptosis. The results obtained in this study showed that the IPNV VP5 protein would not participate in the modulation of apoptosis, contrary to what was observed in the infection with the infectious bursa disease virus (IBDV), that encodes a homologous protein containing a transmembrane region, but lacks homology domains with Bcl-2, shows a PEST domain that is usually present in short-lived and early-expression proteins that fulfill regulatory

Ortega - Relationship between apoptosis and the BH2 altera su morfología y provoca ruptura posterior, actuando como factor de muerte permitiendo la liberación de su progenie (12, 20, 21). La implicación de la proteína VP2 en la virulencia o infectividad de IPNV, está asociada a su secuencia aminoacídica; cepas que presentan los residuos Thr-217 y Ala-247 producen mayor título viral durante un ciclo de replicación, y se consideran de mayor virulencia (4). En este estudio, se observó que la infectividad de las cepas utilizadas no tuvo relación con el nivel de inducción de apoptósis en células CHSE-214; las cepas V70/06 y V33/98 correspondieron a cepas de virulencia media por presentar los residuos Pro-217 y Ala-247, y Pro217 y Thr221 respectivamente, mientras que en V112/06 la secuencia fue Ala-217 y Ala-247, relacionada a cepas avirulentas (4). Pese a que en general las curvas de replicación de las tres cepas mostraron un patrón similar de crecimiento, V112/06 produjo títulos menores, confirmándose como una cepa de menor infectividad. El porcentaje de apoptósis obtenido mediante pruebas de TUNEL e inmunoreacción no indica diferencias en las células infectadas con las cepas V70/06 y V33/98 de genotipo Sp y la cepa V112/06 de genotipo VR-299, evidenciando que el genotipo de la cepa no tiene relación con esta forma de muerte. Se ha indicado que el genoma dsRNA de IPNV puede desencadenar apoptósis por activación de la vía PKR que inhibe la traducción de proteínas celulares, y por la vía RNasa L que degrada los mRNA (22-24); más recientemente, Chiu et al (25), observaron que la proteína VP3 induce la expresión de BAD estimulando apoptósis a través de la vía mitocondrial. Estas aseveraciones respaldarían el hecho de que la apoptósis observada durante la infección por IPNV puede desarrollarse por razones independientes a las características de la cepa involucrada en la infección (14, 26). En respaldo a lo anterior, Imajoh et al (14), informa que células de Salmo salar positivas a la infección por IPNV, frecuentemente no expresan esta forma de muerte; sugiriendo que la apoptósis corresponde a un proceso de suicidio autónomo para eliminar células infectadas impidiendo la diseminación viral. Tras infectar células CHSE-214 con IPNV serotipo Ab, considerado de baja virulencia con respecto de cepas Sp y VR-299, Hong y Wu (27), determinaron que la apoptósis se relaciona con expresión del gen de muerte BAD, como factor temprano de estrés, inducido a través de receptores de tipo TNF. En relación a esto, Espinoza et al (13) proponen que si la apoptósis es iniciada vía receptor, el serotipo viral no influye en la activación del proceso. Esta propuesta concuerda con lo observado en este estudio, donde no se muestran diferencias en el promedio de apoptósis obtenido en las células

3999

activities (19). During the replication of IBDV, VP5 accumulates in the cell membrane, alters its morphology and causes subsequent rupture, acting as death factor allowing the release of its progeny (12, 20, 21). The involvement of the VP2 protein in the virulence or infectivity of IPNV is associated with its amino acid sequence; strains that show Thr-217 and Ala-247 residues produce more viral titer during a replication cycle, and are considered of greater virulence (4). In this study, it was observed that the infectivity of the strains used was unrelated to the induction level of apoptosis in CHSE-214 cells; strains V70/06 and V33/98 corresponded to average virulence strains by having the residues Pro217 and Ala-247, and Pro-217 and Thr221 respectively, while in V112/06 sequence was Ala-217 and Ala-247, related to avirulent strains (4). While overall the replication curves of the three strains showed a similar growth pattern, V112/06 produced less titers, confirming it as a strain with lower infectivity. The percentage of apoptosis obtained through TUNEL and immunoreaction assay does not show differences in cells infected with the strains V70/06 and V33/98 of the Sp genotype and strain V112/06 of genotype VR-299, evidencing that the genotype of the strain is not related to this form of cell death. It has been indicated that the IPNV dsRNA genome can trigger apoptosis by the activation of the PKR pathway that inhibits the translation of cellular proteins, and the RNase L pathway that degrades the mRNA (22-24); more recently, Chiu et al (25), observed that the VP3 protein induces the expression of BAD stimulating apoptosis through the mitochondrial pathway. These assertions would support the fact that apoptosis observed during infection by IPNV may develop for independent reasons from the characteristics of the strain involved in the infection (14, 26). In support of the foregoing, Imajoh et al (14) reports that Salmo salar cells positive to IPNV infection do not frequently express this form of death; suggesting that apoptosis corresponds to an autonomous suicide process for eliminating infected cells preventing the viral spread. After infecting CHSE-214 cells with Ab serotype IPNV, considered of low virulence with respect to Sp and VR-299 strains, Hong and Wu (27) determined that apoptosis is related with the expression of the BAD death gene, as an early stress factor induced through TNF receptors. In relation to this, Espinoza et al (13) propose that if apoptosis is initiated via the receptor,

4000

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

infectadas con las cepas V70/06 y V33/98 de serotipo Sp y la cepa V112/06 de serotipo VR-299. No obstante, se desconoce el receptor que pudiera modular el proceso. Tomando en cuenta que la apoptósis es un mecanismo de defensa temprano, el nivel obtenido con las tres cepas de este estudio hace evidente que IPNV es pobre inductor de este mecanismo de muerte, lo que concuerda con Espinoza et al (13), quienes observaron que el porcentaje de células apoptóticas fue menor de 12%, mientras que a 15 hpi el 75 % de la población celular presento necrosis; los resultados también estan de acuerdo con lo reportado por Hong y Wu (27), que observaron que aunque prácticamente todas las células fueron positivas a la infección, sólo un bajo porcentaje desarrolló apoptósis. En el presente estudio, se observó que el porcentaje de apoptósis obtenido durante la infección no tuvo relación con la presencia del residuo Trp-155 en la secuencia del dominio BH2 de IPNV; este resultado concuerda con investigaciones que indican que la apoptósis ocurre independientemente de la presencia o secuencia de algunos péptidos virales que tienen homología con Bcl-2 (14, 18, 26). Asimismo, en razón a que ni las diferencias en la secuencia de VP2 y VP5, ni la longitud de esta última influyen en el grado de apoptósis, probablemente otras variables como el tipo de tejido y la susceptibilidad de hospedero tendrían mayor relevancia, como se ha observado en caso de ISAV (28). Sin embargo, falta determinar la real participación de los componentes virales en la inducción de esta forma de muerte celular y en la patogénesis. En conclusión las diferencias en la secuencia de BH2 de la proteína VP5, la infectividad y en la secuencia de la proteína VP2 no están asociadas con la modulación de apoptósis. Agradecimientos Al Consejo Nacional de Ciencia y Tecnología (Conacyt) proyecto 99736 y proyecto PROMEP 103.5/09/4196; a la Escuela de Graduados y el Laboratorio de Biotecnología y Patología Acuática del Instituto de Patología Animal, Facultad de Ciencias Veterinarias de la Universidad Austral de Chile.

the viral serotype does not affect the activation of the process. This proposal is consistent with that observed in this study, where there are no differences in the average of apoptosis obtained in cells infected with V70/06 and V33/98 Sp serotype and V112/06 VR-299 serotype strains. However, the receptor that could modulate the process is unknown. Taking into account that apoptosis is an early defense mechanism, the level obtained with the three strains of this study evidences that IPNV is a poor inducer of this death mechanism, which is consistent with Espinoza et al (13), who observed that the percentage of apoptotic cells was less than 12%, while at 15 hpi 75% of the cell population showed necrosis; the results are also consistent with that reported by Hong and Wu (27), who observed that although practically all cells were positive to the infection, only a low percentage developed apoptosis. I n t h i s s t u d y i t wa s o b s e r ve d t h a t t h e percentage of apoptosis during infection was unrelated to the presence of the Trp155 residue in the sequence of the IPNV BH2 domain; this result is consistent with researches indicating that apoptosis occurs irrespective of the presence or sequence of certain viral peptides with Bcl-2 homology (14, 18, 26). Likewise, since neither the differences in the VP2 and VP5 sequence nor the length of the latter influence the degree of apoptosis, probably other variables such as the type of tissue and host susceptibility would have greater relevance, as observed in the case of ISAV (28). However, the actual participation of the viral components in the induction of this form of cell death and pathogenesis is yet to be determined. In conclusion, differences in the BH2 sequence of the VP5 protein and the infectivity in the sequence of the VP2 protein are not associated with the modulation of apoptosis. Acknowledgements To The National Science and Technology Council (Conacyt) project 99736 and project PROMEP 103.5/09/4196; to the Graduate School and the Biotechnology and Aquatic Pathology Laboratory of the Animal Pathology Institute, Faculty of Veterinary Sciences of Universidad Austral de Chile.

Ortega - Relationship between apoptosis and the BH2

4001

REFERENCES 1.

Roberts R, Pearson M. Infectious Pancreatic Necrosis in Atlantic salmon, Salmo salar L. J Fish Dis 2005; 28:383-389.

Bruslind L, Reno P. Virulence Comparison of Three Buhl-Subtipe Isolates of Infectious Pancreatic Necrosis Virus in Brook Trout Fry. JAAH 2000; 12:301-315.

Shivappa R, Song H, Yao K, Aas-Eng A, Evensen Ø, Vakharia V. Molecular characterization of Sp serotype strains of infectious pancreatic necrosis virus exhibiting differences in virulence. Dis Aquat Org 2004; 61:23-32.

Song H, Santi N, Evensen Ø, Vakharia V. Molecular Determinants of Infectious Pancreatic Necrosis Virus Virulence and Cell Culture Adaptation. J Virol 2005; 79:10289-10299.

Hong J, Hsu Y, Wu J. Infectious pancreatic necrosis virus induces apoptósis due to down-regulation of survival factor MCL-1 protein expression in a fish cell line. Virus Res 1999; 63:75-83.

Santi N, Song H, Vakharia V, Evensen Ø. Infectious Pancreatic Necrosis Virus VP5 Is Dispensable for Virulence and Persistence. J Virol 2005; 79:9206-9216. Sano M, Okamoto H, Fukuda H, Saneyoshi M, Sano T. Virulence of infectious pancreatic necrosis virus is associated with the larger RNA segment (RNA segment A). J Fish Dis 1992; 15:283-293.

12. Galloux M, Libersou S, Morellet N, Bouaziz S, Da Costa B, Ouldali M, Lepault J, Delmas B. Infectious Bursal Disease Virus, a Nonenveloped Virus, Possesses a Capsidassociated peptide That Deforms and Perforates Biological Membranes. J Biol Chem 2007; 282:20774-20784. 13. Espinoza J, Cortés M, Kuznar J. Necrosis of infectious pancreatic necrosis virus (IPNV) infected cells rarely is preceded by apoptósis. Virus Res 2005; 109:133-138. 14. Imajoh M, Hirayama T, Oshima S. Frequent occurrence of apoptósis is not associated with pathogenic Infectious Pancreatic Necrosis Virus (IPNV) during persistent infection. Fish Shellfish Immunol 2005; 18:163-177. 15. O´Brien V. Viruses and Apoptósis. J Gen Virol 1998; 79:1833-1845. 16. Ortega C, Rodríguez S, de las Heras A, Romero A, Monrás M, Enríquez R. Evaluation of the level of Mx3 protein synthesis induced by infectious pancreatic necrosis virus (IPNV) strains of different infectivity. Vet Immunol Immunopathol 2011; 141:190–200. 17. Reed J, Muench H. A simple method for estimating fifty percent end points. Am J Hyg 1938; 27:493-497. 18. Cuconati A, White E. Viral homologs of BCL2: role of apoptósis in the regulation of virus infection. Genes & Dev 2002; 16:465-2478.

Hong J, Gong H, Wu J. IPNV VP5, a Novel Anti-apoptósis gene of the Bcl-2 Family, Regulates Mcl-1 and Viral Protein Expression. Virol 2002; 295:217-229.

19. Liu M, Vakharia V. Nonstructural Protein of Infectious Bursal Disease Virus Inhibits Apoptósis at the Early Stage of Virus Infection. J Virol 2006; 80:3369-3377.

Weber S, Fichtner D, Mettenleiter T, Mundt E. Expression of VP5 of infectious pancreatic necrosis virus strain VR299 is initiated at the second in-frame start codon. J Gen Virol 2001; 82:805-812.

20. Lombardo E, Maraver A, Espinosa I, Fernández-Arias A, Rodríguez J. VP5, the Nonstructural Polypeptide of Infectious Bursal Disease Virus, Accumulates within the Host Plasma Membrane and Induces Cell Lysis. Virol 2000; 277:345-357.

10. Santi N, Sandtrø A, Sindre H, Song H, Hong J, Thu B, Wu J, Vakharia V, Evensen Ø. Infectious Pancreatic Necrosis Virus induces apoptósis in vitro and in vivo independent of VP5 expression. Virol 2005; 342:13-25. 11. Hong J, Lin T, Hsu Y, Wu J. Apoptósis Precedes Necrosis of Fish Cell Line with Infectious Pancreatic Necrosis Virus Infection. Virol 1998; 250:76-84.

21. Brandt M, Yao K, Liu M, Heckert R, Vakharia V. Molecular determinants of virulence, cell tropism, and pathogenic phenotype of infectious bursal disease virus. J Virol 2001; 75:11974-11982. 22. Wolf K. Fish viruses and fish viral diseases. Ithaca, N.Y. Canstock Publishing AssociatesCornell University Press, 1988.

4002

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

23. Lyles D. Cytopathogenesis and Inhibition of Host Gene Expression by RNA Viruses. Microbiol Mol Biol Rev 2000; 64:709-724. 24. Robertsen B. The interferon system of teleost fish. Fish Shellfish Immunol 2006; 20:172-191. 25. Chiu CL, Chou YL, Wu JL, Hong JR. Aquatic birnavirus capsid protein, VP3, induces apoptósis via the Bad-mediated mitochondria pathway in ﬁsh and mouse cells. Apoptósis 2010; 15:653-668. 26. Eléouet J, Druesne N, Chilmonczyk S, Momge D, Dorson M, Delmas B. Comparative Study of In-situ Cell Death Inducid by the Viruses of Viral Haemorrhagic Septicaemia (VHS) and Infectious Pancreatic Necrosis (IPN) in rainbow trout. J Comp Pathol 2001; 124:300-307.

27. Hong J, Wu J. Induction of apoptotic death in cells via Bad gene expression by Infectious pancreatic necrosis virus infection. Cell. Death Differ 2002; 9:113-124. 28. Joseph T, Cepica A, Brown L, Ikede B, Kibenge F. Mechanism of cell death during infectious salmon anemia virus infection is cell type-specific. J Gen Virol 2004; 85:3027-3036.

Rev.MVZ Córdoba 19(1):4003-4014, 2014. ISSN: 0122-0268 ORIGINAL

Evaluation of the physicochemical and functional properties of Colombian bee pollen Evaluación de las propiedades fisicoquímicas y funcionales del polen apícola colombiano Carlos Fuenmayor B,1,2 Ph.D, Carlos Zuluaga D,1 M.Sc, Consuelo Díaz M,1 Ph.D, Marta Quicazán de C,1* Ph.D, María Cosio,2 Ph.D, Saverio Mannino,2 Ph.D. Universidad Nacional de Colombia, Instituto de Ciencia y Tecnología de Alimentos – ICTA, Ciudad Universitaria, Av. Cra. 30 # 45-03 Ed. 500C, 111321. Bogotá, Colombia. 2Universidad de Milán, Departamento de Ciencias Alimentarias, Ambientales y Nutricionales, Via Mangiagalli 25, 20133 Milán, Italia. *Correspondencia: mcquicazand@unal.edu.co 1

Received: February 2013; Accepted: September 2013.

ABSTRACT Objective. To establish current knowledge about Colombian bee-pollen from a point of view nutritional and functional, contributing towards creating national technical standards and the identification of chemical differentiation factors for further researches. Material and methods. One hundred ninetysix samples of dried bee pollen were collected in the center region of Colombia known as Cundiboyacense high plateau, where nearly 90% of total bee pollen production is concentrated in this country. Performed physicochemical analyses in this study were: moisture, pH, acidity, ash, carbohydrates, lipids, proteins, dietary fiber, fatty acid profile and mineral elements. Results. Bee pollen from this region had 7.7±5.2 g/100 g moisture content, and a following centesimal composition based on dry matter: ashes 2.5±0.4 g; lipids 6.90±3.5 g; proteins 23.8±3.2 g and total dietary fiber 14.5±3.5 g. The most abundant fatty acids were α-linolenic, palmitic and linoleic. Carbohydrates were the main components and fructose and glucose the most concentrated sugars. The predominant minerals assessed here were potassium, calcium and magnesium. The results were also discussed in terms of the characteristics found in Colombian bee-pollen in comparison to international regulations and findings for other varieties of commercial bee-pollen from eight different countries. Conclusions. The results found in this study suggest that bee-pollen may be used as a dietary supplement and agree with bibliographical reports and international regulations. Such characterization will enable to be proposed technical standards in line with Colombian bee-pollen properties and it is expected to improve marketing and production chain conditions. Key words: Apis mellifera, dietary supplements food composition, food quality, physicochemical analysis (Source: DeCS).

4003

4004

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

RESUMEN Objetivos. Generar conocimiento actualizado sobre el polen colombiano desde un punto de vista nutricional y funcional, contribuyendo a la creación de estándares técnicos nacionales y la identificación de factores químicos de diferenciación para futuras investigaciones. Materiales y métodos. Ciento noventa y seis muestras de polen seco fueron recolectadas en la región central de Colombia conocida como el altiplano cundiboyacense, donde se concentra cerca del 90% de la producción total en este país. Los análisis fisicoquímicos realizados en este estudio fueron: humedad, pH, acidez, cenizas, carbohidratos, lípidos, proteínas, fibra dietaria, perfil de ácidos grasos y minerales. Resultados. El polen de esta región tuvo un contenido de humedad de 7.7±5.2 g/100 g y una composición centesimal basada en materia seca: cenizas 2.5±0.4 g; lípidos 6.90±3.5 g; proteínas 23.8±3.2 g y fibra dietaria total 14.5±3.5 g. Los ácidos grasos más abundantes fueron α-linolénico, palmítico y linoleico. Los carbohidratos fueron los componentes principales con fructosa y glucosa siendo los azúcares más concentrados. Los minerales predominantes evaluados fueron potasio, calcio y magnesio. Los resultados también fueron discutidos en términos de las características encontradas en el polen colombiano en comparación a normatividades internacionales y hallazgos para otras variedades de polen comercial de ocho países diferentes. Conclusiones. Los resultados encontrados en este estudio sugieren que el polen apícola puede ser utilizado como suplemento dietario y es coherente con los reportes bibliográficos y normativas internacionales. Tal caracterización permitirá proponer estándares técnicos de acuerdo a las propiedades del polen colombiano y se espera que se mejore la comercialización y las condiciones de la cadena de producción. Palabras clave: Apis mellifera, análisis fisicoquímico, composición de alimentos y suplementos dietarios, calidad de alimentos (Fuente: DeCS).

INTRODUCCIÓN

INTRODUCTION

El polen de abeja, también conocido como polen apícola, polen corbicular o polen de abeja recogido, es la principal fuente de proteínas para las colonias de abejas. Las abejas obreras transportan este recurso desde las flores a la colmena sobre sus patas traseras como gránulos que forman con los movimientos de sus patas delanteras usando peines, pelos y secreciones salivares (1). Una vez en la colmena, las abejas almacenan el polen en celdas donde se somete a procesos similares al ensilado, antes de ser consumido por crías y adultos; luego es conocido como pan de abeja (2). El manejo adecuado de la colmena promueve la recolección adicional de polen dirigido a su comercialización para el consumo humano, ya que puede ser considerado como alimento o un aditivo alimentario debido a su contenido de una amplia gama de nutrientes (1,3-5). También representa un complemento dietario funcional, especialmente debido a sus capacidades antioxidantes y antimicrobianas, su composición de micronutrientes, su perfil de ácidos grasos y sus funciones terapéuticas o preventivas de enfermedades (6-9).

Bee pollen, also regarded, as apicultural pollen, corbicular pollen, or bee-collected pollen, is the main source of protein for bee colonies. Worker bees transport this resource from flowers into the hive by carrying it on their hind legs as pellets that they form with movements of their front legs using combs, hairs and salivary secretions (1). Once in the hive, bees store pollen in cells where it undergoes processes similar to ensiling, prior to being eaten by pups and adults; it is then referred to as bee bread (2). Proper hive management promotes additional pollen collection aimed at marketing it for human consumption, since it can be considered as food or food additive due to its content of a wide range of nutrients (1,3-5). It also represents a functional dietary supplement, especially because of its antioxidant and antimicrobial activities, its micronutrients composition, its fatty acid profile and its therapeutic or diseasepreventing functions (6-9).

Los apicultores ubican trampas en la entrada de la colmena a través de las cuales las abejas obreras no pueden pasar fácilmente con ambas patas gránulos de polen y se ven obligadas a soltarlos en bandejas que son retiradas periódicamente y de las cuales se remueven los gránulos de polen y son sometidos a un proceso posterior para prolongar su vida útil,

Beekeepers thus locate traps in the hive entrance through which the worker bees cannot pass easily with both legs carrying pollen pellet so they are forced to drop them onto trays which are periodically withdrawn and from which pollen pellets are removed and subjected to further processing for prolonging shelf-life, usually drying processes.

Fuenmayor - Evaluation of the physicochemical and funtional of bee pollen generalmente mediante procesos de secado. La comercialización y consumo actual de polen ha alcanzado recientemente cierta difusión; sin embargo, este producto era prácticamente desconocido como un producto alimenticio durante mucho tiempo, excepto por consumidores vegetarianos o naturistas (10). En la actualidad existen sólo pocos países (por ejemplo, España, China, Hungría, Argentina y Brasil) donde la producción de polen es económicamente significativa; aún así, el mercado de consumo de polen se ha fortalecido durante el último par de décadas (11). Países como Brasil, Argentina, Suiza, España y México han establecido estándares oficiales de calidad y han reconocido al polen como un producto alimenticio (12). Las características fisicoquímicas del polen dependen de su origen botánico (1). Aunque se pueden encontrar algunos estudios sobre la composición nutricional del polen de abeja en países como Brasil (1), España (4), Australia (13), Argentina (14), Argelia (15), China (16) y Sudáfrica (3), no se ha publicado ningún estudio significativo sobre el polen de abeja colombiano aunque su producción en Colombia ha aumentado constantemente durante la última década debido principalmente a condiciones climáticas excepcionales (17). El objetivo de esta investigación fue caracterizar el polen de abeja colombiano, proveniente del altiplano cundiboyacense colombiano, desde el punto de vista nutricional y funcional, para contribuir al establecimiento de normas técnicas nacionales y reglamentación oficial, llevando así a establecer un etiquetado sobre la denominación de origen. Los resultados obtenidos son comparados con la normatividad internacional y la bibliografía de referencia, así como con las muestras de polen de abeja comercial de varios países.

MATERIALES Y MÉTODOS Tipo de estudio y muestras. Este trabajo de investigación ha sido realizado en el marco del proyecto Estrategias para Establecer la Denominación de Origen de Productos Apícolas en Colombia, financiado por el Ministerio de Agricultura y Desarrollo Rural de Colombia, que contó con la participación de asociaciones de apicultores del altiplano cundiboyacense. En total se recolectaron 196 muestras de polen de abeja (Apis mellifera). Estas muestras se secaron y sus impurezas fueron removidas de la forma como los apicultores normalmente lo hacen (2 horas de secado utilizando hornos de aire forzado, con una temperatura inicial del aire menor a 43°C, seguida por tamizado y un proceso de gradiente de densidad para eliminar las impurezas). Las muestras fueron recolectadas durante los años 2008 y 2011.

4005

C o n t e m p o ra r y p o l l e n c o n s u m p t i o n a n d marketing has recently achieved certain diffusion; however, this product went practically unrecognized as a food product for a long time, except by vegetarian or naturist consumers (10). At present there are only few countries (i.e. Spain, China, Hungary, Argentina and Brazil) where pollen production is economically significant; even so, the pollen consumer market has strengthened during the last couple of decades (11). Countries such as Brazil, Argentina, Switzerland, Spain and Mexico have established official quality standards and recognized pollen as a food product (12). Physicochemical characteristics of bee pollen depend on its botanical origin (1). Although some work on the nutritional composition of bee pollen from countries like Brazil (1), Spain (4), Australia (13), Argentina (14), Algeria (15), China (16) and South Africa (3) can be found, no significant study has been published about Colombian bee pollen even though production in Colombia has been constantly increasing over the last decade mainly due to exceptional climatic conditions (17). The objective of this research was aimed at characterizing Colombian bee pollen, coming from the colombian cundi-boyacense high plateau, from a nutritional and functional point of view, to contribute towards establishing national technical standards and official regulation, thereby leading to establishing origin-denomination labeling. The obtained results are compared to international normativity and referenced bibliography, and also, to samples of commercial bee-pollen from several countries.

MATERIALS AND METHODS Type of study and samples. This research work has been made in the context of the project Strategies for establishing Designation of Origin of bee products in Colombia, funded by the Ministry of Agricultural and Rural Development of Colombia, which involved the beekeepers’ associations of the Cundiboyacense high plateau. In total, 196 beepollen samples (Apis mellifera) were collected. These samples were dried and impurities were removed as beekeepers usually do (2-hour drying using forced-air ovens, with initial air temperature below 43°C, followed by sieving and a density-gradient process for removing impurities). The samples were collected during 2008 and 2011.

4006

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Además, nueve muestras de polen comercial de la India, China, Rumania, España, Bulgaria, Hungría y Polonia fueron proporcionadas por fabricantes y comercializadores de polen de los respectivos países durante la exposición del Congreso Mundial de Apicultura 41 - Apimondia, celebrado del 15 al 20 de septiembre de 2009, en Montpellier, Francia. Todas las muestras fueron llevadas al laboratorio en la presentación comercial habitual donde fueron molidas utilizando un tamiz de 1.5 mm y conservadas a 4°C en la oscuridad hasta que fueran analizadas. Coordenadas del sitio del estudio. Las coordenadas geográficas del altiplano cundiboyacense colombiana según el IGACORSTOM (18) están relacionadas en la Tabla 1. Métodos de laboratorio pH y acidez. Se mezclaron 2.5 g de muestra previamente pesado con agua libre de CO2 y se inició la titulación con 0.05 N de NaOH hasta un pH de 8.5. El pH fue calculado utilizando un potenciómetro previamente a la titulación (10).

In addition, nine samples of commercial beepollen from India, China, Romania, Spain, Bulgaria, Hungary and Poland were provided by manufacturers and marketers houses of pollen from the respective countries during the trade fair of the 41st World Congress of Apiculture Apimondia, September 15th to 20th, 2009, in Montpellier, France. All samples were brought to laboratory in the usual commercial presentation where they were ground using a 1.5 mm sieve and kept at 4°C in the dark until being analyzed. Coordinates of the study site. Geographical coordinates of the colombian Cundi-boyacense high plateau according to IGAC-ORSTOM (18) are related in table 1. Table 1. List of geographical coordinates of the Cundiboyacense high plateau (18). Location

Latitude (N)

Longitude (W)

North-West

5°55’45.29’’

72°59’02.26’’

North-East

5°46’45.55’’

73°42’48.08’’

South-West

4°28’06.53’’

74°05’16.96’’

South-East

4°52’16.47’’

74°24’12.10’’

Humedad. Se pesó una muestra de 3 g y fue calentada a 65°C durante 24 h. El contenido de humedad fue obtenido por la diferencia (10).

Laboratory methods

Lípidos. Los lípidos se determinaron por el método Soxhlet donde fueron extraídos de la matriz alimentaria mediante arrastre con solvente; este último se separó de los lípidos por calentamiento -AOAC 920.39- (19).

pH and acidity. 2.5 g of previously weighed sample was mixed with CO2-free water and titration was started with NaOH 0.05 N until pH 8.5. pH is calculated by using a potentiometer previously to titration (10).

Proteínas. Se determinó siguiendo el método de Kjeldahl con la variación de Winkler. El ácido bórico se utilizó para cuantificar el contenido de nitrógeno en la muestra, aplicando un factor de conversión de N x 6.25 -AOAC 984.13- (19).

Moisture. 3 g of sample was weighed and heated at 65°C for 24 h. Moisture content was obtained by difference (10).

Cenizas y minerales. La ceniza fue determinada a través de gravimetría después de incineración en un horno a 600°C hasta un peso constante. Los minerales fueron determinados mediante el uso de la ceniza obtenida de esta forma después de las etapas de digestión y dilución. Se utilizó un espectrómetro de absorción atómica AA 240 (Varian Inc., EE.UU.) para tomar mediciones de minerales de acuerdo a las siguientes longitudes de onda: Na: 599 nm, Mg: 285 nm, K: 766.5 nm, Ca: 422.7 nm, Zn: 213.9 nm y Fe: 248.3 nm -AOAC 968.08- (19). Fibra dietaria. La fibra dietética se determinó utilizando polen seco y desengrasado, con un tratamiento enzimático de α-amilasa, proteasa y amiloglucosidasa. Una etapa de filtración posterior permite la obtención de fibra dietaria soluble;

Lipids. Lipids were determined by the Soxhlet method in which they were extracted from the food matrix by solvent drag; this latter is then separated from lipids by heating -AOAC 920.39(19). Protein. It was determined following the Kjehldahl method with the Winkler variation. Boric acid was used for quantifying nitrogen content in the sample, applying an N x 6.25 conversion factor -AOAC 984.13- (19). Ash and minerals. Ash determination was made through gravimetry after incineration in an oven at 600°C until constant weight. Minerals were determined by using the ash so obtained after digestion and dilution stages. An AA 240 atomic absorption spectrometer (Varian Inc, USA) was used for taking mineral measurements according

Fuenmayor - Evaluation of the physicochemical and funtional of bee pollen mientras tanto, la fibra dietaria insoluble se obtiene por precipitación con etanol -AOAC 985.29- (19,20). Azúcares. Se utilizó HPLC para la evaluación de carbohidratos simples. Se agregaron 40 ml de agua esterilizada ultrapura a 5 g de las muestras previamente pesadas para extraer los azúcares. La solución obtenida fue inyectada en el cromatógrafo (sistema de bomba Jasco PU980), mediante el uso de una columna de Varian de 30x0.78 cm (MetaCarb Ca Plus A5205). Se utilizó agua desgasificada como fase móvil con un flujo de 0.5 ml/min y la temperatura se fijó en 80°C (horno Jasco, CO-2065 Plus). Se usó un detector de índice de refracción (Jasco, RI203 Plus) para la detección del contenido de fructosa, glucosa y sacarosa. Este procedimiento fue adaptado de la metodología propuesta por el método -AOAC 979.23- (19). Perfil de ácidos grasos. La composición de ácidos grasos se determinó mediante cromatografía de gases, según AOAC 969.33 (19). Los extractos fueron obtenidos mediante el uso de éter de petróleo como solvente y se sometieron a derivatización con metóxido de sodio hasta obtener una emulsión. Los ésteres metílicos producidos fueron medidos mediante cromatografía en un sistema Agilent 7890A mediante un columna de 30 m x 0.25 mm x 0.25 µm (OSGE BPX 70). La temperatura del inyector se fijó en 210°C, el detector temperatura a 220° C y la temperatura de la columna se mantuvo a 180°C. El caudal del gas (He) portador fue de 1 a 1.5 ml/min. La identificación y cuantificación de ácidos grasos se realizó mediante la comparación de los tiempos retención con los estándares que se inyectaron el mismo día. Análisis estadístico. Las medias y desviaciones estándar fueron calculadas mediante el software Microsoft® Excel.

RESULTADOS Las muestras de polen para este estudio fueron tomadas de la región más importante para esta actividad apícola en Colombia, abarcando la mayoría de las variedades disponible en el mercado de este producto en el país. Esta región es el altiplano cundiboyacense que se encuentra localizado a una altitud superior a los 2.500 msnm, en la parte central de los Andes orientales colombianos. Se compone de tierras llanas y altas entre los departamentos de Cundinamarca y Boyacá, con una temperatura media de 15°C que puede variar desde 0 hasta 24°C. Se caracteriza por ser muy fértil para una gran variedad de especies de plantas y tiene temporadas alternantes de floración para varias plantas autóctonas, arbustos y cultivos de importancia económica

4007

to the following wavelengths: Na: 599 nm, Mg: 285nm, K: 766.5 nm, Ca: 422.7 nm, Zn: 213.9 nm and Fe: 248.3 nm -AOAC 968.08- (19). Dietary fiber. Dietary fiber was determined by using dried and degreased pollen, with an enzymatic treatment of α-amylase, protease and amyloglucosidase. A posterior filtration stage allows obtaining the soluble dietary fiber; meanwhile, insoluble dietary fiber is obtained by precipitation with ethanol -AOAC 985.29(19,20). Sugars. HPLC was used for assessing simple carbohydrates. 40 ml of ultrapure sterilized water were added to 5 g of the previously weighed samples to extract sugars. The obtained solution was injected into the chromatograph (Jasco PU980 pump system), by using a 30 cm x 0.78 cm Varian column (MetaCarb Ca Plus A5205). Degasified water was used as mobile phase at 0.5 ml/min flow rate, and temperature was set at 80°C (Jasco, CO-2065 Plus oven). A refraction index detector (Jasco, RI-203 Plus) was used for detecting fructose, glucose and sucrose content. This procedure was adapted from the methodology proposed by method -AOAC 979.23- (19). Fatty acids profile. Fatty acid composition was determined by gas chromatography, according to AOAC 969.33 (19). The extracts were made by using petroleum ether as solvent and underwent derivatization with sodium methoxide until an emulsion was obtained. The methylic esters produced were measured by chromatography in an Agilent 7890A system with a 30 m x 0.25 mm x 0.25 µm column (OSGE BPX 70). Injector temperature was set at 210°C, detector temperature was 220°C and column temperature was maintained at 180°C. Carrier gas (He) flow rate was 1 to 1.5 ml/min. Fatty acid identification and quantification was done by comparing retention times with standards injected the same day. Statistical analysis. Means and standard deviations were calculated by using the software Microsoft® Excel.

RESULTS The bee pollen samples for this study were taken from the most important region for this apicultural activity in Colombia, covering most commercially available varieties of this product in the country. This region is the Cundiboyacense high plateau which is located at an altitude higher than 2500 m.a.s.l., on the central part of the colombian eastern Andes.

4008

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

durante todo el año. El altiplano cundiboyacense incluye un orobioma de los Andes, caracterizado por la presencia de zonas agrícolas mixtas, pastos para producción lechera, arbustos y vegetación endémica de páramo húmedo en las partes más altas. La mayoría de los apicultores de esta región han formado asociaciones y cooperativas que, junto con el aumento en la demanda, han mejorado esta actividad, estimulando a muchos apicultores a enfocarse exclusivamente en la producción de polen. En esta región puede encontrarse simultáneamente un gran número de especies de plantas que proveen polen para las abejas Apis mellifera, haciendo que las muestras exhiban una multiplicidad de colores de gránulos y la imposibilidad práctica de tener un polen de abeja monofloral. Aunque en este estudio no se realizó una caracterización palinológica, Nates-Parra et al (21) en un informe anterior, revelaron que Melastomatacea y Fabaceae (incluyendo sus tres subfamilias), Asteracea, Myrtaceae, Euphorbiacea fueron las familias de plantas más importantes que proporcionan polen en el altiplano cundiboyacense. Para los resultados fisicoquímicos del polen colombiano, se calculó la media y la desviación estándar para todos los datos. En la tabla 2 se presenta la composición promedio del polen de abeja así como los datos de las regulaciones en Brasil, México y Argentina. Por otro lado, en las tablas 3 y 4 se muestran los resultados para la composición promedio de minerales y ácidos grasos, respectivamente.

Table 3. Colombian bee pollen mineral elements (mg/ kg) (Dry basis) Mineral

Mean

Minimum

Maximum

Sodium

99.3

79.5

8.9

206

Potassium

5.625

1.176

3.058

7.616

Calcium

1.717

310

1.099

2.409

Iron

70.7

27.8

23.2

126.6

Magnesium

1.029

396

343

1542

Zinc

47.4

21.6

19.8

70.6

Por su parte, se analizó el polen comercial de ocho países para realizar una comparación de sus propiedades fisicoquímicas con respecto al producto de las abejas colombianas, que se presentan en la tabla 5.

Table 2. Chemical analysis of colombian bee-pollen and some international regulatory specifications. Results

Regulatory specifications CCHP

Mean ±SD 4.6 ±0.4

Argentina

Min

Max

3.8

5.4

Min 4 Max 6 -

Acidity (meq/kg)*

256 ±67

155

402

Moisture (g/100 g)

7.7 ±5.2

1.8

11.8 Max 8

Ash (g/100 g)*

2.5 ±0.4

1.5

3.2

Max 4

Lipid (g/100 g)*

6.9 ±3.5

2.8

9.7

Protein (g/100 g)*

23.8 ±3.2

16.1 32.1

Fructose

19.5 ±0.9

18.1 21.3

Glucose

13.6 ±2.4

Min 15 Max 28

Brazil Min 4 Max 6 Max 300

Mexico Min 4 -

Max 4

Min 4.5 Max 8

Max 4

Min 1.5 Max 2.2

Min 1.8

Min 2.5 Max 6.5

Min 8

Min 12 Max 18

Carbohydrates (g/100 g)*

Sucrose

6.7 ±2.0

11.6 20.3

4.5

9.0

Soluble Dietary 2.7 Fiber ±1.8 (g/100 g)*

0.5

4.6

Insoluble Dietary 11.7 Fiber ±3.3 (g/100 g)*

6.5

17.6

Total Dietary Fiber 14.5 (g/100 g)* ±3.5

7.8

18.1

Min. 2

CCHP= Colombia Cundiboyacense High Plateau *Dry basis. Min: minimum. Max: maximum.

It consists of flat and high lands between the Cundinamarca and Boyacá departments, having a 15°C mean temperature which can range from 0 to 24°C. It is characterized by, being very fertile for a wide variety of plant species and having alternating flowering seasons for several native plants, shrubs and economically important crops throughout the whole year. The Cundiboyacense high plateau has an Andes orobiome, characterized by the presence of mixed agricultural areas, pasture for dairy production, shrub land and damp moor shaving endemic vegetation in the highest parts. Most beekeepers from this region have formed associations and cooperatives, which, together with increasing demand, have enhanced this activity, stimulating many beekeepers to focus exclusively on pollen production. In this region a large number of plant species can be found simultaneously providing pollen for Apis mellifera bees, causing the samples to display a multiplicity of pellet colors and the practical impossibility of having monofloral bee pollen. Although in this study it was not performed a palynological characterization, Nates-Parra et al (21) in a previous report revealed that Melastomatacea and Fabaceae

4009

Fuenmayor - Evaluation of the physicochemical and funtional of bee pollen

(including its three sub-families), Asteracea, Myrtaceae, Euphorbiacea were the most important plant families providing pollen in the Cundiboyacense high plateau.

Table 4. Main fatty acids found in Colombian bee pollen (mg/100 mg lipids) (Dry basis). Fatty acid

Mean ±

SD Minimum Maximum

[C12:0]Lauric

4.61

± 2.05

0.85

[C14:0]Miristic

1.33

± 0.44

0.49

2.65

11.33 ± 2.82

6.30

16.59 3.04

[C16:0]Palmitic

9.12

[C18:0] Stearic

1.88

± 0.41

1.07

[C18:1n9c] Oleic

2.38

± 0.51

1.29

3.89

[C18:2n6c] Linoleic

8.19

± 1.40

5.74

12.51

25.68 ± 7.85

[C18:3n3] α-Linolenic

6.83

41.99

[C20:0] Arachidic

1.27

± 0.32

0.63

1.54

[C20:3n6c] Homo-γ-linolenic

1.62

± 1.17

0.18

5.33

(C23:0) Tricosanoic

1.17

± 0.60

0.24

2.26

Saturated Fatty Acids (%)

36.62 ± 4.92

27.31

50.79

Unsaturated fatty acids (%)

63.38 ± 4.92

49.21

72.69

Total Fatty acids (ω-3) (%)

37.86 ± 7.43

14.97

51.26

Total Fatty acids (ω-6) (%)

15.02 ± 2.59

9.92

23.12

Total Fatty acids (ω-9) (%)

8.45

± 1.58

4.87

13.08

Unsaturated / Saturated ratio

1.78

± 0.36

0.97

2.66

(ω-3) / (ω-6) ratio

2.64

± 0.86

0.86

4.78

For the physicochemical results of colombian bee-pollen, the mean and standard deviation were calculated for all data. Table 2 presents average bee-pollen composition as well as the data of Brazilian, Mexican and Argentinean regulations. On the other hand, tables 3 and 4 show results for average mineral and fatty acid composition, respectively. On the other hand, commercial bee-pollen from eight countries was analyzed to make a comparison of its physicochemical properties with respect to colombian bee product, which they are presented in table 5.

Table 5. Average physicochemical composition of commercial bee-pollen samples from several countries. Hungary

Poland

Slovenia

India

Romania

Spain [1] [2]

China

Bulgaria

4.4

4.5

5.4

4.3

4.9

4.4

4.8

5.0

4.4

Free acidity (meq-kg)

243

332

207

383

237

241

196

351

310

Moisture (g/100 g)

4.9

4.0

5.9

9.1

5.1

5.2

4.4

2.0

4.6

Ash (g/100 g)*

1.7

2.6

2.4

3.3

2.3

1.6

1.5

4.3

1.8

Lipids (g/100 g)*

4.9

5.7

5.9

8.0

4.9

5.0

5.6

5.2

5.6

16.3

25.6

21.4

26.1

22.3

20.8

15.8

17.6

19.2

Protein (g/100 g)*

219

236

240

113

379

198

125

199

Potassium (mg/kg)*

Sodium (mg/kg)*

3607

5797

5244

4794

4869

3622

4487

9542

4608

Calcium (mg/kg)*

1461

1654

1462

2376

1657

589

468

1620

665

Iron (mg/kg)*

40.9

56.2

42.1

197.7

89.4

57.7

28.8

63.3

47.4

Magnessium (mg/kg)*

635

1194

1135

1430

865

484

453

2636

577

Zinc (mg/kg)*

34.3

53.2

44.3

31.3

48.7

44.3

26.1

31.4

51.9

Insoluble Dietary fiber (g/100 g)*

9.6

5.7

12.8

8.0

8.6

8.2

5.9

Soluble Dietary fiber (g/100 g)*

0.8

2.3

1.7

0.9

3.2

1.7

2.0

10.5

8.1

14.6

9.0

11.9

10.0

7.9

Total dietary fiber (g/100 g)* * Dry basis.

DISCUSIÓN

DISCUSSION

Acidez y pH. El pH del polen de abeja colombiano varió entre 3.8 y 5.4 y presentó un valor promedio general de 4,6 (±0.4); la acidez osciló entre 155 y 402 meq/kg con 256 (±67) meq/kg como valor medio. Estos dos parámetros fueron correlacionados inversamente, como era de esperarse. A excepción de algunos estudios que generalmente se ocupan de los cambios bioquímicos que el polen sufre dentro de una colmena cuando se convierte en pan de abeja (22), rara vez se ha evaluado la acidez del polen. El pH, por otro lado, ha sido utilizado como indicador de calidad, ya que es un parámetro fácil

Acidity and pH. The pH of colombian beepollen varied between 3.8 and 5.4 and presented a 4.6 (±0.4) general mean value; acidity ranged from 155 to 402 meq/kg with 256 (±67) meq/kg as mean value. These two parameters were inversely correlated, as expected. Except for a few works usually dealing with the biochemical changes that pollen suffers inside a bee hive when becoming beebread (22), bee pollen acidity has rarely been assessed. pH, on the other hand, has been used as quality indicator, since it is an easy-to-assess parameter. An elevated acidity

4010

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

de evaluar. Una elevada acidez o un bajo pH puede ser el resultado de actividad microbiana indeseable (23). La regulación argentina establece un intervalo de pH de 4 a 6, que, según los resultados, parece también ser preciso para el polen colombiano. En comparación con el polen de abeja de otros países que se muestra en la tabla 5, se puede encontrar que los valores de pH y acidez son similares al polen del colombiano. En particular, la acidez del polen de Polonia, India, China y Bulgaria son superiores a 300 meq/kg y ésos no satisfarían la normatividad brasileña. Humedad. Los apicultores reducen el contenido de humedad en el polen mediante secado (a partir de los valores iniciales que oscilan entre el 18% y el 34% en el altiplano cundiboyacense) (10) para reducir la actividad acuosa y así evitar el deterioro microbiano. El polen de abeja colombiano varía de 1.8 a 11.8 g/100 g en el presente estudio y presentó un valor medio de 7.7 (±5.2) g/100 g. La mayoría de las muestras (93%) cumplían con la norma argentina del 8% como contenido máximo permisible de humedad pero sólo el 19% de las mismas cumplían con las regulaciones brasileñas que indican un máximo de 4%. El polen de abeja menor aproximadamente ~6 g/100 g se encuentra en el rango aceptable para la estabilidad de almacenamiento, teniendo en cuenta que un contenido de humedad inferior al 4% puede también inducir reacciones de rancidez (11). El contenido de humedad del polen de abeja internacional osciló entre 2.0 (China) y 9.1 (India); es evidente que las técnicas de secado de polen han sido pobremente estudiadas y estandarizadas, razón por la cual es posible encontrar diferencias considerables en el contenido acuoso del polen de abeja en todo el mundo. Proteína. El contenido de proteína en el polen de abeja es una de sus características nutricionales más importante; el valor del mismo osciló entre 16.1 y 32.1 g/100 g (base seca) evaluado mediante un factor N x 6.25 con una media de 23.8 (±3.2) g/100 g. Estos resultados fueron similares a los obtenidos por Szczesna (24) para polen proveniente de Polonia, por Estevinho et al (25) para el polen recolectado en Portugal y por Almeida-Muradian et al (1) para el polen brasileño. Hubo diferencias en el contenido proteínico del polen de España según lo reportado por González-Martín et al (4), donde fue menor; las diferencias encontradas en la cantidad total de proteína fueron causadas por su origen botánico (26). Las regulaciones brasileñas sobre el contenido de proteína del polen de abeja establecen un valor mínimo del 8% (peso seco) mientras que las regulaciones argentinas establecen un rango del 15% al 28% (peso seco); todas las muestras del altiplano cundiboyacense analizadas estuvieron por encima del mínimos para los valores anteriores y el 11% de las mismas fueron superiores al estándar

or low pH can result from undesirable microbial activity (23). Argentinean regulation establishes a pH range from 4 to 6, which, according to the results, seems to be accurate for colombian pollen as well. In comparison with bee-pollen from other countries, shown in table 5, it can be found that pH and acidity values are similar to colombian pollen. Particularly, acidity of Poland, Indian, Chinese and Bulgarian bee-pollens are higher than 300 meq/kg, and those would not fulfill the brazilian normativity. Moisture. Beekeepers reduce bee pollen moisture content by drying (from initial values ranging from 18% to 34% on the Cundiboyacense high plateau) (10) to reduce water activity and so prevent microbial deterioration. Colombian bee-pollen varied from 1.8 to 11.8 g/100 g in the present study and had 7.7 (± 5.2) g/100 g mean value. Most samples (93%) met the argentinean standard of 8% as maximum allowable moisture content but only 19% of them complied with brazilian regulations stating a maximum of 4%. Bee pollen below ~6 g/100 g is in the acceptable range for storage stability, having into account that also a moisture content lower than 4% may induce to rancidity reactions (11). Moisture content of international bee-pollen ranged from 2.0 (China) to 9.1 (India); it is clear that bee-pollen drying techniques are poorly studied and standardized, that is why it can be found considerable differences in the water content of bee-pollen worldwide. Protein. Bee-pollen protein content is one of its most regarded nutritional features; this ranged from 16.1 to 32.1 g/100g (dry basis) evaluated by using factor N x 6.25, having a 23.8 (±3.2) g/100 gmean. These results were similar to those obtained by Szczesna (24) for pollen from Poland, by Estevinho et al (25) for pollen collected in Portugal and by AlmeidaMuradian et al (1) for brazilian pollen. There were differences with spanish pollen protein content as reported by González-Martín et al (4), where it was lower; the differences found in the total amount of protein were due to their botanical origin (26). Brazilian regulations for bee pollen protein content set an 8% minimum (dry weight) while argentinean regulations state a range from 15% to 28% (dry weight); all Cundiboyacense high plateau samples analyzed were above the minimum for both the foregoing and 11% of them were above the maximum argentinean standard. In comparison to international bee-pollen, colombian had one of the greatest proteins content, similar to bee-pollen from Romania (22.3 g/100 g) and only below of Poland (25.6 g/100 g) and India (26.1 g/100 g).

Fuenmayor - Evaluation of the physicochemical and funtional of bee pollen máximo de Argentina. En comparación con el polen internacional, Colombia tuvo uno de los mayores contenidos de proteínas, similar al polen de abeja de Rumania (22.3 g/100 g) y sólo por debajo de Polonia (25.6 g/100 g) e India (26.1 g/100 g). Fibra. El IDF varió entre 6.5 y 17.6 g/100 g, con una media de 11.7 (± 3.3) g/100 g. Por otro lado, el SDF varió de 0.5 a 4.6 g/100 g, con un valor medio de 2.7 (± 1.8) g/100 g (base seca). La cantidad de SDF fue considerablemente más alta en comparación con la mayoría de productos manufacturados. La media de fibra dietaria total fue 14.5 g/100 g. Entre el polen internacional analizado, India tuvo el mayor contenido de IDF (12.8 g/100 g), mientras que otros productos internacionales analizados oscilaron entre 5.7 y 9.6. Una muestra de España tuvo el mayor contenido de SDF (3.2 g/100g), un valor notablemente alto en comparación con otros países (rangos de 0.8 a 2.3 g/100g). Es posible observar que la proporción de fibra dietaria soluble e insoluble del polen colombiano constituye otro factor de funcionalidad, con un contenido más alto incluso que productos similares de otras regiones. Carbohidratos. Se identificaron y cuantificaron tres azúcares principales; fructosa fue el más abundante (19.45 ± 0.92 g/100 g peso seco), seguido de glucosa (13.58 ± 2.35 g/100 g) y sacarosa (6.68±2.03 g/100 g). El coeficiente F/G varió entre 1.20 y 1.61. La normatividad vigente en los distintos países no considera límites mínimos o máximos para el contenido de carbohidratos en el polen; sin embargo, en comparación con los datos obtenidos de Qian et al (5), para el polen de abeja chino, los resultados difieren notablemente, especialmente en relación con la concentración de sacarosa que ha sido reportada como considerablemente más alta. Lípidos. El contenido total de lípidos se mostró altamente variable y osciló entre 2.8 y 9.7 g/100 g (media de 6.9 (±3.5) g/100 g). El polen de esta región cumplió con el mínimo de 1.8 (peso seco) de lípidos totales especificado en las regulaciones brasileñas y mexicanas. El contenido de lípidos es altamente variable y depende de la cantidad de ácidos grasos, carotenos y vitaminas presentes en el polen. Los valores medios fueron similares a aquellos encontrados en variedades de polen de otros países, que oscilaron de 4.9 a 8.0 g/100 g, siendo el polen de la India aquel con el mayor contenido. No obstante, es importante señalar que la desviación estándar apreciable obtenida para el polen de abeja colombiano es causada por la diversidad del origen botánico de los pólenes de esta región. Perfil de ácidos grasos. El perfil de ácidos grasos fue analizado para el polen del altiplano

4011

Fiber. IDF varied from 6.5 to 17.6 g/100 g, having an 11.7 (± 3.3) g/100 g mean. On the other hand SDF varied from 0.5 to 4.6 g/100 g, having a 2.7 (± 1.8) g/100 g mean (dry basis). The amount of SDF was considerably high compared to most manufactured products. The mean for total dietary fiber was of 14.5 g/100 g. Among analyzed international bee-pollen, India had the greatest IDF content (12.8 g/100 g), meanwhile other analyzed international products ranged from 5.7 to 9.6. One sample from Spain had the greatest content of SDF (3.2 g/100g), a notorious high value compared to other countries (ranges from 0.8 to 2.3 g/100g). It can be seen that the proportion of soluble and insoluble dietary fiber of colombian bee-pollen constitutes another functionality factor, having even higher contents than similar products from other regions. Carbohydrates. Three main sugars were identified and quantified; fructose was the most abundant (19.45±0.92 g/100 g dry weight), followed by glucose (13.58±2.35 g/100 g) and sucrose (6.68±2.03 g/100 g). F/G ratio varied between 1.20 and 1.61. The existing regulation in different countries does not consider minimum or maximum limits for carbohydrate content in pollen; however, in comparison to data obtained for Qian et al (5), for chinese bee pollen, results differ noticeably, especially regarding sucrose concentration which has been reported as being considerably higher. Lipids. Total lipid content was highly variable and ranged from 2.8 to 9.7 g/100 g (mean 6.9 (±3.5) g/100 g). Pollens from this region met the minimum 1.8% (dry weight) total lipids specified in brazilian and mexican regulations. The content of lipids is highly variable and dependent on the amount of fatty acids, carotenes and vitamins present in pollen. Mean values were similar to those found in pollen varieties from other countries, which ranged from 4.9 to 8.0 g/100 g, with pollen from India having the highest content. Nevertheless, it is important to note that the appreciable standard deviation obtained for colombian bee-pollen is due to the diversity of botanical origin of pollens from this region. Fatty acid profile. The fatty acid profile was analyzed for pollens from Cundiboyacense highplateau. α-linolenic [C18:3n3] was found to be the most important fatty acid (25.68 mg/100 mg mean lipid concentration equal to 39.2% of fatty acids found) followed by palmitic [C16:0] (11.33 mg/100 mg of lipids), linoleic [C18:2n6c] (8.19 mg/100 mg of lipids), lauric [C12:0] (4.61 mg/100 mg of lipids), oleic [C18:1n9c] (2.38 mg/100 mg of lipids), stearic

4012

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

cundiboyacense. Se encontró que el ácido α-linolénico [C18:3n3] fue el ácido graso más importante (la concentración media de lípidos de 25.68 mg/100 mg fue equivalente al 39.2% de los ácidos grasos encontrados) seguido por el ácido palmítico [C16:0] (11.33 mg/100 mg de lípidos), linoleico [C18:2n6c] (8.19 mg/100 mg de lípidos), láurico [C12:0] (4.61 mg/100 mg de lípidos), oleico [C18:1n9c] (2.38 mg/100 mg de lípidos), esteárico [C18:0], cis-8,11,14-eicosatrienoico [C20:3n6], mirístico [C14:0] y tricosanoico [C23:0]. La proporción de ácidos grasos insaturados/saturados fue 1.78; se han encontrado previamente proporciones mayores a 1 en polen de abeja (3,6,25), con las variaciones siendo causadas por el origen botánico. La fracción lipídica también puede contener otros ácidos grasos, pigmentos, ceras, esteroles, vitaminas liposolubles, alcoholes pesados e hidrocarburos (3). Cenizas y minerales. El contenido medio de cenizas para el polen de abeja colombiano fue 2.5 (±0.4) g/100 g (base seca) que varía desde 1.5 a 3.2 g/100 g. Estos resultados son consistentes con los resultados anteriores (1,13); todas las muestras cumplieron con las normas argentinas y brasileñas que establecen un máximo del 4% (peso seco). En una comparación con polen de abeja internacional se obtuvieron valores similares para el contenido de cenizas, el cual oscila entre 1.5 y 3.3 g/100 g, con excepción de China, con 4.3 g/100 g. Por otro lado, se evaluaron seis minerales (Tabla 3), siendo el potasio el más concentrado, seguido en orden decreciente por calcio, magnesio, sodio, hierro y zinc. Los resultados fueron consistentes con otros resultados (1,13). Este perfil mineral respalda la idea de que el polen es un suplemento nutricional. El polen de abeja de otros países ha mostrado una gran diversidad; con el contenido de potasio y magnesio variando entre 3.607 y 9.542 mg/kg y de 453 a 2.636 mg/kg, respectivamente, siendo China el país con el mayor contenido en ambos casos; esto explicaría el alto valor inusual para el contenido de cenizas. Para el calcio y el hierro, los valores oscilaron entre 468 y 2.376 mg/kg y de 28.8 a 197.7 mg/kg, respectivamente, teniendo la India el mayor contenido en ambos casos. Para sodio y zinc, los valores obtenidos no han tenido una variabilidad considerable entre países, que varía desde 84 a 379 mg/kg y de 26.1 a 53.2 mg/ kg, respectivamente. Particularmente, el polen de Colombia mostró un valor considerablemente alto para el contenido de potasio, calcio y hierro y también, un bajo valor de sodio. Como conclusiones, las características fisicoquímicas y funcionales del polen del altiplano cundiboyacense podrían desempeñar un papel importante para controlar la calidad de este producto y cumplirían los requerimientos internacionales, a excepción del

[C18:0], cis-8,11,14-eicosatrienoic [C20:3n6], miristic [C14:0] and tricosanoic [C23:0]. The unsaturated/saturated fatty acid ratio was 1.78; ratios greater than 1 have been previously found in bee pollen (3,6,25), variations being due to botanical origin. The lipid fraction may also contain other fatty acids, pigments, waxes, sterols, liposoluble vitamins, heavy alcohols and hydrocarbons (3). Ash and minerals. Mean ash content found for colombian bee-pollen was 2.5 (±0.4) g/100 g (dry basis) ranging from 1.5 to 3.2 g/100 g. These results agreed with previous findings (1,13); all samples met both argentinean and brazilian standards establishing a maximum 4% (dry weight). A comparison with international bee-pollen showed similar values for ash content ranging between 1.5 and 3.3 g/100 g, except for China with 4.3 g/100 g. O n t h e o t h e r h a n d , s i x m i n e ra l s w e r e assessed (Table 3), potassium being the most concentrated, followed in decreasing order by calcium, magnesium, sodium, iron and zinc. The results agreed with other findings (1,13). Such mineral profile supports the idea of pollen being a nutritional supplement. Beepollen from other countries has shown a great diversity; potassium and magnesium content ranged from 3607 to 9542 mg/kg and 453 to 2636 mg/kg, respectively, with China having the highest content in both cases; this would explain the unusual high value for ash content. In calcium and iron, values ranged from 468 to 2376 mg/kg and 28.8 to 197.7 mg/kg, respectively, with India having the highest content in both cases. For sodium and zinc, the obtained values have not had a considerable variability among countries, ranging from 84 to 379 mg/kg and 26.1 to 53.2 mg/kg, respectively. Particularly, Colombian bee-pollen showed a considerable high value for potassium, calcium and iron content, and also, a low value for sodium. As conclusions, physicochemical and functional characteristics of pollens from the CundiBoyacense high plateau could play an important role for quality control of this product and would satisfy international requirements, except for moisture content, where it is necessary to improve drying conditions to obtain a more suitable product. The particularities of colombian pollen composition demand that local standards become defined; the data presented here would thus provide a suitable basis for such work. Particularly, high levels of minerals were found in analysis compared to several reports and analyzed bee-pollen from several countries.

Fuenmayor - Evaluation of the physicochemical and funtional of bee pollen contenido de humedad, ya que resulta necesario mejorar las condiciones de secado para obtener un mejor producto. Las particularidades de la composición del polen colombiano requieren de la definición de normas locales; los datos presentados aquí proporcionarían por lo tanto una base adecuada para dicho estudio. En particular, se han encontrado altos niveles de minerales en el análisis en comparación con varios informes y el polen analizado de varios países. Los altos niveles de potasio, proteína, fibra dietaria y lípidos indican la posibilidad de utilizar el polen como un suplemento dietario. Se recomienda realizar un análisis posterior centrado en los componentes y propiedades bio-activas y la caracterización de la fracción volátil y características sensoriales para caracterizar totalmente el polen colombiano y así diferenciarlo localmente y de otras variedades mundiales. Se espera que este trabajo constituya una herramienta importante para catalogar y reconocer al polen colombiano como una fuente beneficiosa de nutrientes naturales. Agradecimientos Los autores agradecen al Ministerio de Agricultura y Desarrollo Rural de Colombia, el Departamento Administrativo de Ciencia, Tecnología e Innovación de Colombia (COLCIENCIAS) y las siguientes asociaciones de apicultura: Asociación de Apicultores de Boyacá (ASOAPIBOY), la Asociación de Apicultores de la Región del Sumapaz (ASOAPIS), la Asociación de Apicultores Conservacionistas de la Sierra Nevada de Santa Marta (APISIERRA), la Asociación Apícola Comunera (ASOAPICOM), Apicultura Los Cerezos y Apiarios Los Cítricos.

4013

The high potassium, protein, dietary fiber and lipids levels indicated the possibility of using pollen as a dietary supplement. Further analysis focused on bioactive components and properties and characterizing the volatile fraction and sensory characteristics are highly recommended for fully characterizing colombian bee pollens and differentiating them locally and from other varieties from around the world. It is expected that this work would be an important tool for cataloguing and recognizing colombian pollen as being a beneficial source of natural nutrients. Acknowledgments The authors thank the colombian Ministry of Agriculture and Rural Development, the colombian Science, Technology and Innovation Department (COLCIENCIAS), and the following beekeeping associations: Asociación de Apicultores de Boyacá (ASOAPIBOY), the Asociación de Apicultores de la región del Sumapaz (ASOAPIS), the Asociación de Apicultores Conservacionistas de la Sierra Nevada de Santa Marta (APISIERRA), the Asociación Apícola Comunera (ASOAPICOM), Apicultura Los Cerezos and Apiarios Los Cítricos.

REFERENCES 1. Almeida-Muradian L, Pamplona L, Coimbra S, Barth O. Chemical composition and botanical evaluation of dried bee pollen pellets. J Food Compos Anal 2005; 18(1):105-111. 2. Del Risco C, Pérez A, Álvarez V, Rodríguez G, Leiva V, Puig Y, et al. Bacterias ácido-lácticas para ensilar polen apícola. Revista CENIC. Ciencias Biológicas 2012; 43(1):17-21. 3. Human H, Nicolson S. Nutritional content of fresh, bee-collected and stored pollen of Aloe geatheadii va. davyana (Asphodelaceae). Phytochemistry 2006; 67:1486-1492.

4. Gonzalez-Martin I, Hernandez-Hierro J, Barros-Ferreiro N, Cordon C, GarciaVillanova R. Use of NIRS technology with a remote reflectance fibre-optic probe for predicting major components in bee pollen. Talanta 2007; 72:998-1003. 5. Qian WL, Khan Z, Watson DG, Fearnley J. Analysis of sugars in bee pollen and propolis by ligand exchange chromatography in combination with pulsed amperometric detection and mass spectrometry. J Food Compos Anal 2008; 21(1):78-83.

4014

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

6. Xu X, Dong J, Mu X, Sun L. Supercritical CO2 extraction of oil, carotenoids, squalene and sterols from lotus (Nelumbo nucífera Gaertn) bee pollen. Food Bioprod Process 2011; 89(1):47-52. 7. Xu L, Sun I, Dong L, Zhang H. Breaking the cells of rape bee pollen and consecutive extraction of functional oil with supercritical carbon dioxide. Innovat Food Sci Emerg Tech 2009; 10:42-46. 8. Pinto B, Caciagli F, Riccio E, Reali D, Šarić A, Balog T, et al. Antiestrogenic and antigenotoxic activity of bee pollen from Cystus incanus and Salix alba as evaluated by the yeast estrogen screen and the micronucleus assay in human lymphocytes. Eur J Med Chem 2010; 45(9):4122-4128. 9. Mărghitaş LA, Stanciu OG, Dezmirean DS, Bobiş O, Popescu O, Bogdanov S, et al. In vitro antioxidant capacity of honeybeecollected pollen of selected floral origin harvested from Romania. Food Chem 2009; 115(3):878-883. 10. Diaz C, Zuluaga C, Fuenmayor C, Martinez T. Special features of pollen production in Colombia. 41st World Congress of Apiculture. Montpellier, France; Apimondia: 2009. 11. Campos M, Bogdanov S, Almeida-Muradian L, Szczesna T, Mancebo Y, Frigerio C, et al. Pollen composition and standardisation of analytical methods. J Apicult Res 2008; 47(2):156-163. 12. Bogdanov S. The Bee Pollen Book. Bulgaria: Bee Product Science; 2011. 13. Somerville D, Nicol H. Mineral content of honeybee-collected pollen from sothern New South Wales. Aust J Exp Agr 2002; 42(8):1131–1136. 14. Baldi B. Composición bromatológica del polen argentino. Ciencia, docencia y tecnología. Argentina: Universidad Nacional de Entre Ríos; 2004. 15. Rebiai A, Lanez T. Chemical composition and antioxidant activity of Apis mellifera bee pollen from northwest Algeria. J Fund Appl Sci 2012; 4(2):26–35. 16. Yang K, Wu D, Ye X, Liu D, Chen J, Sun P. Characterization of Chemical Composition of Bee Pollen in China. J Agr Food Chem 2013; 61:708–718.

17. Martínez T. Diagnóstico de la actividad apícola y de la crianza de abejas en Colombia. Colombia: Ministerio de Agricultura y Desarrollo Rural - Dirección de Cadenas Productivas. Instituto Intermaericano de Cooperación para la Agricultura; 2006. 18. IGAC-ORSTOM. Estudio regional integrado del Altiplano Cundiboyacense: estudio general de suelos. Bogotá, Colombia; 1984. 19. AOAC. Official Methods of Analysis of AOAC International. Association Official Analytical Chemists; 2005. 20. Díaz C, Zuluaga C, Morales C, Quicazán M. Determinación de fibra dietaría en polen apícola colombiano. Vitae 2012; 19(S1):454–456. 21. Nates-Parra G, Montoya P, Obregón D, Ramírez N, Solarte V, Chamorro F. La melisopalinología como herramienta para la diferenciación por origen botánico de productos de abejas en Colombia. Sincelejo, Colombia: Encuentro Nacional de Apicultura; 2010. 22. Čeksterytė V, Račys J, Kaškonienė V, Venskutonis P. Fatty acid composition in beebread. Biologija 2008; 54(4):253–257. 23. Fuenmayor C, Quicazán M, Torres A, Rubio A. A beebread-inspired functional dietary supplement by means of solid state fermentation of honeybee-collected pollen with probiotic. Montpellier, France: Apimondia; 2009. 24. Szczesna T. Protein content and amino acid composition of bee-collected pollen from selected botanical origins. J Apic Sci 2006; 50(2):81–90. 25. Estevinho LM, Rodrigues S, Pereira AP, Feás X. Portuguese bee pollen: palynological study, nutritional and microbiological evaluation. Int J Food Sci Technol 2012; 47(2):429-435. 26. Almaraz-Abarca N, Campos M, Ávila-Reyes J, Naranjo-Jiménez N, Herrera-Corral J, González-Valdez L. Variability of antioxidant activity among honeybee-collected pollen of different botanical origin. Interciencia 2004; 29(10):1–12.

Rev.MVZ Córdoba 19(1):4015-4022, 2014. ISSN: 0122-0268 ORIGINAL

Application of the logistic model to describe the growth curve in dogs of different breeds Aplicación del modelo logístico para describir la curva de crecimiento en perros de diferentes razas Sandra Posada O,1* Ph.D, Luis Gomez O,2 M.Sc, Ricardo Rosero N,1 Ph.D. Universidad de Antioquia, Faculty of Agricultural Sciences, Animal Science Research Group-GRICA, AA 1226, Medellin, Colombia.2 Empresa Solla S.A., AA 1272, Medellin, Colombia. *Correspondence: slposada@gmail.com. 1

Received: February 2013; Accepted: August 2013.

ABSTRACT Objective. To model the growth in dogs of different size and breeds that during their development showed a relative body weight according to the standards of their racial group. Materials and methods. The data used were obtained from the Canine Research Center (CIC), property of Empresa Solla S.A., located in the municipality of Rionegro (Antioquia, Colombia). The parameters of the growth curve were defined based on the logistic model using the procedure PROC NLIN of the SAS. Results. The adult weight (a) ranged from 2.12 Kg (York Shire Terrier) to 32.88 Kg (Weimaraner). For small, medium and large breeds, growth rates (1/b) during the exponential phase ranged between 9.9118.91%, 9.12-13.83% and, 8.17-14.38%, respectively, and the average age at which 50% of the adult weight was reached (x0) was 3.49±0.03, 4.21±0.42 y 5.27±0.86 months, correspondingly. Large dog breeds reached maturity (T99) later than smaller breeds, 14.37±1.79 vs. 9.46±1.63 mo. Conclusions. The logistic model was able to describe the growth in dogs of different size, however, a larger sample size will improve its predictive ability, given the individual variability that characterizes growth. Key words: Body size, body weight, growth model, growth rate, regression analysis (Source: CAB, USDA).

RESUMEN Objetivo. Modelar el crecimiento en perros de diferentes tamaños y razas, que durante su desarrollo exhibieron un peso corporal relativo acorde con los estándares de su grupo racial. Materiales y métodos. Los datos utilizados fueron obtenidos del Centro de Investigaciones Caninas (CIC) de la Empresa Solla S.A., ubicada en el municipio de Rionegro (Antioquia, Colombia). Los parámetros de la curva de crecimiento fueron definidos desde el modelo logístico utilizando el procedimiento PROC NLIN del programa estadístico SAS. Resultados. El peso de los adultos (a) fluctuó entre 2.12 Kg (York Shire Terrier) hasta 32.88 Kg (Weimaraner). Para las razas pequeñas, medianas y grandes, las tasas de crecimiento (1/b) durante la fase exponencial fluctuaron entre 9.91-18.91%, 9.12-13.83%

4015

4016

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

y, 8.17-14.38%, respectivamente, y la edad media a la cual se alcanzó el 50% del peso adulto (xo) fue 3.49±0.03, 4.21±0.42 y 5.27±0.86 meses, correspondientemente. Las razas de perros grandes alcanzaron la madurez (T99) mucho más tarde que las razas de perros pequeños, 14.37±1.79 vs. 9.46±1.63 meses. Conclusiones. El modelo logístico fue adecuado para describir el crecimiento en perros de diferente tamaño, no obstante, un tamaño de muestra mayor mejoraría la capacidad predictiva del mismo, dada la variabilidad individual que caracteriza el crecimiento. Palabras clave: Análisis de regresión, modelo de crecimiento, peso corporal, tamaño corporal, tasa de crecimiento (Fuente: CAB, USDA).

INTRODUCCIÓN

INTRODUCTION

El crecimiento es un proceso complejo de proliferación celular en el cual existen interacciones entre la genética, la nutrición y otras influencias ambientales. La medida de crecimiento más usual es el peso corporal, por lo cual el crecimiento puede resumirse a través de modelos matemáticos que se traducen en curvas de ganancia acumulativa de peso (1). Los perros en crecimiento progresan a través de tres períodos críticos en los primeros 12 meses de vida, a saber, un período de lactancia, un período de destete y un período posdestete: éste último que resulta crítico para el desarrollo esquelético y de otros sistemas corporales. En relación con la edad, el crecimiento más rápido se presenta durante los primeros 3-6 meses de vida, en tanto que la madurez (tamaño adulto) se alcanza entre los 1016 meses para las razas grandes y entre los 6-12 meses para las razas más pequeñas, momento en que la mayoría de los de perros han aumentado su peso al nacer entre 40 y 50 veces (2). Dependiendo de la raza, el peso corporal adulto varía más de 100 veces, desde 2-6 lb en la raza Chihuahua hasta 150180 lb en la raza San Bernardo (3).

Growth is a complex process of cell proliferation in which there are interactions between genetics, nutrition, and other environmental influences. The most usual growth measurement is body weight, whereupon growth can be summarized through mathematical models that translate into cumulative weight gain curves (1). Growing dogs go through three critical periods in the first 12 months of life, namely, a lactation period, a weaning period and a post-weaning period: the latter is critical for skeletal development and other body systems. In relation to age, the fastest growth occurs during the first 3-6 months of life, while maturity (adult size) is reached between 1016 months for large breeds and between 6-12 months for smaller breeds, at which time most of the dogs have increased their weight at birth in between 40 and 50 times (2). Depending on the breed, adult body weight varies more than 100 times, from 2-6 lb. for Chihuahuas up to 150-180 lb. for St. Bernards (3).

Durante el crecimiento resulta esencial aportar una dieta equilibrada para que el animal presente un adecuado desarrollo esquelético y muscular, exhiba la velocidad típica de crecimiento de los ejemplares de su raza y alcance un tamaño adulto normal. De acuerdo con el NRC (4), los perros en crecimiento, por unidad de peso corporal requieren el doble de la energía requerida por los perros adultos de la misma raza. Una disminución en el aporte energético a 1.6 y 1.2 veces el nivel de mantenimiento se recomienda cuando se alcanza el 50% y 80% del peso adulto, respectivamente. No obstante, en concepto de Case et al (2) y Hawthorne et al (3), las demandas energéticas están afectadas por variaciones en el tamaño, conformación corporal, temperamento y tipo de pelaje, lo cual genera diferencias en los patrones de crecimiento de razas específicas. Aumentos en la velocidad de crecimiento conducen a madurez precoz, inadecuado desarrollo esquelético, aumento del número de células grasas, mayor riesgo de obesidad en la edad adulta y reducción en la longevidad (5).

During growth, it is essential to provide a balanced diet so the animal shows proper skeletal and muscular development and the typical growth rate of the specimens of its breed and reaches its normal adult size. According to the NRC (4), growing dogs require twice the energy required by adult dogs of the same breed per unit of body weight. A decrease in the energy contribution to 1.6 and 1.2 times the maintenance level is recommended when 50% and 80% of the adult weight is reached, respectively. However, in the opinion of Case et al (2) and Hawthorne et al (3), the energy demand is affected by variations in the size, corporal estructure, temperament and coat type, which generates differences in the growth patterns of specific breeds. Increases in the growth rate lead to an early maturity, inadequate skeletal development, increase in the number of fat cells, increased risk of obesity in adulthood and the reduction of longevity (5).

Posada - Application of the logistic model to describe the growth curve El modelo logístico expresa analíticamente el fenómeno de crecimiento de los organismos. Tanto la población humana como la animal encuentran obstáculos de sobrevivencia, los que aumentan proporcionalmente con relación al exceso de la población total. Esto significa que después de un crecimiento acelerado de la población sobreviene siempre un período de avance más lento, que finalmente tiende a estabilizarse (6). Aplicado a los modelos no lineales, la curva logística modela la función sigmoidea, donde el crecimiento inicialmente es exponencial (aumenta en un constante porcentual en función del tiempo), transcurrido un determinado tiempo se ralentiza (la tasa de crecimiento disminuye) y finalmente, en la madurez, se detiene. Poca información está disponible sobre los parámetros que definen las curvas de crecimiento de razas específicas, lo cual podría orientar al personal responsable de la tenencia de mascotas (criadores, propietarios, profesionales) sobre el ritmo de crecimiento objetivo al que deben dirigir el nivel de alimentación y actividad del animal, que propenda por su salud y bienestar en la edad adulta. El objetivo del presente trabajo fue aplicar el modelo logístico para describir los parámetros de crecimiento de perros de diferentes razas, pequeñas, medianas y grandes, que durante su desarrollo presentaron adecuado peso corporal relativo y condición corporal.

4017

The logistic model expresses the growth p h e n o m e n o n o f o r g a n i s m s a n a l y t i c a l l y. Both the animal and human population face obstacles to survival, which increase proportionally in relation to the excess of the total population. This means that after a period of rapid growth in the population there is always a period of slower progress, which finally tends to stabilize (6). Applied t o nonlinear mod els, t he log ist ic c urve models the sigmoid function, where growth is initially exponential models (increases by a constant percentage depending on time), and after certain time slows down (growth rate decreases) and finally, in maturity, stops. Little information is available on the parameters that define the growth curves of specific breeds, which could guide the personnel responsible for the ownership of pets (breeders, owners, professionals) on the target growth rate at which the feeding and activity level of the animal should be directed, for improving their health and wellbeing in adulthood. The objective of this study was to apply the logistic model to describe the growth parameters of dogs of different breeds, small, medium and large, that during their development displayed adequate relative body weight and body condition.

MATERIALES Y MÉTODOS

MATERIALS AND METHODS

Sitio de estudio. Los datos utilizados para la construcción de las curvas de crecimiento fueron obtenidos del Centro de Investigaciones Caninas (CIC) de la Empresa Solla SA, ubicada en el municipio de Rionegro, oriente del departamento de Antioquia (Colombia). Las condiciones agroecológicas de la zona corresponden a una temperatura promedio de 17°C, humedad relativa del 75%, precipitación anual de 2280 mm y altura sobre el nivel del mar de 2125 m.

Study site. The data used for the construction of the growth curves were obtained from the Canine Research Center (CIC) of Empresa Solla S.A., located in the municipality of Rionegro, to the east of the department of Antioquia (Colombia). The agro-ecological conditions in the area correspond to an average temperature of 17°C, relative humidity of 75%, annual precipitation of 2280 mm and height above sea level of 2125 m.

Animales. Perros (n=21), correspondientes a 10 razas diferentes, clasificadas como pequeñas (n=3), medianas (n=7) y grandes (n=11) fueron incluidos en este estudio. Para cada raza, la información correspondiente al número de individuos evaluados, el rango de edad de aplicación del modelo y el número de datos usados para la modelación se presenta en la tabla 1.

Animals. Dogs (n=21), corresponding to 10 different breeds, classified as small (n=3), medium (n=7) and large (n=11), were included in this study. For each breed, the information corresponding to the number of individuals evaluated, the age range for the application of the model and the number of data used for modeling is shown in table 1.

Alimentación y manejo. Los animales fueron alimentados con una variedad de alimentos comercialmente disponibles, nutricionalmente completos, de las categorías Premium y Super Premium, y formulados para cumplir con las exigencias nutricionales de la etapa de crecimiento.

Feeding and handling. The animals were fed with a variety of commercially available, nutritionally complete foods of Premium and Super Premium categories, formulated to meet the nutritional demands of the growth stage. The variety of foods offered is because

4018

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Table 1. General characteristics of dog breeds under study. Size Small

Breed York Shire Terrier French Poodle (Toy)

Medium

Fox Terrier Teckel Basset Hound Beagle

Large

Golden retriever Labrador retriever Weimaraner German Shepherd

Age range1

2-3.2 3.2-3.8

1* 2**

34 62

17.71 - 87.57 14.57 - 77.86

7-8 8-10 11-25 9-14

2* 1* 2** 2*

56 58 108 62

9.57 - 83.71 20.57 - 156.57 8.14 - 125.00 23.00 - 135.86

25-32 25-35 25-38 22-34

1** 4** 2* 4*

34 231 64 193

12.29 - 82.14 16.29 - 152.29 11.29 - 128.71 4.14 - 121.00

PA: Corresponding to the adult weight reported for the breed, not that estimated in this study (7). NA: Number of animals belonging to each racial group. ND: Number of data considered for the modeling of each racial group. 1 Corresponding to the initial and final age (weeks) at which each racial group was weighted. * Males, **Females.

La variedad de alimentos ofertada obedece a que los ejemplares del CIC deben ser entrenados para la realización de pruebas de palatabilidad. La cantidad suministrada fue individualizada, de acuerdo con el peso corporal y los requerimientos energéticos (4), y garantizada dos veces por día, a las 8 y 18 horas, en los caniles asignados a cada animal. A partir de las 17 horas, y hasta las 9 horas del día siguiente, los animales fueron alojados en caniles de 2x4 m, que disponían de cubierta superior (techo) en las zonas de alimentación y descanso y de un área al aire libre para la actividades de descanso y excreción. Una vez ofertada la primera ración, los animales fueron organizados en tres grupos, previo estudio y observación de su estructura jerárquica, y ubicados en espacios abiertos, en los cuales socializaban. Igualmente, los animales tuvieron acceso a un espacio adecuado para su entrenamiento (agility), actividad que cada animal practicó de acuerdo con los criterios de un experto, teniendo en cuenta la edad y el nivel de experiencia. Finalmente, cada animal realizaba paseos con duración promedio de una hora, dos veces por semana. Colecta de información y procesamiento de datos. Los pesajes de cada ejemplar se realizaron con una frecuencia quincenal, siempre en el mismo horario y antes de la oferta de la primera ración diaria. La edad de cada animal fue calculada, previo registro de la fecha de nacimiento, para construir la base de datos peso-edad. Para cada raza, los parámetros de la curva de crecimiento fueron definidos a partir del modelo logístico descrito por Hawthorne et al (3), correspondiente a: y = a/{1+exp[-(x-x0)/b]}, donde, y= peso corporal alcanzado a la edad x, a= peso corporal adulto (peso asintótico) (gramos), (1/b)= tasa de crecimiento durante la fase exponencial (%) y xo= tiempo necesario para alcanzar el 50% del peso adulto (semanas).

the specimens of the CIC must be trained for carrying out palatability tests. The quantity supplied was individualized, based on the body weight and energy requirements (4), and guaranteed twice per day, every 8 and 18 hours, in the kennels assigned to each animal. From 5 p.m. and until 9 a.m. of the next day, the animals were kept in 2x4 m kennels, which had a top cover (roof) in the feeding and leisure areas and outdoor area for rest and excretion activities. Once the first ration has been offered, the animals were organized into three groups, prior study and observation of their hierarchical structure, and located in open spaces, in which they socialized. Likewise, the animals had access to adequate space for their training (agility), an activity that each animal practiced according to an expert’s criteria, taking into account the age and experience level. Finally, each animal made walks with an average duration of one hour, twice a week. Collection of information and data processing. The weighing of each specimen was made with a weekly frequency, always at the same time and before the first daily ration. The age of each animal was calculated, after the record of the date of birth, to build the weight-age database. For each breed, the parameters of the growth curve were defined based on the logistic model described by Hawthorne et al (3), corresponding to: y = a/{1+exp[-(x-x0)/b]}, where, y= body weight reached at age x, a= adult body weight (asymptotic weight) (grams), (1/b)= growth rate during exponential phase (%), and xo= time needed for reaching 50% of adult weight (weeks).

4019

Posada - Application of the logistic model to describe the growth curve El ajuste de los datos a este modelo y las estimativas de los parámetros se realizaron a través de un proceso iterativo usando el algoritmo Marquardt del procedimiento para modelos no lineales PROC NLIN de SAS (8). Todos los ejemplares pertenecientes a una misma raza fueron considerados para ajustar el modelo. Toda vez que la función logística no puede calcular el peso corporal adulto, la edad (semanas) a la cual cada raza alcanzó el 99% de su peso adulto (T99) fue calculada a partir de los parámetros estimados.

The adjustment of the data to this model and the estimates of parameters were carried out through an iterative process using the Marquardt algorithm of the procedure for nonlinear models PROC NLIN of SAS (8). All the specimens belonging to a same breed were considered for adjusting the model. Whenever the logistic function cannot calculate the adult body weight, the age (weeks) at which each breed reached 99% of their adult weight (T99) was calculated from the estimated parameters.

RESULTADOS

RESULTS

Las curvas de crecimiento estimadas desde el modelo logístico para cada una de las razas, pequeñas, medianas y grandes se presentan en la figura 1.

The growth curves estimated from the logistic model for each of the breeds, small, medium and large are shown in figure 1.

Las estimativas de los parámetros, resultantes del ajuste de los datos peso-edad al modelo de crecimiento no lineal, con sus respectivos errores estándar (EE), son presentadas en la tabla 2. El peso adulto (a) fluctuó entre 2.12 Kg (York Shire Terrier) hasta 32.88 Kg (Weimaraner). El 50% del peso adulto se alcanzó a las 15.11±0.14, 18.26±1.82 y 22.85±3.74 semanas (x0) en las razas pequeñas, medianas y grandes, respectivamente. La duración de esta fase de crecimiento se incrementó en proporción con el peso adulto y durante la misma, las tasas de crecimiento fueron exponenciales (el logaritmo del peso corporal incremento linealmente). Las tasas de crecimiento durante la fase exponencial (tasa de incremento de peso por semana) (1/b) fluctuaron entre 9.91 y 18.91% para las razas pequeñas, 9.12 y 13.83% para las medianas y 8.18 y 14.38% para las grandes. Se observó que las razas pequeñas alcanzaron el 99% de su peso corporal adulto (T99) entre las 36 y 46 semanas, las medianas entre la62s 52 y 58 semanas y las grandes entre las 52 y 70 semanas. Finalmente, los coeficientes de determinación (R2) para todas las razas evaluadas fluctuaron entre 44.49 y 98.80%.

The estimates of the parameters, resulting from the adjustment of the weight-age data to the non-linear growth model, with the respective standard errors (EE), are shown in table 2. The adult weight (a) ranged between 2.12 Kg (York Shire Terrier) to 32.88 Kg (Weimaraner). Fifty percent of the adult weight was reached at 15.11±0.14, 18.26±1.82 and 22.85±3.74 (x0) weeks in small, medium and large breeds, respectively. The duration of this growth phase was increased in proportion to the adult weight and during the same, the growth rates were exponential (the body weight logarithm increased linearly). Growth rates during the exponential phase (weight increase rate per week) (1/b) fluctuated between 9.91 and 18.91% for small breeds, 9.12 and 13.83% for medium-sized breeds, and 8.18 and 14.38% for large breeds. It was noted that small breeds reached 99% of their adult body weight (T99) between 36 and 46 weeks, medium breeds between 52 and 58 weeks and large breeds between 52 and 70 weeks. Finally, the coefficients of determination (R2) for all breeds evaluated fluctuated between 44.49 and 98.80%.

Body weight (g)

1 2 3

3 4 1 2 3 4

Age (week)

1 -Weimaraner 2 -Labrador Retriever 3 -Pastor Aleman 4 -Golden Retriever

-Basset Hound -Beagle -Fox Terrier -Teckel

Age (week)

Figure 1. Growth curves estimated by the logistic model for the different breeds under study.

4020

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

Table 2. Growth parameters for dogs of different breeds from the logistic model. Size and breed

Parameters

a (g)

1/b (%)

xo (weeks)

T99 (weeks)

2124.10 (21.43)1 2706.60 (29.41)

10.09 (1.13) 5.29 (0.73)

9.91 18.91

15.21 (1.09) 15.01 (0.69)

46 36

92.65 80.73

Medium Fox Terrier Teckel Basset Hound Beagle

10191.60 (80.87) 8537.00 (43.83) 18873.20 (519.70) 13677.10 (101.00)

8.53 (0.46) 7.23 (1.10) 8.13 (2.09) 10.96 (1.03)

11.72 13.83 12.30 9.12

16.12 17.86 18.55 20.52

(0.38) (1.25) (1.93) (1.07)

54 53 52 58

96.97 72.05 44.49 90.22

Large Golden Retriever Labrador Retriever Weimaraner German Shepherd

22219.50 29537.00 32877.40 26689.70

7.62 (0.38) 6.96 (0.48) 9.75 (0.39) 12.23 (1.15)

13.13 14.38 10.26 8.18

28.17 20.26 22.74 20.23

(0.40) (0.69) (0.33) (1.03)

61 52 66 70

98.80 71.46 98.54 75.53

Small York Shire Terrier French Poodle (Toy)

(216.20) (121.70) (186.30) (371.20)

1 Values corresponding to the average ± EE, a = adult body weight (grams), (1/b) = exponential growth rate (percentage), x0= time necessary to reach 50% of adult weight (weeks), T99= time necessary to reach 99% of adult weight (weeks), R2= coefficient of determination.

DISCUSIÓN

DISCUSSION

La curva logística modela la función sigmoidea, donde el crecimiento inicialmente es exponencial (aumenta en un constante porcentual en función del tiempo), transcurrido un determinado tiempo se ralentiza (la tasa de crecimiento disminuye) y finalmente, en la madurez, se detiene. Este comportamiento se observa en las curvas de crecimiento que se presentan en la figura 1, donde a la fase de aceleración rápida le sigue una fase de menor tasa de crecimiento –a medida que el animal se aproxima al peso adulto (peso asintótico) - y posteriormente una fase de estabilización del peso corporal, correspondiente al peso adulto.

The logistic curve models the sigmoid function, where growth is initially exponential (increases by a constant percentage depending on time), after certain time slows down (growth rate decreases) and finally, in maturity, stops. This behavior is observed in the growth curves showed in figure 1, where the rapid acceleration phase is followed by a phase of lower growth rate - as the animal approaches its adult weight (asymptotic weight) - and then a stabilization phase of the body weight, corresponding to the adult weight.

En relación con el comportamiento de los parámetros (Tabla 2), se observa que la fase de crecimiento exponencial aumenta con el peso adulto estimado por el modelo (a), presentando mayores valores para el parámetro x0. El análisis de correlación de Spearman evidenció la relación directa y significativa que existe entre los parámetros a y xo (r=0.6959, p<0.05). Entre las funciones de crecimiento con comportamiento sigmoidal, la ecuación logística fija el punto de inflexión exactamente al 50% del peso a la madurez del animal (9), lo cual explica la relación directa que se registró entre los parámetros a y xo. A diferencia de los resultados del presente trabajo, donde la correlación entre los parámetros a y 1/b no fue alta ni significativa (-0.32, p=0.3642), Malhado et al (10) en experimento con bufalinos, encontró que la correlación entre estos parámetros fue alta (-0.71), cuya interpretación biológica es que animales con mayores tasas de crecimiento tienen menor probabilidad de alcanzar mayores pesos en la madurez, comparados con aquellos que crecen más lentamente en el inicio de la vida. Sarmento et al (11) resalta que esta relación, biológicamente, es la más importante. El inverso del parámetro b (1/b) refleja una tasa relativa de crecimiento durante

In relation to the behavior of the parameters (Table 2), it is observed that the exponential growth phase increases with the adult weight estimated by the model (a), showing higher values for the parameter x0. The Spearman’s rank correlation analysis showed the direct and meaningful relationship that exists between the parameters a and xo (r=0.6959, p<0.05). Between growth functions with behavior sigmoidal, the logistic equation sets the turning point exactly at 50% of the mature weight of the animal (9), which explains the direct relationship recorded between parameters a and xo. In contrast to the results of this study, where the correlation between parameters a and 1/b was neither high nor significant (-0.32, p=0.3642), Malhado et al (10) in an experiment with buffalos, found that the correlation between these parameters was high (-0.71), whose biological interpretation is that animals with higher growth rates are less likely to reach higher weights at maturity, when compared with those that grow more slowly in the beginning of their life. Sarmento et al (11) highlights that this relationship, biologically, is the most important. The inverse

Posada - Application of the logistic model to describe the growth curve la fase exponencial, que para el modelo logístico es antes de lograr el 50% del peso asintótico, es decir antes del punto de inflexión. En las tablas 1 y 2 se observa que el tiempo en que se iniciaron las mediciones del peso corporal superó el parámetro xo para las razas York Shire Terrier, Teckel y Beagle, lo cual ilustra la falta de datos durante esta fase exponencial, comprometiendo los resultados de 1/b para las razas en mención. Case et al (2) confirman la menor duración del período de mayor velocidad de crecimiento en razas pequeñas, que termina alrededor de los 3 meses de edad, en tanto que en razas grandes y gigantes, el crecimiento exponencial se puede prolongar por 1 y 2 meses más, respectivamente. Como norma empírica, los perros de tamaño pequeño y mediano (peso adulto hasta los 25 Kg) alcanzan alrededor del 50% de su peso adulto aproximadamente a los 4 meses de edad y aquellos con peso superior a 25 Kg, alrededor de los 5 meses de edad. Este concepto coincide con los resultados del presente trabajo, donde las razas pequeñas, medianas y grandes exhibieron un valor medio para el parámetro xo correspondiente a 3.49±0.03, 4.21±0.42 y 5.27±0.86 meses, respectivamente (media+desviación estándar).

4021

of the parameter b (1/b) reflects a relative growth rate during the exponential phase, which for the logistic model is before reaching 50% of the asymptotic weight, i.e. before the turning point. Tables 1 and 2 show that the moment when body weight measurements began exceeded the parameter xo for the York Shire Terrier, Dachshund and Beagle breeds, which illustrates the lack of data during the exponential phase, biasing the results of 1/b for the breeds mentioned. Case et al (2) confirmed the shorter duration of the period of faster growth in small breeds, which ends at around 3 months of age, while in large and giant breeds, the exponential growth may be extended in 1 and 2 months, respectively. As an empirical rule, small and medium-sized dogs (adult weight up to 25 Kg) reached around 50% of their adult weight at approximately 4 months of age and those with a weight over 25 Kg, at about 5 months of age. This concept coincides with the results of this study, where small, medium and large breeds exhibited a mean value for the parameter xo corresponding to 3.49±0.03, 4.21±0.42 and 5.27±0.86 months, respectively (average + standard deviation).

De los resultados del presente trabajo se concluye que la duración del período de crecimiento de los perros depende del tamaño del animal. Las razas de perros grandes alcanzan la madurez mucho más tarde que las razas de perros pequeños. El 99% del peso corporal adulto (T99) para las razas pequeñas, medianas y grandes fue alcanzado en promedio a los 9.46±1.63, 12.52±0.61 y 14.37±1.79 meses, respectivamente (media+desviación estándar). Estos hallazgos coinciden con las indicaciones dadas por Case et al (2), referidas a que la madurez (tamaño adulto) se alcanza entre los 10 y 16 meses de edad para las razas grandes y entre los 6 y 12 meses de edad para las razas más pequeñas.

From the results of this study it is concluded that the duration of the growth period of dogs depends on the size of the animal. Large dog breeds reach maturity much later than small dog breeds. Ninety-nine percent of the adult body weight (T99) for small, medium and large breeds was achieved on average at 9.46±1.63, 12.52±0.61 and 14.37±1.79 months, respectively (average+standard deviation). These findings are in line with the indications given by Case et al (2), concerning that maturity (adult size) is reached between 10 and 16 months of age for large breeds and between 6 and 12 months of age for smaller breeds.

Con base en el concepto general referido a que la curva de crecimiento se estabiliza al año de edad, la mayoría de los fabricantes de alimentos y profesionales del sector recomiendan que el alimento para cachorros se garantice hasta ese momento, no obstante, es importante resaltar que este concepto sólo se aplica para cachorros de razas medias. Al tratarse de razas grandes o gigantes será necesario extender el aporte de nutrientes para cubrir las demandas de crecimiento por un período adicional, lo cual fue matemáticamente evidenciado a partir de los parámetros del modelo logístico empleado para el análisis de los datos del presente trabajo. De acuerdo con el NRC (4), las razas medianas, grandes y gigantes alcanzan el 95, 88 y 80% del peso maduro (20, 35 y 60 Kg, respectivamente) a los 12 meses de edad. Las guías

Based on the general concept that the growth curve stabilizes at one year of age, most food manufacturers and industry professionals recommend guaranteeing puppy food until that time, nevertheless, it is important to highlight that this concept is only applicable to medium breed puppies. When dealing with large or giant breeds it will be necessary to extend the supply of nutrients to meet the growth demands for an additional period, which was mathematically evidenced from the parameters of the logistic model used for the analysis of the data of this study. According to the NRC (4), medium, large and giant breeds reach 95, 88 and 80% of their mature weight (20, 35 and 60 Kg, respectively) at 12 months of age. Nutritional guidelines, as well

4022

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

nutricionales, así como los profesionales y personal responsable de la tenencia de mascotas deben orientar los planes de manejo (alimentación y actividad) a partir del conocimiento de las curvas de crecimiento que caracterizan las diferentes razas, que aunque sean de tamaño similar presentan diferencias en los parámetros estimados, como se evidenció en el presente trabajo. Es reconocido que la velocidad de crecimiento aporta información valiosa sobre riesgos nutricionales asociados, a saber, obesidad y enfermedad ortopédica del desarrollo, de común presentación en animales de compañía. En el presente trabajo, el modelo logístico se mostró adecuado para describir el crecimiento en perros de diferente tamaño, no obstante, un mayor tamaño muestral mejorará su capacidad predictiva, dada la variabilidad individual que caracteriza el crecimiento.

as professionals and personnel responsible for pet ownership, must guide the handling plans (feeding and activity) from the knowledge of the growth curves that characterize different breeds, which albeit of similar sizes have differences in the parameter estimated, as evidenced in this study. It is recognized that the growth rate provides valuable information about the associated nutritional risks, namely obesity and developmental orthopedic disease, common in pets. In this study, the logistic model was appropriate to describe the growth of different-sized dogs, however, a larger sample size will improve its predictive capability, given the individual variability that characterizes growth.

REFERENCES 1.

Trangerud C, Grøndalen J, Indrebø A, Tverdal A, Ropstad E, Moe L. A longitudinal study on growth and growth variables in dogs of four large breeds raised in domestic environments. J Anim Sci 2007; 85:76-83.

American Kennel Club. AKC Breeds complete breed list. [en línea] AKC: 2012; [acceso 30 de septiembre de 2013]. URL disponiblen en: http://www.akc.org/breeds/complete_ breed_list.cfm

Case LP, Carey DP, Daristotle L, Hayek MG, Raasch MF. Development and Treatment of Obesity. Canine and Feline Nutrition, 3th edición. USA: Mosby Elsevier; 2011.

SAS/STAT: User guide version [programa de ordenador]. Versión 9.1.3. Cary (NC): SAS Institute Incorporation; 2003.

Hawthorne AJ, Booles D, Nugent PA, Gettinby G, and Wilkinson J. Body-Weight Changes during Growth in Puppies of Different Breeds. J Nutr 2004; 134:2027S–2030S.

Kuhi HD, Porter T, Lopez S, Kebread E, Strathe AB, Dumas A, Dijkstra J, France J. A review of mathematical functions for the analysis of growth in poultry. World Poultry Sci J 2010; 66:227-240.

National Research Council -.NRC. Nutrient requirements of dogs and cats. 1a ed. Washington, D.C: National Academy Press; 2006.

German AJ. The Growing Problem of Obesity in Dogs and Cats. J Nutr 2006; 136:1940S-1946S.

Ulloa JTI, Rodríguez JAC. El modelo logístico: Una alternativa para el estudio del crecimiento poblacional de organismos. REDVET [en línea] 2010; [fecha de acceso 15 de septiembre de 2013]; 11(3). URL disponible en: http:// www.veterinaria.org/revistas/redvet/ n030310/031004.pdf

10. Malhado CHM, Ramos AA, Carneiro PLS, Souza JC, Wechsler FS, Eler JP, Azevêdo DMMR, Sereno JRB. Nonlinear models to describe the growth of the buffaloes of murrah breed. Arch Zootec 2008; 57:497-503. 11. Sarmento JLR, Regazzi AJ, Souza WH. Estudo da curva de crescimento de ovinos Santa Inês. Rev Bras Zootec 2006; 35:435-442.

Rev.MVZ Córdoba 19(1):4023-4032, 2014. ISSN: 0122-0268

SHORT COMMUNICATION

Single dose of secnidazole treatment against naturally occuring Giardia duodenalis infection in Sakiz lambs Tratamiento con dosis única con secnidazol en corderos naturalmente infectados con Giardia duodenalis Kerem Ural,1* Ph.D, Nuran Aysul,2 Ph.D, Huseyin Voyvoda,1 Ph.D, Bulent Ulutas,1 Ph.D, Osman S. Aldemir,2 Ph.D, Hasan Eren,2 Ph.D. University of Adnan Menderes, Department of Internal Medicine, Faculty of Veterinary Medicine, PK: 17, 09016, Isikli, Aydin, Turkey. 2Adnan Menderes University, Faculty of Veterinary Medicine, Department of Parasitology, Işıklı Mevki, 09016, Aydın, Turkey. *Corresponding: uralkerem@gmail.com 1

Received: June 2013; Accepted: November 2013.

ABSTRACT Objective. The purposes of this study were to determine whether secnidazole administered at a single dose of 10 mg/kg, orally, lessens or eliminates Giardia cyst shedding, and to validate the benefit of secnidazole treatment on clinical signs and faecal consistency in lambs naturally infected with Giardia duodenalis. Materials and methods. To this extent weaned 12 weeks of age lambs were selected and randomly assigned into two groups based on placebo (group C, n=7 untreated control group) or treatment (group S, n=10 lambs treated with a single dose of secnidazole at 10 mg/kg). Results. On days 0 and 10, before and after treatment, respectively, reduction in cyst excretion was determined. The faecal consistency and general health were recorded at each sampling day. Conclusions. During the study there was a high (99.98%) reduction in cyst excretion in the secnidazol treatment group compared to the positive control group on day 10, resulting in a significant (p<0.001) reduction, making secnidazole highly effective treatment option. Key words: Clinics, evaluation, lamb, secnidazol (Source: CAB).

RESUMEN Objetivo. El objetivo de este estudio fue determinar si la administración oral de una dosis única de secnidazol de 10mh/kg reduce o elimina la presencia de quistes de Giardia y validar el beneficio del tratamiento con secnidazol en los signos clínicos y la consistencia fecal de corderos infectados naturalmente con Giardia duodenalis. Materiales y métodos. Se seleccionaron corderos destetados de 12 semanas de edad que fueron asignados al azar a dos grupos con base a placebo (grupo C, n=7, grupo de control sin tratar) o tratamiento (grupo S, n=10 corderos con tratamiento de dosis única de secnidazol de 10 mg/kg). Resultados. En los días 0 y 10, antes y después del tratamiento, respectivamente, se determinó una merma en la excreción de quistes. La consistencia de la materia fecal y el estado general de salud fue registrado en cada muestreo diario. Conclusiones. Durante el estudio hubo una alta reducción en la excreción de quistes (99.98%) en el grupo tratado con secnidazol comparado con el grupo control positivo en el día 10, resultando en una disminución significativa (p<0.001), haciendo del tratamiento con secnizadol una opción altamente efectiva. Palabras clave: Evaluación, clinica, cordero, secnidazol, (Fuente: CAB).

4023

4024

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

INTRODUCCIÓN

INTRODUCTION

La Giardia duodenalis (G. lamblia and G. intestinalis) es el parásito intestinal más comúnmente diagnosticado en seres humanos y especies de animales en todo el mundo. Se sugiere que anualmente se presentan 2.5 millones de casos humanos relacionados con giardiasis en los Estados Unidos (1). La giardiasis también se presenta comúnmente en rumiantes. La prevalencia de la infección de G. duodenalis en el ganado puede presentar tasas del 9 al 38% en ovejas adultas (2-4) y del 68% en corderos (5). Las tasas de prevalencia en animales y humanos son a menudo subestimadas debido a la baja sensibilidad de algunos métodos de detección del parásito y la excreción intermitente de quistes. En Turquía, la prevalencia real de la giardiasis en el ganado ovino sigue siendo poco clara con relativamente pocos estudios que indican un 36.6% (6) y 48.48% (7).

Giardia duodenalis (G. lamblia and G. intestinalis) is the most commonly diagnosed intestinal parasite of humans and livestock species worldwide. It is suggested that 2.5 million human cases of giardiasis exist annually in the United States (1). Giardiasis also ocur commonly in ruminants. The prevalence of G. duodenalis infection in livestock may present rates from 9 to 38% in adult sheep (2-4) and 68% in lambs (5). Prevalence rates in both humans and animals are often underestimated through the low sensitivity of some parasite detection methods and the intermittent cyst excretion. In Turkey, the real prevalence of giardiasis in sheep remains unclear with relatively few studies indicating 36.6% (6) and 48.48% (7).

Entre las especies de Giardia morfológicamente definidas, Giardia agilis, G. microti, G. muris, G. psicatti y G. duodenalis, sólo el último infecta a los seres humanos y a la mayoría de mamíferos domésticos y salvajes (8). El espectro de la infección de Giardia varía desde la presentación asintomática de quistes de Giardia a giardiasis sintomática. La infección resultante de la G. duodenalis puede causar pérdida de la función de la barrera epitelial, atrofia de las vellosidades y hiperplasia de las criptas del intestino delgado (9, 10). Los resultados muestran que la infección y las alteraciones patológicas relacionadas con pueden ocasionar diarrea intermitente y mucosa (10), en la combinación de malabsorción intestinal e hipersecreción (11). Aunque la enfermedad clínica manifiesta carece de las alteraciones patológicas en asociación con el sistema gastrointestinal, puede por lo tanto resultar en una disminución de peso y una eficacia alterada de la alimentación (3,12). Los animales jóvenes son más propensos a desarrollar síntomas clínicos especialmente aquellos que se encuentran tensionados o inmunocomprometidos (8-11). La Giardia duodenalis se ha establecido como zoonosis en base a similitudes morfológicas y bioquímicas entre animales y humanos aislados así como en exámenes cruzados de infección. Por lo tanto los animales de compañía y sacrificio pueden tener el potencial de infectar a los seres humanos a través de transmisión por el agua o el contacto directo con heces contaminadas (13, 14). A pesar de la falta evidencia convincente que relacione la contaminación de fuentes de agua por ovinos con brotes de Giardia, los rebaños de ovejas son considerados como una amenaza potencial (14). En este sentido, los rumiantes pequeños se proponen como un reservorio de para la infección humana (2, 14). Todos los animales infectados con giardiasis

Among the morphologically defined Giardia species, Giardia agilis, G. microti, G. muris, G. psicatti and G.duodenalis, only the latter infects humans and most domestic and wild mammals (8). The spectrum of Giardia infection vary from asymptomatic shedding of giardial cysts to symptomatic giardiasis. The infection resulted from G. duodenalis may cause epithelial barrier function loss, villus atrophy and crypt hyperplasia in the small intestine (9, 10). Findings presented that infection and related pathological alterations may result in intermittent and mucous diarrhea (10), within the combination of intestinal malabsorption and hypersecretion (11). Even if overt clinical disease is lacking the pathological alterations in association with the gastrointestinal system may consequently result in a declined weight gain and to an altered feed efficiency (3,12). Young animals are most likely to develop clinical symptoms especially those stressed or immunocompromised (8-11). Giardia duodenalis has established itself as zoonoses based upon biochemical and morphological similarities among animal and human isolates as well as cross infection surveys. Thus companion and food animals may have the potential to infect humans either through waterborne transmission or direct contact with contaminated feces (13, 14). Albeit the lack of strong evidence connecting contamination of water supplies by sheep with Giardia outbreaks, sheep flocks are considered as a potential threat (14). In this sense, small ruminants are suggested as a reservoir for human infections (2, 14). All animals infected with giardiasis should therefore promptly treated whether presenting clinical signs or not, because of potential source of infection for humans or other animals (9).

Ural - Single dose of secnidazole treatment in Sakiz lambs deben por lo tanto ser tratados rápidamente ya sea que presenten signos clínicos o no, debido a la potencial fuente de infección para los seres humanos u otros animales (9). El tratamiento tradicional contra la giardiasis en seres humanos incluye el uso de 5-nitroimidazoles como metronidazol, tinidazol y ornidazol, que a pesar de ser una terapia efectiva en poblaciones con prevalencias altas, puede consistir del uso de una dosis oral única del medicamento que posee una baja toxicidad y relativamente pocos efectos secundarios (15), por ejemplo podría ser proporcionada mediante secnidazol (15-17). Al igual que en los exámenes entre seres humanos, se obtuvo una tasa de erradicación parasitológica del 100% después del tratamiento con una dosis única de secnidazol en gatos infectados con G. duodenalis (18). Actualmente ningún medicamento está autorizado o aprobado por la FDA para el tratamiento de la giardiasis en rumiantes. El Fenbendazol (9,19) y albendazol (20) tuvieron como resultado un beneficio clínico en corderos y ovejas tratadas. Además, se encontró que la paromomicina es efectiva en corderos (21). Sin embargo, el fenbendazol y albendazol requieren de múltiples dosis y la paramomicina es costosa. Ya que los datos sobre la eficacia del tratamiento contra la giardiasis en ovejas se basan en estudios limitados y ya conocidos, además de los casos refractarios al tratamiento tradicional existe la necesidad de evaluar regímenes de tratamientos novedosos con precios razonables. El propósito de este estudio fue evaluar la eficacia de una dosis única de secnidazol en corderos infectados naturalmente con G. duodenalis.

MATERIALES Y MÉTODOS Animales, alojamiento y cría. Un tamaño de muestra de un total de 17 corderos Sakiz de 12 semanas de edad que fueron comprados a un proveedor comercial nacional, donde fueron agrupados y ubicados en heno como lecho. Durante el período de asignación (10 días) todos los corderos fueron evaluados dos veces con un intervalo de 10 días para confirmar la presencia/ausencia de quistes de G. duodenalis y ooquistes de Cryptosporidium parvum en las heces. Todos los animales fueron previamente tratados profilácticamente con toltrazuril (Cevazuril® Ceva-Vet, 20 mg/kg peso corporal) para prevenir la coccidiosis. Antes de la prueba, el alojamiento fue limpiado y desinfectado con un producto que contiene amonio cuaternario para la eliminación de la posible contaminación ambiental existente. Por un periodo de 10 días de duración se agregó paja al lecho de los corrales. Además se tomaron medidas estrictas para evitar la contaminación cruzada entre ambos grupos experimentales. Todos los corderos recibieron

4025

The traditional anti-Giardial treatment in humans includes the usage of 5-nitroimidazoles such as metronidazole, tinidazole and ornidazole, albeit effective therapy among populations with high prevalences, may be conformed by the usage of single oral dose drug possessing low toxicity and relatively few side effects (15), for instance might be provived by secnidazole (15-17). Similar to surveys among humans, parasitological eradication rate of 100% was obtained after single-dose treatment with secnidazole in cats infected with G. duodenalis (18). Currently no drug is licensed or FDA approved for the treatment of giardiasis in ruminants. Fenbendazole (9,19) and albendazole (20) resulted in a clinical benefit in treated lambs and sheep. Furthermore, paromomycin was found to be effective in lambs (21). However, fenbendazole and albendazole require multiple doses, and paramomycin is expensive. As data on the efficacy of anti-Giardial treatment in sheep involves limited and aforementioned studies, besides cases refractory to traditional treatment there is a need to evaluate novel and reasonably priced treatment regimens. The purpose of this study was to evaluate the efficacy of a single dose of secnidazole in lambs naturally infected with G. duodenalis.

MATERIALS AND METHODS Animals, housing and husbandry. A sample size of a total of 17 Sakiz lambs at the age of 12 weeks were purchased from a national commercial vendor, where they were group housed on hay as contact bedding. During the allocation period (10 days) all lambs were screened twice with a 10 days interval to conﬁrm the presence/absence of G. duodenalis cysts and Cryptosporidium parvum oocysts in the faeces. All animals were previously treated prophyl acti cal l y wi th tol trazuril (Cevazuril® Ceva-Vet, 20 mg/kg bodyweight) to prevent coccidiosis. Prior to the trial, the housing was cleaned and disinfected with a product containing quaternary ammonium for elimination of probable existing environmental contamination. For 10 days duration straw bedding was added to the pens. In addition strict measures were performed to prevent crosscontamination between both experimental groups. All lambs received commercial lamb ﬂakes, to ensure equivalent diets. Water and hay was provided ad libitum throughout the study period. Ethical guidelines were taken into consideration for enrollment into the groups.

4026

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

hojuelas comerciales para cordero, para asegurar dietas equivalentes. Se proporcionó agua y heno ad libitum durante todo el período de estudio. Se tomaron en consideración guías éticas para la asignación de los grupos.   Flotación de materia fecal y examen microscópico de las muestras de heces. El día 0 (D0) previo al tratamiento fue designado como el tratamiento inicial de la prueba. Se tomaron muestras de cada cordero en 2 ocasiones y fueron designadas como D0 o día 10 (D10) (después del tratamiento). Las muestras fecales (aprox. 10 g) fueron recolectadas en D0 manualmente del recto de todos los corderos participantes y fueron enviadas de inmediato al Departamento de Parasitología para flotación fecal. Se mezcló la materia fecal con 15 ml de una solución de ZnSO4 al 33% (p/v) que fue filtrada en tubos de centrífuga, que luego fueron centrifugados a 880 x g durante 5 minutos como se anotó anteriormente (5). Tras la centrifugación, una muestra pequeña de la solución de la mezcla fecal fue recogida y colocada sobre un portaobjetos y cubiertas con Lugol. El portaobjetos fue examinado con una ampliación de 40x para detectar la presencia de quistes de Giardia. La última prueba se repitió 2 veces a partir de diferentes muestras para cada cordero recogidas en el día 0 por un solo investigador a ciegas. Para participar en el presente estudio se demostró una monoinfección con G. doudenalis únicamente por medio de muestras fecales microscópicas según lo reportado anteriormente por Escobedo et al (17). Criterios clínicos. Se registraron los datos sobre la salud general y la consistencia de la materia fecal antes y después del tratamiento. La consistencia fecal fue examinada por la forma descrita por Le Jambre et al (22) y similar a Geurden et al (9). Evaluación de la eficacia del tratamiento. La eficacia del tratamiento con secnidazol en el presente estudio fue evaluada mediante el examen microscópico de muestras fecales recolectadas en D0 y D10 (después de la finalización del tratamiento), con el fin de evitar el sesgo que sería introducido por una reinfección y medida en base a la reducción de la excreción de quistes para el grupo de tratamiento en comparación con los del grupo de control. La reducción en la excreción de quistes fue calculada mediante la fórmula de Henderson– Tilton (23), que involucra la media geométrica del recuento de quistes similar a Geurden et al (9):

Ta y Tb representan la media geométrica del recuento de quistes en el grupo de tratamiento

Fecal flotation and microscopic examination of fecal samples. Pretreatment day 0 (D0) was designated as the initial treatment of the trial. Collections from each lamb were obtained on 2 occasions and were designated etiher D0 or day 10 (D10) (after treatment). Fecal samples (approximately 10 g) were collected on D0 manually from the rectum of all lambs involved and were submitted immediately to Department of Parasitology for fecal flotation. Fecal material was mixed with 15 ml of 33% (w/v) ZnSO 4 solution and strained onto centrifuge tubes, which then was spunned in centrifuge at 880 x g for 5 minutes as reported previously (5). Following centrifugation, a small sample of the fecal mixture solution was collected and placed on a microscope slide involving Lugol iodine, which was covered by a slip. The slide was examined 40x power for the presence of Giardia cysts. The latter test was repeated for 2 times from different samples for each lamb collected on day 0 by a single blinded researcher. For enrollment in the present study mono infection with G. doudenalis was proven only by microscopical fecal samples as reported previously by Escobedo et al (17). Clinical criteria. Data on general health and faecal consistency were recorded before and after treatment. The faecal consistency was scored as previously described by Le Jambre et al (22), and similar to that of Geurden et al (9). Assessment of efficacy of treatment. Secnidazole treatment efficacy in the present study was assessed by microscopic examination of fecal samples collected on D0 and D10 (after treatment completion), in order to avoid the bias that would be introduced by reinfection, and measured based on the reduction in cyst excretion for treatment group compared to those of control group. The reduction in cyst excretion was calculated using the Henderson–Tilton formula (23), involving geometric mean cyst counts similar to those of Geurden et al (9):

Ta and Tb; represented the geometric mean cyst count in the secnidazole treatment group before and after treatment, respectively; where as Ca and Cb; the geometric mean cyst count in the control animals before and after treatment (24). The Henderson–Tilton formula is considered as the most appropriate method as described and used previously by Geurden et al (9).

Ural - Single dose of secnidazole treatment in Sakiz lambs con secnidazol antes y después del tratamiento, respectivamente; mientras que Ca y Cb representan la media geométrica del recuento de quistes en los animales de control antes y después del tratamiento (24). La fórmula de Henderson–Tilton es considerada como el método más apropiado de acuerdo con lo que ha sido descrito y utilizado previamente por Geurden et al (9). Análisis estadístico. Se realizaron análisis estadísticos utilizando el paquete estadístico SPSS (versión 13; SPSS Inc., Chicago, IL). La distribución normal de los resultados de los recuentos de quistes fecales en los grupos de control y de tratamiento fue comprobada mediante la prueba de Kolmogorov–Smirnov. El recuento de quistes fecales no tuvo una distribución normal; por lo tanto, los datos del conteo de quistes fecales fueron transformados a una función logarítmica para lograr una distribución casi normal. Se realizó una prueba t de muestras independiente para comparar los recuentos de quistes fecales antes (D0) y 10 días después del inicio del tratamiento (D10) entre los grupos. Se realizaron comparaciones dentro de cada uno de los grupos con el valor base de quistes determinado mediante la prueba de t para medidas dependientes. Se consideró que la probabilidad (p<0.05) obtenida indica una diferencia significativa. Los datos resumidos se presentan como una media geométrica y un rango.

RESULTADOS Manejo de los animales y aplicaciones del tratamiento. No se detectaron reacciones observables y significativas adversas al tratamiento con secnidazol en este estudio. Todos los corderos involucrados se encontraban en buenas condiciones generales de salud. Todos los corderos en ambos grupos presentaron signos clínicos compatibles con la Giardiosis adquirida naturalmente, los cuales incluyeron diarrea. No se encontró ninguna infección de Cryptosporidium ni coccidosis en ninguno de los animales que participaron durante todo el período de estudio. Diecisiete corderos Sakiz de 12 semanas de edad, de ambos sexos, que tuvieron resultados positivos cuando fueron examinados mediante un microscópico para detectar G. duodenalis, fueron distribuidos en dos grupos. Siete corderos fueron asignados aleatoriamente al grupo control positivo (grupo C), teniendo en cuenta pautas éticas y los consentimientos escritos de sus propietarios. Los corderos restantes (n=10) fueron asignados al grupo con el tratamiento con secnidazol ( grupo S), a los cuales se les administró el fármaco anterior (Flagentyl® Eczacibaşi, tabletas de 500 mg) en una dosis oral única de 10 mg/kg. Debido a las preocupaciones éticas y el valor comercial

4027

Statistical analysis. Statistical analyses were performed using the SPSS statistical software package (version 13; SPSS Inc., Chicago, IL). The results for faecal cyst counts in both control and treatment groups were tested for normality using the Kolmogorov–Smirnov test. The faecal cyst count was not normally distributed; therefore, the data on faecal cyst count were log-transformed to achieve nearnormality. An independent-samples t test was conducted to compare faecal cyst counts before (D0) and 10 days after the start of treatment (D10) between the groups. Within-group comparisons with baseline cyst value were made using t test for dependent measures. Probability (p<0.05) was considered to indicate a significant difference. Summarized data were presented as geometric mean and range.

RESULTS Animal management and treatment applications. No observable and significant adverse reactions to secnidazole treatment were detected in the present study. All involved lambs were in good general health condition. All lambs in both groups had clinical signs compatible with naturally occuring Giardiosis, i nvol vi ng di arrhea. No C ryptosporidium and nor coccidosis infection were found in any of the animals enrolled throughout the study period. Seventeen Sakiz lambs at the age of 12 weeks, of both sexes, that tested microscopically positive for G. duodenalis, were allocated into two groups. Seven lambs were randomly assigned to the positive control group (group C), with taking into account the ethical guidelines and written owners consent. The remaining lambs (n=10) were enrolled in secnidazole group (group S), receiving the latter drug (Flagentyl ® Eczacıbaşı, 500 mg tablets) at a single dosage of 10 mg/ kg perorally. Due to ethical concerns and commercial value of the lambs, only a limited number of animals served as controls. Albeit at the end of the study all positive control animals were also treated with secnidazol at the same dosage to the previosuly treated animals. Cyst excretion. The results of the cyst counts were presented in table 1. Throughout the study period lambs in control group C remained positive, besides 5 out of 7 lambs presented an increase in cyst counts on day 10 (ranged 340-47600) compared to the initial values (ranged between 1000-39500), albeit there was no statistical significance. On day 10, after secnidazol treatment, the percentage reduction in cyst excretion calculated based on geometric

4028

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

de los corderos, únicamente un número limitado de animales fueron asignados al grupo de control. Aunque al final del estudio todos los animales del grupo control positivo fueron tratados también con secnidazol en la misma dosis que los animales tratados anteriormente. Excreción de quistes. Los resultados de los recuentos de quistes se presentan en la Tabla 1. Durante el período de estudio, los corderos en el grupo de control C permanecieron como positivos, además 5 de 7 corderos presentaron un aumento en el recuento de quistes en el día 10 (intervalo de 340-47.600) en comparación con los valores iniciales (variación de 1.000-39.500), aunque no hubo significación estadística. El día 10, después del tratamiento con secnidazol, la reducción porcentual en la excreción de quistes calculada en base a la media geométrica fue sorprendentemente alta con el 99.98%. Para el grupo S la media geométrica para la excreción de quistes fue significativamente menor (p<0.001) después del tratamiento. Resultados de la calificación fecal. La consistencia de la materia fecal fue elevada en aproximadamente la mayoría de los animales y 15 de 17 corderos tuvieron una calificación de 2 o 3 fecal en un solo día de muestreo 0, mientras que en el día 10 todos los corderos tratados tuvieron una consistencia fecal normal (calificación 1).

DISCUSIÓN

Table 1. The Giardia duodenalis cyst excretion in the control (Group C) and in the secnidazole treated (Group S) groups at each sampling day (before treatment [day 0] and after treatment [day 10]): the geometric mean (geomean) (X G) was presented and the percentage reduction calculated based on geometric mean. The values at day 0 were cyst excretion prior to treatment. D0 XG

D10 Range

Group C

11947.854a 1000-39500

Group S

10676.056a

Reduction in cyst excretion (%)

800-35200

Range

13175.021a

340-47600

1.47876b

0-50 99.98%

*Diferrent letters among parameters at the same columns and rows indicated statistically significant difference (p<0.001).

mean was surprisingly very high as 99.98%. For group S geometric mean for cyst excretion was significantly decreased (p<0.001) after treatment. Faecal scoring results. The faecal consistency was high in approximately most of the animals and 15 out of 17 lambs had a fecal score of 2 or 3 on a single sampling day 0, whilst on day 10 all treated lambs had normal faecal consistency (score 1).

A pesar del reconocimiento de la giardiasis como un patógeno intestinal significativo en seres humanos, relativamente pocas opciones, específicamente derivados del nitroimidazol, están disponibles comercialmente como terapia (25). Por un largo periodo de tiempo, los compuestos de 5-nitroimidazol (metronidazol y otros), son la primera opción de tratamiento contra la giardiasis y son utilizados más ampliamente aun (25,26). Aunque su eficacia parcial y los casos refractarios a las aplicaciones de terapia dentro de los compuestos anteriores se están volviendo comunes (27). Claramente existe una necesidad de evaluar opciones de tratamientos novedosos tanto en seres humanos y en campos veterinarios de animales pequeños y grandes.

DISCUSSION

Los derivados del nitroimidazol, especialmente la segunda generación como el secnidazol, son efectivos en una sola dosis y han demostrado ser efectivos y baratos (25). El secnidazol se encuentra relacionado con los 5-nitroimidazoles utilizados. Los medicamentos anteriores son activos contra microorganismos anaerobios y son eficaces para el tratamiento de la giardiasis. (28). El secnidazol se absorbe rápida y completamente después de ser administrado por vía oral y tiene una

Nitroimidazole derivatives, especially the second generation such as secnidazole, is effective in a single dose, and have proven t o b e e f f i c a c o u s a n d i n e x p e n s i ve ( 2 5 ) . Secnidazole is related to the commonly used 5-nitroimidazoles. The latter drugs present an activity against anaerobic microorganisms and are effective for the treatment of giardiasis. (28). Secnidazole is rapidly and completely absorbed after oral administration

Despite the recognition of giardiasis as a significant human intestinal pathogen, relatively few options, specifically nitroimidazole derivatives are commercially available for therapy (25). For a long while, 5-nitroimidazole compounds, (metronidazole and other ones), are first line anti-Giardial treatment choice and are still been widely using (25,26). Albeit their partial efficacy, cases refractory to therapy applications within the latter compounds are becoming common (27). There is clearly a need for evaluating novel treatment options both in humanbeing and for small and large animal veterinary fields.

Ural - Single dose of secnidazole treatment in Sakiz lambs vida media de eliminación terminal mayor (aproximadamente de 17 a 29 horas) que los medicamentos utilizados comúnmente en esta clase (28,29). Se comercializa para el tratamiento de la giardiasis en los seres humanos. Tiene la ventaja de poder ser administrado en una dosis única con efectos curativos demostrados. La terapia contra la giardiasis con secnidazol ha sido objeto de varios artículos de investigación en seres humanos (15-17). Un brote de giardiasis fue detectado en ovejas en Italia, mientras que los corderos infectados con una edad de 30 a 90 días presentaron síndrome de malabsorción con una disminución de peso y deterioro en la eficiencia de alimentación con excreción de heces malolientes y mal formadas. La terapia con fenbendazol en una dosis de 10 mg/kg durante 3 días consecutivos tuvo como resultado la desaparición exitosa de la infección (19). En un estudio previo que evaluó la eficacia del fenbendazol en una dosis de 15 mg/kg/día durante 3 días consecutivos en corderos infectados experimentalmente con giardiasis, hubo una alta (≥97.8%) y continua reducción en la excreción de quistes en el grupo de tratamiento en comparación con el grupo control positivo (placebo) durante 12 días, resultando en una reducción significativa (p<0.001) de la excreción de quistes acumulados (9). El tratamiento con albendazol fue objeto de otra prueba en ovejas con infección de Giardia sp. en 2 diferentes grupos de animales con 10 y 20 mg/kg de albendazol durante 3 días consecutivos, en el cual las eficacias de albendazol en una dosis de 10 y 20 mg/kg en ovejas fueron del 58.8% y del 100%, respectivamente 20 días después del tratamiento (20). En un estudio reciente con corderos infectados naturalmente con Giardia en Turquía, se comparó la eficacia terapéutica de 20 mg de albendazol, 50 mg y 100 mg de paromomicina (kg peso corporal por vía oral) por 3 días consecutivos. De acuerdo a los resultados de este estudio, la paromomicina pareció ser más efectiva que el albendozole para el tratamiento (21). De acuerdo con conocimiento de estos autores, la alta eficacia de una dosis única de 10 mg/kg en un tratamiento oral con secnidazol en contra de giardiasis adquirida naturalmente en corderos ha sido demostrada por primera vez. En el presente estudio clínico, el secnidazol fue tolerado de forma adecuada, sin efectos gastrointestinales adversos evidentes, por lo tanto no requirió la intervención en el tratamiento o el retiro del tratamiento. La evidencia disponible sugiere que el secnidazol puede ser eficaz como otros medicamentos 5-nitroimidazoles en el tratamiento de la giardiasis en corderos.

4029

and has a longer terminal elimination halflife (approximately 17 to 29 hours) than commonly used drugs in this class (28,29). It is commercialized for the treatment of giardiasis in humans. It has the advantage to be administered in a single dose with sound curative effects. Anti-Giardial therapy within secnidazole has been the subject of various research articles in humanbeing (15-17). An outbreak of giardiasis was detected among sheep in Italy, whereas infected lambs at the age of 30–90 days presented malabsorption syndrome with decreased weight gain and impairment in feed efficiency within the excretion of malodorous and poorly formed faeces. Therapy with fenbendazole at a dose of 10 mg/kg for 3 consecutive days resulted in successfull clearence of the infection (19). In a prior study evaluating the efficacy of fenbendazole at 15 mg/kg/day during 3 consecutive days in lambs experimentally infected with giardiasis, there was a high (≥97.8%) and continuous reduction in cyst excretion in the treatment group compared to the positive control group (placebo) for 12 days, resulting in a significant (p<0.001) reduction of the cumulative cyst excretion (9). Albendazole treatment was the subject of another trial in sheep with Giardia sp. infection at 2 different groups of animals with 10 and 20 mg/kg albendazole for 3 consecutive days, in which the efficacies of 10 mg/kg and 20mg/kg albendazole on sheep were 58.8% and 100%, respectively after 20 days posttreatment (20). In a recent trial lambs with naturally occuring Giardia infection in Turkey, the therapeutic efficacy of 20 mg albendazole, 50 mg and 100 mg paromomycin (kg body weight orally) for 3 consequtive days were compared. According to the results of that study paromomycin apperaed to be more effective than albendozole for the treatment (21). To t h e p r e s e n t a u t h o r s ’ k n o w l e d g e t h e high efficacy of a single dose of an oral treatment with secnidazole at 10 mg/kg against naturally occuring giardiasis in lambs has been demonstrated for the first time. In the present clinical trial, secnidazole was well tolerated, no adverse events were evident within gastrointestinal in nature, thus did not require treatment intervention or withdrawal from therapy. Available evidence suggested that secnidazole may be efficacious as other 5-nitroimidazole drugs in the treatment of giardiasis in lambs.

4030

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

La eficacia del secnidazol en corderos es comparable con aquella descrita en gatos infectados naturalmente con giardiasis, en los cuales una única dosis oral de 30 mg/kg produjo una eficacia del 100%, ya que no se encontraron quistes en las heces después del tratamiento (18). En el presente estudio, el tratamiento con secnidazole redujo significativamente la excreción de quistes calculada en base a la media geométrica en un 99.98% el día 10 después del inicio del tratamiento, lo tiene como resultado una reducción significativa (p<0.001) en la excreción de quistes en el grupo tratado con secnidazol. De igual manera en otra especie parásita de protozoo ciliado, la infección de Balantidium coli en ganado en Pakistán fue tratada con secnidazol en una dosis vía oral de 10 mg/kg con una eficacia final del 87.5%, convirtiéndolo en la opción más efectiva a diferencia del metronidazol o la oxitetraciclina en ese estudio (30). La conveniencia y facilidad de administración asociada con el tratamiento de dosis única, combinado con un buen perfil de tolerabilidad, hacen del secnidazol una opción adecuada y una alternativa atractiva, además de probablemente superior a los regímenes de dosis múltiples con otros derivados del nitroimidazol. Dada la eficacia del secnidazol (ya que tuvo como resultado una excreción significativamente menor de quistes) en un tratamiento de una sola dosis para infecciones de Giardia adquiridas naturalmente entre los corderos Sakiz involucrados en el presente estudio, se recomienda el uso de este medicamento. La alta reducción de quistes del secnidazol en contra de la G. duodenalis puede ofrecer un beneficio importante en un ambiente clínico donde un diagnóstico específico es imposible o poco práctico, así como la condición de los animales. La disponibilidad de este medicamento económico, el costo (aproximadamente 2,2 dólares por cordero por terapia) y la disponibilidad de oportunidades de mercado han sido impedimentos importantes para el uso de este medicamento antiparasitario en contra de la giardiasis en ovinos.

The efficacy of secnidazole in lambs is comparable to what has been described in cats naturally infected with giardiasis, in which an oral single dose of 30 mg/kg resulted in 100 % efficacy, as no cysts were found in faeces after treatment (18). In the present study secnidazole treatment significantly reduced the cyst excretion calculated based on geometric mean by 99.98% on day 10 after the start of the treatment, resulting in a significant reduction (p<0.001) in cyst excretion in secnidazole treatment group. Similarly in another parasitic species of ciliate protozoan, Balantidium coli infection cattle in Pakistan were treated with secnidazole at a dosage of 10 mg/kg perorally with a final efficacy of 87.5%, making it the most efffective choice in contrast to metronidazole or oxytetracycline in that study (30). The convenience and ease of administration associated with single-dose therapy, combined with a good tolerability profile, make secnidazole a suitable option and an attractive, besides probably superior alternative to multiple dosage regimens with other nitroimidazole derivatives. Given the efficacy of secnidazole (as it resulted in a significantly decreased cyst excretion) as a single dose for treatment of naturally occuring Giardia infection among Sakiz lambs involved in the present study, the usage of this of drug should be encouraged. The high cyst reducing activity of secnidazol against G. duodenalis may provide an important benefit in a clinical setting where a specific diagnosis is impossible or impractical, likewise livestock field condition. The availability of this inexpensive drug, the cost (approximately 2.2 dollars per a lamb for therapy) and the easily availability for market opportunity have been significant impediments for usage of this antiparasitic drug against giardiasis in sheep.

REFERENCES 1.

Furness BW, Beach MJ, Roberts JM. Giardiasis surveillance - United States, 1992–1997. Morbidity and Mortality weekly Report (MMWR) 2000; 49(SS07):1–13.

Geurden T, Vercruysse J, Claerebout E. Is giardia a significant pathogen in production animals?. Exp Parasitol 2009; 124:98–106.

Olson ME, McAllister TA, Deselliers L, Morck DW, Cheng KJ, Buret AG, Ceri H. Effects of Giardiasis on production in a domestic ruminant (lamb) model. Am J Vet Res 1995; 56:1470-1474.

Ryan UM, Bath C, Robertson I, Read C, Elliot A, McInnes L, Traub R, Besier B. Sheep may not be an important zoonotic reservoir for Cryptosporidium and Giardia parasites. Appl Environ Microbiol 2005; 71:4992–4997.

Ural - Single dose of secnidazole treatment in Sakiz lambs 5.

Wilson JM, Hankenson FC. Evaluation of an inhouse rapid ELISA test for detection of Giardia in domestic sheep (Ovis aries). J Am Assoc Lab Anim Sci 2009; 49(6):809-813.

Ozmen O, Yukari BA, Haligur M, Sahinduran S. Observations and immunohistochemical detection of coronavirus, cryptosporidium parvum and giardia intestinalis in neonatal diarrhoea in lambs and kids. Schweiz Arch Tierheilkd 2006; 148:357-364.

Ozdal N, Tanritanir P, Goz Y, Deger S, Kozat S. Parasitic protozoans (Eimeria, Giardia, and Cryptosporidium) in lambs with diarrhoea in the Van Province (Turkey). Bull Vet Inst Pulawy 2009; 53:47-51. van der Giessena JWB, de Vriesa A, Roosa M, Wielingaa P, Kortbeekb LM, Mankc TG. Genotyping of Giardia in Dutch patients and animals: A phylogenetic analysis of human and animal isolates. Int J Parasitol 2006; 36(7):849-858. Geurden T, Pohleb H, Sarrea C, Dreesena L, Vercruyssea J, Claerebouta E. The efficacy of a treatment with fenbendazole against an experimental Giardia duodenalis infection in lambs. Small Rum Res 2011; 96(23):211–215.

10. Ruest N, Couture Y, Faubert GM, Girard C. Morphological changes in the jejunum of calves naturally infected with giardia spp. and cryptosporidium spp. Vet Parasitol 1997; 69:177-186. 11. Buret AG. Pathophysiology of enteric infections with Giardia duodenalius. Parasite 2008; 15(3):261-265. 12. Sweeny JP, Jacobson C, Robertson I, Ryan UM. Carcass productivity consequences of trichostrongylid and protozoan parasites in Merino×Suffolk prime lambs in the South West of Western Australia. Conference proceedings: Melbourne, Australia: The International Congress of parasitology (ICOPA); 2010. 13. Gaydos J. Giardia and Wildlife South Coop Wild Dis St Br 1998; 14:2. 14. Robertson LJ. Giardia and Cryptosporidium infections in sheep and goats: A review of the potential for transmission to humans via environmental contamination. Epidemiol Infect 2009; 137:913–921.

4031

15. Di Prisco MC, Jiménez JC. Rodríguez N, Costa V, Villamizar J, Silvera A, Carrillo M, Lira C, Zerpa E, López Y. Clinical trial with secnidazole in a single dose in venezuelan children infected by Giardia intestinalis. Invest Clin 2000; 41:179-188. 16. Almirall P, Escobedo AA, Ayala I, Alfonso M, Salazar Y, Cañete R, et al. Mebendazole compared with secnidazole in the treatment of adult giardiasis: A randomised, noinferiority, open clinical trial. J Parasitol Res 2011; 1-6. doi:10.1155/2011/636857. 17. Escobedo AA, Canete R, Gonzalez ME, Pareja A, Cimerman S, Almirall P. Randomized trial comparing mebendazole and secnidazole for the treatment of giardiasis. Ann Trop Med Parasitol 2003; 97(5): 499–504. 18. DaSilva AS, Castro VSP, Tonin AA, Brendler S, Costa MM, Jaques JA, Bertoletti B, Zanette RA, Raiser AG, Mazzanti CM, Lopes STA, Monteiro SG. Secnidazole for the treatment of giardiasis in naturally infected cats. Parasitol Int 2011; 60(4):429-432. 19. Aloisio F, Filippini G, Antenucci P, Lepri E, Pezzotti G, Cacciò M S, Pozio E. Severe weight loss in lambs infected with Giardia duodenalis assemblage B. Vet Parasitol 2006; 142(1–2):154-158. 20. Mohammed BA. Efficacy of albendazole with two different doses for the treatment of giardiasis in domestic ruminants. Iraq J Vet Sci 2006; 20(2):265-282. 21. Albay MK, Sahinduran S, Adanir R, Yukari BA, Kose O. Efficacy of albendazole and two different doses of paromomycin for treatment of naturally occurring giardia infection in lambs. Kafkas Univ Vet Fak Derg 2011; 17:1021-1024. 22. Le Jambre LF, Dominika S, Eadya SJ, Henshalla JM, Colditza IG. Adjusting worm egg counts for feacal moiture in sheep. Vet Parasitol 2007; 145:108-115. 23. Henderson CF, Tilton EW. Tests with acaricides against the brown wheat mite J Econ Entomol 1955; 48:157-161. 24. Presidente PJA. Resistance in nematodes to anthelmintic drugs. Australia: CSIRO Division of Animal Health Australian Wool Corporation; 1985.

4032

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

25. Rossignol JF. Cryptosporidium and Giardia: Treatment options and prospects for new drugs. Exp Parasitol 2010; 124:45-53. 26. Busatti HGNO, Santos JFG, Gomes MA. The old and new therapeutic approaches to the treatment of giardiasis:Where are we? Biologics 2009; 3:273-287. 27. Nash TE, Ohl CA, Thomas E, Subramanian G, Keiser P, Moore TA. Treatment of Patients with Refractory Giardiasis. Clin Infect Dis 2001; 33:22-28.

28. Gillis JC, Wiseman LR. Secnidazole. A review of its antimicrobial activity, pharmacokinetic properties and therapeutic use in the management of protozoal infections and bacterial vaginosis. Drugs 1996; 51:621-638. 29. Videau D, Niel G, Catalan F. Secnidazole A 5-nitroimidazole derivative with a long half-life. Brit J Vener Dis 1978; 54:77-80. 30. Bilal CQ, Khan MS, Avais M, Ijaz M, Khan JA. Prevalence and chemotherapy of Balantidium coli in cattle in the River Ravi region, Lahore (Pakistan). Vet Parasitol 2009; 163(1-2):15-17.

Rev.MVZ Córdoba 19(1):4033-4040, 2014. ISSN: 0122-0268

SHORT COMMUNICATION

Estimation of genetic parameters for milk traits in Romanian local sheep breed Estimación de parámetros genéticos para características de la leche en la raza ovina local Rumano Pelmus RS,* Ph.D, Pistol GC, Ph.D, Lazar C, Ph.D, Gras MA, Ph.D, Ghita E, Ph.D. National Research-Development Institute for Animal Biology and Nutrition, INCDBNA, Laboratory of Animal Biology, 1, Calea Bucuresti, 077015, Balotesti, Romania. *Correspondence: pelmus_rodica_ stefania@yahoo.com Received: March 2013; Accepted: November 2013.

ABSTRACT Objective. Estimate the genetic parameters for milk traits in a Romanian local sheep population Teleorman Black Head. Material and methods. Records of 262 sheep belonging to 17 rams and 139 ewes were used in the study. The following traits were investigated: milk yield, fat yield, protein yield, fat percentage and protein percentage. The genetic parameters were estimated using the Restricted Maximum Likelihood method, with a model including maternal effects. Results. The results from our study revealed that direct heritability estimates were moderate for milk yield (0.449), fat yield (0.442), protein yield (0.386) while for protein percentage (0.708) and fat percentage (0.924) were high. The high direct and maternal genetic correlation was between milk yield and protein yield (0.979, 0.973) and between protein yield and fat yield (0.952, 0.913) while the phenotypic correlation between the milk yield and fat yield (0.968), the milk yield and protein yield (0.967), fat yield and protein yield (0.936) was high and positive. Conclusions. The genetic parameters are important in selection program on this breed for genetic improvement. Key Words: Genetic improvement, milk production characteristics, ovinos (Source: CAB).

RESUMEN Objetivo. Estimar los parámetros genéticos para características de la leche en una población de ovinos locales Rumanos Teleorman cabeza negra. Materiales y métodos. En el estudio se utilizaron registros de 262 animales pertenecientes a 17 carneros y 139 ovejas. Se investigaron los siguientes rasgos: producción de leche, producción de grasa, producción de proteína, porcentaje de grasa y porcentaje de proteína de la leche. Los parámetros genéticos fueron estimados mediante el método de Máxima Verosimilitud Restringida, con un modelo que incluye efectos maternos. Resultados. Los resultados de este estudio revelaron que la heredabilidad directa fue moderada para la producción de leche (0.449), producción de grasa (0.442) y producción de proteína (0.386) mientras que para el porcentaje de proteína (0.708) y el porcentaje de grasa (0.924) fueron altos. La alta correlación genética directa y materna se produjo entre la producción de leche y la producción de proteína (0.979, 0.973) y entre la producción de proteína y de grasa (0.952, 0.913) mientras que la correlación fenotípica entre la producción de leche y de grasa (0.968), la producción de leche y proteína (0.967), la producción de proteína y de grasa (0.936) fue alta y positiva. Conclusiones. Los parámetros genéticos son importantes en el programa de selección de esta raza para el mejoramiento genético. Palabras clave: Características de la producción de leche, mejoramiento genético, sheep (Fuente: CAB).

4033

4034

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

INTRODUCCIÓN

INTRODUCTION

Los ovinos Teleorman cabeza negra son una raza local rumana con un alto potencial para la producción de leche. Carta et al (1) ha demostrado que esta razas ovinas locales tienen varios rasgos importantes como: rusticidad, resistencia y adaptabilidad a diferentes condiciones ambientales. La raza de ovinos Teleorman cabeza negra fue inscrita en la base de datos nacional y de la FAO para los recursos zoogenéticos.

The Teleorman Black Head sheep is a Romanian local breed with high potential for milk production. Carta et al (1) have shown that this local sheep breeds have several important traits such as: rusticity, resistance and adaptability to different environmental conditions. The teleorman black head sheep breed is enlisted in the national and in FAO database for animal genetic resources.

La estimación de los parámetros genéticos de los ovinos locales Teleorman cabeza negra es necesaria para estimar el valor genético de los animales y determinar los objetivos de cría. Es necesario un programa de reproducción de la raza Teleorman cabeza negra para la producción de leche. Muchos autores han utilizado el método de Máxima Verosimilitud Restringida (REML) para estimar los parámetros genéticos de los rasgos de producción en razas ovinas; Oravcova et al (2), Komprej et al (3) y Bauer et al (4). El objetivo de este estudio fue estimar los parámetros genéticos para las características de la leche de Teleorman cabeza negra usando el método de Máxima Verosimilitud Restringida (REML), ajustando un modelo lineal de Rasgos Maternos a las características de producción de leche.

MATERIALES Y MÉTODOS Animales y muestras biológicas. Se obtuvieron muestras de leche de 262 ovejas pertenecientes a la raza local Teleorman cabeza negra, de la granja experimental del Instituto Nacional de Investigación y Desarrollo de Biología y Nutrición Animal, Balotesti, Rumania. En la tabla 1 se presentan las características de los ovinos Teleorman cabeza negra. La leche de cada ordeño fue medida individualmente. Se realizaron un total de 4 días de pruebas utilizando el método ICAR B4 (30 días) para determinar la producción de leche; Carta et al (1). La duración de la lactancia total fue de 172 días en la población de ovinos Teleorman cabeza negra. Determinación de índices de calidad de la leche. Los porcentajes totales de grasa y proteína fueron determinados utilizando el analizador Ekomilk M (Bulteh 2000 Ltd, EON Trading LLC, Delaware, EE.UU.).

The estimation of the genetic parameters for the teleorman black head local sheep is necessary in order to estimate the breeding value of the animals and to determine the breeding objectives. A breeding program for milk production is necessary for teleorman black head breed. Many authors have used restricted maximum likelihood (REML) method for estimating the genetic parameters of production traits in sheep breeds Oravcova et al (2), Komprej et al (3), Bauer et al (4). The objective of this study was to estimate the genetic parameters for milk traits of the teleorman black head using Restricted Maximum Likelihood (REML) method, fitting a Maternal Trait linear model for milk production traits.

MATERIALS AND METHODS Animals and biological samples. Milk samples were obtained from 262 sheep belonging to the local breed, teleorman black head, from the experimental farm of National ResearchDevelopment Institute for Animal Biology and Nutrition, Balotesti, Romania. The characteristics of teleorman black head sheep are presented in table 1. Table 1. The Characteristics of teleorman black head. Specification Total records per trait Litter size fixed effect levels Lamb gender fixed effect levels Ewes

Number 262 2 2 262

Sires (rams)

Dams (ewes)

139

Total number of animals

418

The milk from each milking was measured individually. A total of 4 test–days were performed using the ICAR method B4 (30 days) to determine the milk yield Carta et al (1). The length of the total lactation was 172 days in the teleorman black head sheep population.

4035

Pelmus - Estimation of genetic parameters for milk traits Análisis estadístico. La estimación de los parámetros genéticos se realizó mediante el método de Máxima Verosimilitud Restringida (REML); el software utilizado fue MATLAB Student 5.3, usando un modelo lineal de Rasgos Maternos. El número de iteraciones necesarias para que las estimaciones convergieran fue: 113 iteraciones para producción de leche, 112 para producción de grasa, 117 para producción de proteína, 68 para el porcentaje de grasa y 99 iteraciones para el porcentaje de proteína. Los criterios de convergencia fueron:

100 ⋅ (1 −

C1 ) C2

σ a2 A σ am A σ am A σ m2 A

Statistical analysis. The estimation of the genetic parameters was done with the restricted maximum likelihood (REML) method; the software used was MATLAB Student 5.3, using a Maternal Trait linear model. The number of iterations needed for estimates to converge was: 113 iterations for milk yield, 112 for fat yield, 117 for protein yield, 68 for fat percentage and 99 iterations for protein percentage. The convergence criteria was:

100 ⋅ (1 −

G= matriz de varianza y covarianza genética aditiva para efecto animal G=cálculo inicial G1= calculado en primera iteración H= G1-G C1=H2 C2=G12 En notación matricial, (Mrode y Thompson, (5)) el modelo es el siguiente: y = Xb+Za+Wm+Spe+e Donde: y = vector de observaciones, b = vector de efectos fijos, a = vector de efectos animales aleatorios, m = vector de efectos genéticos maternos aleatorios, pe = vector de efectos ambientales permanentes y e = vector de efectos residuales aleatorios. X, Z, W y S son matrices de incidencia que hacen referencia al desempeño animal, los efectos fijos, los efectos directos, los efectos maternos y los efectos ambientales permanentes. Se asume que:

0  a   σ a2 A σ am A  m  σ A σ 2 A 0 m var   =  am  pe   0 0 Iσ p2e    0 0 e  0

Determination of milk quality indices. The total percentages of fat and protein were determined using the Ekomilk M analyser (Bulteh 2000 Ltd, EON Trading LLC, Delaware, USA).

0   0  0   Iσ e2 

Donde: A es la matriz de parentesco entre animales; I es la matriz de identidad; σ2a es la varianza genética aditiva de efectos directos, σ 2m la varianza genética aditiva de efectos maternos, σam la

C1 ) C2

σ a2 A σ am A σ am A σ m2 A

G= additive genetic variance and covariance matrix for animal effect G=initial calculated G1= calculated at first iteration H= G1-G C1=H2 C2=G12 In matrix notation, (Mrode and Thompson, (5)) the model is: y = Xb+Za+Wm+Spe+e Where: y = the vector of observations, b = the vector of the fixed effects, a = the vector of the random animal effects, m= the vector of the random maternal genetic effects, pe = the vector of the permanent environmental effects and e= the vector of the random residual effects. X, Z, W and S are the incidence matrices referring to animal performance, to the fixed effects, to the direct effects, to the maternal effects and to the permanent environmental effects. It is assumed that:

0  a   σ a2 A σ am A  m  σ A σ 2 A 0 m var   =  am  pe   0 0 Iσ p2e    0 0 e  0

0   0  0   Iσ e2 

Where: A is the kinship matrix between animals; I is the identity matrix; σ2a is the additive genetic

4036

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

covarianza genética aditiva entre los efectos directos y maternos, σ2pe es la varianza casada por los efectos ambientales permanentes, σ2e es la varianza del error residual. De acuerdo con el objetivo de este estudio, se estimaron los siguientes parámetros genéticos: Heredabilidad genética (ha2= σ2a /σp2), donde σp2 es la variancia fenotípica. Heredabilidad materna (hm2= σ2m /σp2). Covarianza entre efectos directos y maternos como proporción de la varianza fenotípica (σam/ σp2) Heredabilidad total

hT2 =

σ a2 + 0.5σ m2 + 1.5σ am σ p2

(Wilham qouted por Ghafouri-Kesbi y Baneh (6)) Donde:

According to the objective of this paper the following genetic parameters were estimated: The direct heritability (ha2= σ2a /σp2), where σp2 is the phenotypic variance. The maternal heritability (hm2= σ2m /σp2) The covariance between direct and maternal effects as proportion of the phenotypic variance (σam/ σp2) The total heritability

hT2 =

σ a2 + 0.5σ m2 + 1.5σ am σ p2

(Wilham qouted by Ghafouri-Kesbi and Baneh (6))

h2T es la heredabilidad total, y σ2P la variancia fenotípica. Cociente entre el ambiente materno permanente y la varianza fenotípica (c2). ram correlación genética entre los efectos directos y maternos.

ram =

variance for the direct effects, σ2m, the additive genetic variance for the maternal effects, σam, the additive genetic covariance between the direct and maternal effects, σ2pe, is the variance due the permanent environmental effects, σ2e, is the variance of the residual error.

σ am σ a2 ⋅ σ m2

En el presente estudio, la parte fija del modelo incluyó el tamaño de la camada y el sexo de los corderos. Los efectos aleatorios correspondieron a los efectos genéticos directos, los efectos genéticos maternos y los efectos ambientales permanentes. Las correlaciones genéticas directas entre rasgos se estimaron de forma aproximada mediante la correlación de los valores genéticos de los ovinos para estos rasgos; las correlaciones genéticas maternas fueron estimadas de manera aproximada mediante la correlación de los efectos genéticos maternos para las características estudiadas, mientras que las correlaciones fenotípicas se estimaron mediante la correlación de los valores fenotípicos de las ovejas para estos rasgos.

Where: h 2 T is the total heritability, and σ 2 P is the phenotypic variance. The ratio of the maternal permanent environment to phenotypic variance (c2). ram the genetic correlation between the direct and maternal effects

ram =

σ am σ a2 ⋅ σ m2

In the present study, the fixed part of the model included the litter size and sex of lambs. The random effects were the direct genetic effects, the maternal genetic effects and the permanent environmental effects. The direct genetic correlations between the traits were approximate estimated by the correlation of the breeding values of the sheep for these traits; the maternal genetic correlations were approximate estimated by the correlation of the maternal genetic effects for the studied traits, while the phenotypic correlations were estimated by the correlation between the phenotypic values of the sheep for these traits.

4037

Pelmus - Estimation of genetic parameters for milk traits

RESULTADOS

RESULTS

En la tabla 2 se presenta el promedio de los rasgos de leche de ovinos Teleorman cabeza negra en la primera lactancia.

The average performances for milk traits for Teleorman Black Head sheep at the first lactation are presented in table 2.

En la tabla 3 se muestran las estimaciones de los componentes de covarianza, heredabilidad directa, heredabilidad materna, correlación genética directa y materna y fracción de la varianza total debido a efectos ambientales maternos permanentes para los rasgos de la leche. En este estudio, la varianza genética aditiva directa para la producción de leche representa el 44.9% de la varianza fenotípica, mientras que la varianza genética materna y la varianza ambiental materna permanente el 22.1% y el 4.4%, respectivamente. La varianza genética aditiva directa para la producción de grasa es el 44.2% de la varianza fenotípica. Al mismo tiempo, la varianza genética materna y la varianza ambiental materna permanente fue del 20.5% y del 4.3%, respectivamente. La varianza genética aditiva directa para la producción de proteína representa el 38.6% de la varianza fenotípica, mientras que la varianza genética materna y la varianza materna permanente corresponden al 21.4% y 4.4%, respectivamente. La varianza genética aditiva directa para el porcentaje de grasa representa el 92.4% de la varianza fenotípica. La varianza genética materna y la varianza ambiental materna permanente corresponde al 24% y al 3.7%, respectivamente. Para el porcentaje de proteína, la varianza genética aditiva directa representa el 70.8% de la varianza fenotípica mientras que la varianza genética materna y la varianza ambiental materna permanente fue del 23.1% y del 4.1%. La covarianza entre los

Table 2. Average of milk traits for Teleorman Black Head sheep. Standard Standard Error deviation

Variation coefficient (%)

Item

Mean

Milk yield (l)

103.72

2.84

46.12

44.46

Fat yield (kg)

6.79

0.20

3.20

47.14

Protein yield (kg)

5.94

0.17

2.81

47.26

The estimates of covariance components, direct heritability, maternal heritability, direct-maternal genetic correlation and fraction of total variance due to maternal permanent environmental effects for milk traits are shown in table 3. In this study, the direct additive genetic variance for milk yield represents 44.9% from phenotypic variance while the maternal genetic variance and the maternal permanent environmental variance are 22.1% and 4.4%, respectively. The direct additive genetic variance for fat yield is 44.2% from the phenotypic variance. At the same time, the maternal genetic variance and maternal permanent environmental variance are 20.5%, 4.3% respectively. The direct additive genetic variance for protein yield represents 38.6% from the phenotypic variance while the maternal genetic variance and the maternal permanent variance are 21.4% and 4.4% respectively. The direct additive genetic variance for fat percentage represents 92.4% from the phenotypic variance. The maternal genetic variance and the maternal permanent environmental variance are 24% and 3.7%, respectively. For protein percentage, the direct additive genetic variance represents 70.8%

Table 3. Estimates of covariance components and genetic parameters for milk yield, fat yield, protein yield, fat and protein percentage. Item

Milk yield

Fat yield

Protein yield

Fat (%)

Protein (%)

σ2a

1094.500

5.198

3.446

0.573

0.295

σ2m

537

2.412

1.908

0.149

0.096

σam

-480.200

-2.322

-1.501

-0.256

-0.133

σ2pe

106.243

0.511

0.394

0.023

0.017

σe2

1177.100

5.953

4.682

0.132

0.141

σ p2

2434.643

11.752

8.929

0.621

0.416

ha2

0.449±0.244

0.442±0.242

0.386±0.143

0.924±0.409

0.708±0.334

hm2

0.221±0.166

0.205±0.160

0.214±0.163

0.240±0.172

0.231±0.209

0.044

0.043

0.044

0.037

0.041

-0.197

-0.198

-0.168

-0.412

-0.319

σam/σp

ram

-0.626

-0.655

-0.585

-0.876

-0.790

hT2

0.264±0.180

0.249±0.175

0.241±0.173

0.424±0.236

0.346±0.169

σ2a direct additive genetic variance, σ2m maternal genetic variance, σam direct–maternal additive genetic covariance, σ2pe maternal permanent environmental variance, σe2 residual variance, ha2 direct heritability, hm2 maternal heritability, c2 = σpe2/σp2 ratio of maternal permanent environmental variance to phenotypic variance, σam / σp 2covariance between direct and maternal effects as proportion to phenotypic variance, ram genetic correlation between direct and maternal effects, hT2 total heritability

4038

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

efectos genéticos directos y maternos para todos los rasgos fue negativa. Las estimaciones de la heredabilidad directa fueron moderadas para la producción de leche, producción de grasa y de proteína mientras que fueron mayores para el porcentaje de proteína y el porcentaje de grasa. La heredabilidad directa para estos rasgos fue mayor que la heredabilidad materna. La correlación genética aditiva directa–maternal fue negativa y sobre todo mayor para todos los rasgos. La varianza ambiental materna permanente como proporción de la varianza fenotípica (c2) fue igual para la producción de leche y la producción de proteína (0.044). Las estimaciones de heredabilidad fueron bastante variables, lo que sugiere que los parámetros específicos de raza y rasgos de leche son necesarios para estimar los valores genéticos y predecir la respuesta a la selección. En la tabla 4 se muestra la estimación de las correlaciones fenotípicas, las correlaciones genéticas directas y las correlaciones genéticas maternas entre los rasgos. La correlación genética directa entre la producción de leche y porcentaje de grasa fue baja y positiva (0.009), así como la producción de leche y el porcentaje de proteína (0.007). Se han obtenido correlaciones genéticas moderadas y positivas entre el porcentaje de grasa y el porcentaje de proteína y entre el porcentaje de grasa y la producción de grasa. La alta correlación genética directa se produjo entre la producción de leche y la producción de proteína (0.979), la producción de leche y la producción de grasa (0.977) y entre la producción de proteína y la producción de grasa (0.952). La correlación genética entre los efectos maternos para el porcentaje de grasa y la producción de leche y entre la producción de leche y el porcentaje de proteína fue baja y positiva, mientras que la correlaciones genéticas maternas entre la producción de leche y la producción de grasa, la producción de leche y la producción de proteína, la producción de proteína y la producción de grasa fueron altas y positivas. Se han obtenido correlaciones genéticas maternas moderadas y positivas entre el porcentaje de grasa y el porcentaje de proteína y entre el porcentaje de grasa y la producción de grasa. La correlación fenotípica entre la producción de leche y el porcentaje de grasa y entre la producción de leche y el porcentaje de proteína fue baja y positiva, mientras que la correlación

from phenotypic variance while the maternal genetic variance and the maternal permanent environmental variance are 23.1% and 4.1%. The covariance between the direct and the maternal genetic effects for all the traits was negative. Direct heritability estimates were moderate for milk yield, fat yield and protein yield while for protein percentage and fat percentage were greater. The direct heritability for these traits was greater than the maternal heritability. The direct–maternal additive genetic correlation was negative and mostly greater for all traits. The maternal permanent environmental variance as a proportion of the phenotypic variance (c2) was the same for milk yield and protein yield (0.044). The heritability estimates were quite variable, suggesting that the parameters specific to milk traits and breed are necessary when estimating the breeding values and when predicting the response to selection. Table 4 shows the estimation of the phenotypic correlations, of the direct genetic correlations and of the maternal genetic correlations between the traits. The direct genetic correlation between the milk yield and fat percentage was low and positive (0.009), as was the milk yield and protein percentage (0.007). Moderate and positive genetic correlations have been obtained between the fat percentage and protein percentage and between the fat percentage and fat yield. The high direct genetic correlation was between milk yield and protein yield (0.979), milk yield and fat yield (0.977) and between protein yield and fat yield (0.952). The genetic correlation between the maternal effects for the milk yield and fat percentage and between milk yield and Table 4. Phenotypic and genotypic correlation for the milk traits. Trait 1

Trait 2

Milk yield

Fat (%)

0.009±0.346 0.038±0.518 0.064±0.043

Milk yield

Fat yield

0.977±0.017 0.911±0.092 0.968±0.011

Milk yield

Protein (%)

0.007±0.357 0.028±0.618 0.069±0.043

Milk yield

Protein yield

0.979±0.013 0.973±0.028 0.967±0.011

Fat (%)

Protein (%)

0.297±0.294 0.348±0.500 0.336±0.041

Fat (%)

Protein yield

0.117±0.367 0.121±0.514 0.127±0.043

Fat (%)

Fat yield

0.334±0.309 0.330±0.468 0.353±0.041

Fat yield

Protein (%)

0.145±0.351 0.150±0.577 0.191±0.043

Protein yield Fat yield

0.952±0.029 0.913±0.090 0.936±0.015

Protein yield Protein (%)

0.297±0.269 0.240±0.553 0.299±0.042

rd direct genetic correlation between trait 1 and trait 2, rm maternal genetic correlation between trait 1 and trait 2, rp phenotypic correlation between trait 1 and trait 2.

Pelmus - Estimation of genetic parameters for milk traits fenotípica entre la producción de leche y la producción de grasa, la producción de leche y la producción de proteína, la producción de grasa y la producción de proteína fue alta y positiva. Se han obtenido correlaciones fenotípicas moderadas y positivas entre el porcentaje de grasa y el porcentaje de proteína y entre el porcentaje de grasa y la producción de grasa.

DISCUSIÓN La producción de leche es uno de mayores rasgos de selección en la población de ovinos. Las estimaciones de heredabilidad obtenidas en el presente estudio son consistentes con aquellas reportadas para diversas poblaciones. El valor de la heredabilidad total para la producción de leche de las ovejas en este estudio (0.264) fue similar a la heredabilidad total de la producción diaria de leche estimada por Bauer et al (4) para varias razas ovinas (East Friesian, Lacaune, Sumavska) entre 0.17 y 0.30 y Rupp et al (7) (0.28) y fue mayor que el valor (0.11) reportado por Komprej et al (3) y el valor de la heredabilidad (0.21) reportado por Legarra et al (8). Los valores de la heredabilidad para el contenido de grasa (0.424) y el contenido de proteína (0.346) en este estudio fueron mayores que los valores (0.08 para el contenido de grasa y 0.10 para el contenido proteínico) reportados por Komprej et al (3) en tres razas de ovinos lecheros eslovenos (Bovec, Bovec Mejorado e Istria Pramenka) y Alvarez et al (9) (0.09, 0.25). La heredabilidad para el contenido de grasa y proteína y la producción de grasa y proteína en este estudio fue mayor que el valor r ep o r t ad o p o r D e V r i e s e t a l ( 1 0 ) . L as bajas estimaciones para c 2 obtenidas en el presente estudio (0.044) sugieren que los efectos maternos fueron causados por efectos genéticos aditivos maternos. Las estimaciones de la correlación genética entre los efectos directos y maternos en los rasgos de la leche eran generalmente altas y consistentemente negativas. En este estudio, la correlación entre los efectos genéticos directos y maternos para la producción de leche fue negativa y alta. En el presente estudio, las correlaciones genéticas entre la producción de leche y grasa, la producción de leche y proteína fueron positivas, altas y similares a los valores reportados por Ugarte (11). Los resultados de nuestro estudio revelaron que las estimaciones de la heredabilidad directa

4039

protein percentage was low and positive, while the maternal genetic correlations between milk yield and fat yield, milk yield and protein yield, protein yield and fat yield were high and positive. Moderate and positive maternal genetic correlations have been obtained between the fat percentage and protein percentage and between the fat percentage and fat yield. The phenotypic correlation between the milk yield and fat percentage and between the milk yield and protein percentage was low and positive, while the phenotypic correlation between the milk yield and fat yield, the milk yield and protein yield, fat yield and protein yield was high and positive. Moderate and positive phenotypic correlations have been obtained between the fat percentage and protein percentage and between the fat percentage and fat yield.

DISCUSSION The milk yield is one of the major selection traits in sheep population. The heritability estimates obtained in the present study are in agreement with those reported for various populations. The value of the total heritability for milk yield of the sheep from this study (0.264) was similar with the total heritability of daily milk yield estimated by Bauer et al (4) for various breeds (East Friesian, Lacaune, Sumavska) sheep between 0.17 and 0.30 and Rupp et al (7) (0.28) and was larger than the value (0.11) reported by Komprej et al (3) and the value of the heritability (0.21) reported by Legarra et al (8). The values of the heritability for fat content (0.424) and protein content (0.346) in this study were larger than the values (0.08 for fat content and 0.10 for protein content) reported by Komprej et al (3) in three Slovenian dairy sheep breeds (Bovec, Improved Bovec and Istrian Pramenka) and Alvarez et al (9) (0.09, 0.25). The heritability for fat and protein content and fat and protein yield in the present study was larger than the value reported by De Vries et al (10). The low estimates for c2 obtained in the present study (0.044) suggest that maternal effects were due to maternal additive genetic effects. The genetic correlation estimates between direct and maternal effects on the milk traits were generally high and consistently negative. In this study the correlation between the direct and maternal genetic effects for milk yield was negative and high. In the present study the genetic correlations between milk yield and fat yield, milk yield and protein yield were positive, high and similar with the values reported by Ugarte (11).

4040

REVISTA MVZ CÓRDOBA • Volumen 19(1) Enero - Abril 2014

fueron moderadas para la producción de leche, la producción de proteína, la producción de grasa y el porcentaje de proteína, mientras que las mismas fueron altas para el porcentaje de grasa. La elevada correlación genética directa y materna se produjo entre la producción de leche y proteína y entre la producción de proteína y grasa, mientras que la correlación fenotípica entre la producción de leche y grasa, la producción de leche y proteína, la producción de grasa y proteína fue alta y positiva. En conclusión, los parámetros genéticos son muy importantes en el programa de selección de esta raza. Agradecimientos Este estudio fue fianciado por CNCSIS-UEFISCDI Proyecto No.56/ PNII/TE, 2010-2013.

The results from our study revealed that direct heritability estimates were moderate for milk yield, protein yield, fat yield and protein percentage, while for fat percentage were high. The high direct and maternal genetic correlation was between milk yield and protein yield and between protein yield and fat yield, while the phenotypic correlation between the milk yield and fat yield, the milk yield and protein yield, fat yield and protein yield was high and positive. In conclusion the genetic parameters are very important in selection program on this breed. Acknowledgements This work was financially supported from CNCSISUEFISCDI Project no.56/ PNII/TE, 2010-2013.

REFERENCES 1.

Carta A, Casu S, Salaris S. Invited review: Current state of genetic improvement in dairy sheep. J Dairy Sci 2009; 92:5814-5833.

2. Oravcova M, Margetin M, Peskovicova D, Dano J, Milerski M, Hetenyi L et al. Factors affecting milk yield and ewe’s lactation curves estimated with test-day models. Czech J Anim Sci 2006; 11:483-490. 3. Komprej A, Gorjanc G, Kompan D, Kovac M. Covariance components by a repeatability model in Slovenian dairy sheep using test-day records. Czech J Anim Sci 2009; 9:426-434. 4. Bauer J, Milerski M, Pribyl J, Vostry L. Estimation of genetic parameters and evaluation of test– day milk production in sheep. Czech J Anim Sci 2012; 57:522-528. 5. Mrode RA, Thompson R. Maternal Trait Models: Animal and Reduced Animals Models. Linear models for the prediction of animal Breeding Values. Cabi Publishing UK; 2005. 6. Ghafouri-Kesbi F, Baneh H. Genetic parameters for direct and maternal effects on growth traits of sheep. Arch Tierz 2012; 55(6):603-611.

7. Rupp R, Lagriffoul G, Astruc JM, Barilet F. Genetic Parameters for milk Somatic Cell Scores and Relationship with production traits in Franch Lacaune Dairy Sheep. J Dairy Sci 2003; 86:1476-1481. 8. Legarra A, Ugarte E. Genetic parameters of Udder Traits, Somatic Cell Score and Milk Yield in Laxta Sheep. J Dairy Sci 2005; 88:2238-2245. 9. Alvarez L, Gutierrez-Gill B, San Primitivo F, De la Fuente FL, Arranz JJ. Influence of prion protein genotypes on milk production traits in spanish Churra Sheep. J Dairy Sci 2006; 89:1784-1791. 10. De Vries F, Hamann H, Drogemuller C, Ganter M, Distl O. Analysis of associations between the prion protein genotypes and production traits in east friesian milk sheep. J Dairy Sci 2005; 88:392-398. 11. Ugarte E. The breeding program of Laxta breed. Biotech Anim Husbandry 2007; 23(56):97-111.

Revista MVZ Córdoba Instrucciones para los autores La Revista MVZ Córdoba es una publicación científica de la Facultad de Medicina Veterinaria y Zootecnia de la Universidad de Córdoba, Montería, Colombia. Se publican artículos de procedencia nacional e internacional que estén relacionados con las ciencias agropecuarias en la modalidad de artículos originales de investigación, revisiones de literatura, comunicaciones breves y casos clínicos. Los temas que publica la Revista MVZ Córdoba tienen correspondencia con la medicina veterinaria, zootecnia, acuicultura, biología, biotecnología, ciencias básicas biomédicas, salud pública y otros tópicos de interés de las ciencias agropecuarias. La revista está dirigida a los profesionales de la medicina veterinaria, zootecnia, salud pública, epidemiología, acuicultura, biología, ciencias básicas biomédicas y biotecnología. “La revista MVZ Córdoba apoya las políticas para registro de ensayos clínicos de la Organización Mundial de la Salud (OMS) y del International Committee of Medical Journal Editors (ICMJE), puesto que se reconoce la importancia de esas iniciativas para el registro y divulgación internacional de información sobre estudios clínicos, en acceso abierto. En consecuencia, desde el 2007, en la revista MVZ Córdoba solamente se publican los artículos de investigaciones clínicas que hayan recibido un número de identificación en uno de los Registros de Ensayos Clínicos validados por los criterios establecidos por OMS e ICMJE, cuyas direcciones están disponibles en el sitio web del ICMJE. El número de identificación se registra al final del resumen”.

Requisitos y normas generales para publicación de artículos Los interesados deberán enviar al editor, debidamente diligenciados y firmados por cada uno de los autores, los formularios: Presentación de artículos y autorevisión, los cuales se encuentran disponibles en el link: http://www.unicordoba.edu.co/ revistas/revistamvz/index.htm

Preparación de artículos El artículo debe ser redactado en tercera persona, escrito en procesador de palabras, a espacio sencillo, con letra verdana a 12 puntos, en una sola columna, con márgenes de 3 cm. El artículo, incluyendo tablas, figuras, referencias, leyenda de tablas y de figuras, no debe exceder las 6000 palabras para artículos originales y revisiones de literatura; 3000 para comunicaciones breves y casos clínicos. Se aceptan artículos en español e inglés y a partir del año 2015, deberán ser enviados en los dos idiomas, anexando la certificación de traducción que corresponda. En el artículo se usará la palabra “Figura” para referirse a todas las ilustraciones (gráficas de datos, fotografías o dibujos originales). Las figuras deben ser de buena calidad, con trazos limpios, bien definidos y texto legible; y sus márgenes deben ser de máximo 1 cm. Las fotografías deben ser nítidas, bien enfocadas y con iluminación balanceada. Todas las tablas y figuras deben ser tituladas, las tablas en la parte superior y las figuras en la parte inferior, numeradas y citadas en el artículo, sin recuadros. Las tablas no se admiten en formato de imagen y todas deben anexarse al final del texto en páginas separadas. El número máximo entre tablas y figuras será de 8. Cada figura debe enviarse por separado con las siguientes especificaciones: formato TIFF, resolución: 300 pixeles por pulgada y 16 cm de ancho. En caso de incluir fotografías, se deben enviar los archivos originales e indicar la fuente, con los siguientes requerimientos: formato jpg, resolución de 180 pixeles por pulgada y 26 cm de ancho. Si se utiliza Microsoft Excel para gráficos de datos, se debe remitir el archivo en formato xls o xlsx.

Recepción y evaluación de los artículos Una vez recibido un artículo para posible publicación, se le comunicará formalmente al autor corresponsal su recepción y se verificará el cumplimiento de normas y requisitos. Concluida la etapa anterior, el artículo será enviado confidencialmente a dos árbitros externos a la institución mediante la modalidad de doble ciego para que lo evalúen. Se recurrirá a un tercer árbitro en caso de discrepancia. En todos los casos se tomarán las medidas necesarias para que el artículo no presente elementos que permitan que los árbitros identifiquen a los autores. El editor será el único responsable de comunicar a los autores el resultado de la evaluación. El Comité Editorial y el editor se reservan el derecho de rechazar los artículos que no cumplan con los requisitos y las normas, así como el derecho de introducir (con la aprobación de los autores) los cambios editoriales inherentes a normas gramaticales, compaginación, maquetación y reparto del espacio editorial. Si el artículo es aprobado, se le enviará una prueba de galera al autor corresponsal, quien será el único responsable de socializar, corregir y aprobar la versión final del artículo junto con los coautores.

1.2. Autores: Son aquellos que participan en la planeación, ejecución, elaboración, discusión y escritura del artículo. El nombre de los autores se deberá escribir de la siguiente manera: El primer nombre, primer apellido y la inicial en mayúscula del segundo apellido seguida de coma, salvo excepciones de firmas registradas, de credo u otras. También se podrán incluir los dos apellidos unidos por un guión (Arrieta-Contreras) seguidos de coma y por un superíndice que indica la filiación de cada autor y el último título o grado académico obtenido por el autor (se requiere como mínimo el título de profesional o tecnólogo. No se aceptan candidaturas). Se utilizarán las siguientes abreviaturas según el caso: Especialización (Esp.), maestría (M.Sc.), doctorado (Ph.D.) o la abreviatura del título profesional. Se deberá indicar con un asterisco el autor corresponsal y escribir su correo electrónico, el cual aparecerá en el artículo y por tanto será público. La filiación institucional de los autores deberá ser jerarquizada: Institución, Facultad, Departamento, Instituto, Laboratorio, Grupo de estudio, etc., dirección postal, ciudad y país. Ejemplo: Determinación de bacterias ácido lácticas termoresistentes Determination of bacteria acid lactic thermoresistant

La revista MVZ Córdoba se acoge a los requisitos generales de uniformidad para revistas biomédicas (normas de Vancouver) con algunas modificaciones que se mencionan a continuación. 1. Estructura de los artículos originales: Los títulos se deben escribir en mayúscula sostenida, alineados a la izquierda y resaltados con negrita. Deben contener la siguiente información: 1.1. Título del artículo: Deberá ser escrito en español e inglés, en minúscula y resaltado con negrita, este último debajo del primero dejando doble espacio y en tamaño de 10 puntos. El título debe ser preciso e informativo, sin abreviaturas y de máximo 15 palabras. Los nombres en latín se escribirán en cursiva. Debe incluir debajo del título en inglés, un título abreviado del mismo en inglés, máximo de 8 palabras.

Lactic acid bacteria Mario Pérez B,1* Ph.D, Vanessa ArrietaContreras,2 M.Sc, Diva Almentero S,1 Lic. Universidad de Córdoba, Facultad de Medicina Veterinaria y Zootecnia, Instituto de Investigaciones Biológicas del Trópico, A.A. Nro. 354, Montería, Colombia. 2Lactoanálisis. Calle 27 Nro. 18-62 Montería, Colombia. *Correspondencia: elcorreopig@servidor.com 1

1.3. Resumen: Debe ser estructurado y tener máximo 250 palabras y mínimo 150, escritas en un solo párrafo. Deberá ofrecer una idea clara del contenido del artículo incluyendo los subtítulos: objetivo, materiales y métodos, resultados y conclusiones, resaltados con negrita. Después de cada subtítulo se debe escribir un punto y seguido a partir del cual se inicia la redacción del texto de cada sección.

1.4. Palabras clave: Son términos cortos que definen el contenido del artículo, su clasificación y permiten localizarlo en un archivo automatizado. Se sugiere emplear seis palabras, como máximo, que no estén contenidas en el título del artículo, escritas en orden alfabético. Se deben usar los términos de la lista MeSH u otro tesauro acorde con el tema de investigación, tales como DeCS, BIREME, NLM, CAB thesaurus, AGROVOC thesaurus, tesauro de ASFA, tesauro de biología animal IEDCYT, tesauro ambiental para Colombia, National agricultural library, etc., e indicar al final de ellas, el o los tesauros utilizados escritos entre paréntesis y en cursiva así: Palabras clave: Extramedular, nódulos linfáticos, plasmocitoma (Fuentes: DeSC, CAB). 1.5. Abstract: Es el mismo resumen en español traducido al inglés; debe tener la misma estructura y contenido. 1.6. Key words: Deben ser las mismas palabras clave de español traducidas al inglés. 1.7. Introducción: Debe indicar claramente el propósito de la investigación, relacionando igualmente en forma selectiva la literatura pertinente. No se pueden incluir datos ni conclusiones del trabajo que se está dando a conocer. Esta sección deberá finalizar con el objetivo general. 1.8. Materiales y métodos: Se deben describir claramente los procedimientos empleados en la investigación, lo cual incluye diseño estadístico y análisis de datos. Esta sección deberá ser estructurada (con subtítulos) para especificar tipo de estudio, sitio, condiciones geo-climáticas, coordenadas del sitio de estudio, pacientes o animales de estudio, métodos de laboratorio, aspectos éticos, análisis de resultados, etc. Los subtítulos deberán ser resaltados con negrita y después de cada uno de ellos se debe colocar un punto y seguido a partir del cual se inicia la redacción del texto. 1.8.1. Aspectos éticos: Se hará una breve descripción de los procedimientos de manejo de pacientes (humanos o animales)

y de los riesgos y las garantías de seguridad ofrecidas durante el estudio, de acuerdo con el tipo de investigación realizada. Se deberá declarar que la investigación solo se inició cuando se obtuvo la autorización de los entes implicados. Es necesario adjuntar el formulario de consentimiento informado de participantes (humanos), así como la certificación de la aprobación del proyecto emitida por el Comité de Ética. Los documentos de soporte deben ser escritos en papel membretado de la institución correspondiente y luego escaneados para su remisión. A modo de ejemplo se cita el siguiente texto: “Las muestras fueron recolectadas por estudiantes de la Facultad de Medicina Veterinaria y Zootecnia, de la Universidad de Córdoba, quienes tuvieron en cuenta para los procedimientos de recolección de muestras, manejo y conservación, las normas éticas, técnicas, científicas y administrativas para la investigación en animales contenidas en la Ley 84 (Congreso Nacional de Colombia, 1989). Durante el estudio, se mantuvo la confidencialidad de la información de predios muestreados y animales positivos. La investigación fue aprobada por el Comité de Ética del Instituto de Investigaciones Biológicas del Trópico de la Universidad de Córdoba, mediante la Resolución 012009 de febrero 1 de 2014”. Además, en esta sección se deben citar las reglamentaciones existentes y vigentes de cada país, incluyendo producción limpia, conservación del medio ambiente, así como aquellas de regulación internacional de obligatorio cumplimiento global. 1.9. Resultados: Corresponde a la información de los hallazgos, pero sin incluir comentarios ni referencias a otros trabajos. Se sugiere utilizar tablas y figuras. Los resultados se deben expresar en tiempo pasado, anotando el nivel de significancia estadística entre paréntesis (p≤ 0.05, p≤0.01, p>0.05). Las tablas y figuras deberán citarse en esta sección en estricto orden. La citación en el texto se podrá hacer de dos maneras: a)... como se puede apreciar en la tabla 2; o b)…éxito de captura de 0.1313 individuos/horas-red (Tabla 1).

Las unidades de medida se citarán de acuerdo con el sistema métrico decimal y se deberá dejar un espacio entre el número y la unidad, excepto para los signos de porcentaje (%), grados centígrados (ºC) y pesos ($) que siempre irán unidos a la cifra. Las unidades de medida no deben ser usadas en plural ni llevar punto final (Ejemplo: kg en lugar de kgs, kg.). Cuando una unidad de medida rige para varios números, sólo acompañará al último valor (Ejemplo: 8 - 15 kg en lugar de 8 kg – 15 kg). Los decimales no se deben expresar con coma, sino con punto. Todos los compuestos y reactivos, así como los equipos utilizados, deberán incluir entre paréntesis la casa matriz productora, ciudad sede y estado o país (Ejemplo: Sigma, St. Louis, MO). No se deberán incluir nombres comerciales en el texto y siempre se hará referencia al principio activo. 1.10. Discusión: Es la interpretación de los resultados obtenidos y la contrastación de los mismos con estudios relacionados que hayan realizado otros autores. Se debe destacar las limitaciones del estudio y evitar especulaciones. Es necesario incluir las conclusiones del estudio y las recomendaciones para futuras investigaciones. 1.11. Agradecimientos: Relacione el nombre de las personas, instituciones, empresas, laboratorios, fincas, etc., que hayan colaborado con la investigación (financiación, logística, etc.). Esta sección no es obligatoria, pero es recomendable. Tiene un máximo de 50 palabras. 1.12. Referencias: Deben numerarse consecutivamente según el orden en que se mencionen por primera vez en el texto, por medio de números arábigos entre paréntesis (1). En esta sección deben aparecer solamente aquellos artículos directamente relacionados con la investigación, para evitar revisiones bibliográficas extensas. Si un artículo tiene de uno a seis autores, en la referencia se deben incluir todos; pero si son más, después del sexto se escribe la expresión et al, la cual debe ir sin cursiva y sin puntuación (et al). Los títulos de las revistas serán abreviados (nombre corto, sin puntuación) según el estilo empleado en el IndexMedicus. (http://www. ncbi.nlm.nih.gov/sites/entrez?db=journals).

La lista de referencias se presentará en una hoja aparte, en estricto orden de aparición en el texto, no en orden alfabético. Para los artículos originales se aceptarán hasta 30 referencias; para las revisiones de literatura, hasta 50 y para la presentación de casos clínicos y comunicaciones breves, hasta 15. Los resúmenes de congresos, seminarios, eventos, cursos, presentaciones, informes técnicos, boletines, comunicaciones personales, consultas electrónicas no indexadas, monografías, sitios web, así como los trabajos de grado de pregrado, no se aceptan como referencias. Las referencias deben ser actualizadas y no mayores a 10 años de antigüedad. En caso de ser necesario, se podrán incluir con la debida justificación, pero no podrán sobrepasar el 20% del total de las referencias. Solamente se pueden incluir hasta dos referencias que sean de libros. 2. Comunicaciones breves: Deben tener el mismo contenido estructural de los artículos originales. La extensión será mínimo de 1.800 palabras y máximo de 3.000. 3. Casos clínicos: El contenido estructural es similar al de las comunicaciones breves, pero el resumen no es estructurado. Además, después de la introducción se incluirá la evaluación del paciente (subtítulos: anamnesis, hallazgos al examen clínico, ayudas diagnósticas, etc., resaltados con negrita), enfoque de tratamiento. 4. Revisiones de literatura: Consisten en un análisis crítico de la literatura publicada en torno a un tema de actualidad, interés y pertinencia para las ciencias pecuarias. Deben ajustarse a las normas anteriores, sin incluir las secciones de materiales y métodos, resultados y discusión; en su lugar, se utilizarán los títulos y subtítulos (resaltados con negrita) necesarios y relacionados con el tema que se aborda. Los autores deberán argumentar, sustentar o controvertir la información contenida en la revisión. Además, deberán hacer un aporte crítico sobre las fortalezas, debilidades y oportunidades de investigación del tema propuesto. Generalmente, el editor es quien hace la invitación a los autores expertos y reconocidos para que hagan estas contribuciones.

Derechos de impresión y copia: Los autores se comprometen a ceder a la Revista MVZ Córdoba los derechos de reimpresión del material publicado. La traducción o publicación parcial o total de la Revista requerirá del permiso escrito del editor. La Revista MVZ Córdoba y la Universidad de Córdoba no se responsabilizan por las opiniones y los resultados expresados por los autores. Los contenidos publicados en la Revista MVZ Córdoba están bajo la licencia “Atribución – Sin Derivar – No comercial” de Creative Commons, 3.0 cuyo texto completo se puede consultar en: http://co.creativecommons. org/tipos-de-licencias/. Correspondencia: Nombre completo del autor corresponsal, dirección laboral y residencial, correo electrónico, teléfono celular y teléfono fijo. Esta información se debe diligenciar en el Formulario de declaración para los autores. La Revista MVZ Córdoba se compromete con el manejo confidencial de la información suministrada por los autores. Consultas: Deben ser realizadas exclusivamente por el autor corresponsal, quien será el único responsable de la comunicación administrativa con la revista, escribiendo siempre en el asunto del correo remisorio el nombre del artículo que se desea consultar, a los correos: editormvzcordoba@gmail.com, revistamvz@ unicordoba.edu.co y revistamvz@gmail.com. Certificaciones: Serán expedidas a los árbitros una vez entreguen el dictamen del artículo. A los autores solo se entregarán cuando el artículo haya sido evaluado, aprobado y corregido para publicación. La Revista MVZ Córdoba no se compromete con la publicación diligente de artículos relacionados con la obtención de grados académicos (M.Sc., Ph.D.), fuentes de financiación, informes finales de proyectos de investigación, etc., y por lo tanto dichos artículos estarán sometidos a la misma reglamentación vigente.

Identidad de autores: Será manejada bajo estricta reserva por el equipo editorial de la revista. Los artículos retirados por los autores y los rechazados para su publicación por el Comité Editorial serán archivados en la base de datos histórica de la revista y sus contenidos no serán utilizados bajo ninguna circunstancia. Plagio y autoplagio: Los autores deberán respetar y reconocer todas las fuentes de información en la obtención de datos, figuras, fotografías, etc., dando el crédito respectivo a los autores consultados. El incumplimiento de esta norma será causal de retiro inmediato del artículo cuando se descubra durante el proceso de sometimiento. En caso de detectarse con posterioridad a la publicación, bien sea por miembros de la revista o por el reclamo o denuncia de otros autores, la Revista MVZ Córdoba, previa verificación, publicará la correspondiente nota de retractación. La Revista MVZ Córdoba corregirá oportunamente los errores tipográficos o de otra índole que pudieran haberse presentado con la publicación de cualquier artículo. Se aceptarán solicitudes de retractación debidamente argumentadas. Cambios en la autoría: Pueden ser por incorporación, supresión o modificación en el orden inicialmente remitido. En cualquier caso, el autor corresponsal deberá enviar una carta al editor, en la que justifique tales cambios y en la que aparezcan las firmas de los implicados. En ningún caso los cambios serán permitidos después de la aprobación del artículo. Comité Editorial de la Revista MVZ Córdoba Universidad de Córdoba, Facultad de Medicina Veterinaria y Zootecnia Teléfonos: (57) (4) 756 90 27 Montería - Colombia Editor: Marco González Tous. MVZ., M.Sc. editormvzcordoba@gmail.com. http://revistas.unicordoba.edu.co/revistamvz/.

Journal MVZ Córdoba Instructions to Authors The Journal MVZ Cordoba is a scientific publication of the Faculty of Veterinary Medicine and Zootechny of the University of Córdoba, Montería, Colombia. It publishes national and international articles related to the agricultural sciences in the form of original investigation, literature reviews, short communications and clinical cases. The subjects that are published in Journal MVZ Córdoba correspond to veterinary medicine and zootechny, agriculture, biology, biotechnology, biomedical basic sciences, public health and other subjects of interest in agricultural sciences. The magazine is directed to professionals in veterinary and zootechny medicine, public health, epidemiology, aquaculture, biology, biomedical basic sciences and biotechnology. “The Journal MVZ Cordoba follows the policies of the World Health Organization (WHO) and of International Committee of Medical Journal Editors (ICMJE), for clinical trials registration, recognizing the importance of those initiatives for international dissemination of information on clinical research, in open access. Therefore, since 2007 the Journal MVZ Córdoba only publishes articles from clinical investigations that have received an identification number in one of the Clinical Trial Registries validated by criteria established by WHO and ICMJE, whose addresses are available on the ICMJE website. The identification number is listed at the end of the abstract”.

Requirements and general guidelines for article publication Interested parties should send the following forms to the editor, duly filled out and signed by each one of the authors: Presentation of articles and self-review, which can be found in the link: http:// www.unicordoba.edu.co/revistas/ revistamvz/index.htm

Article preparation The article should be written in third person, using a word processor, single spaced, in 12 point Verdana Font, in one column with 3 cm margins. The article, including tables, figures, references, table and figure legends should not exceed 6.000 words for original articles and literature reviews; 3.000 for short communications and clinical cases. Articles in Spanish and in English are accepted and from 2015 they should be sent in the two languages, annexing the corresponding translation certificate. In the article will use the word “Figure” to refer to all the illustrations (graphs, photographs and original drawings). The figures should be of good quality, with well defined, clean lines and legible text; margins should be maximum 1 cm. Photographs should be neat, in focus and with balanced lighting. All tables and figures should have titles, tables in the upper part and figures in the lower part, numbered and cited in the article, without boxes. Tables in image format are not accepted and they all should be annexed at the end of the text in separate pages. The maximum amount of tables and figures will be 8. Each figure should be sent separately with the following specifications: TIFF format, resolution: 300 pixels per inch and 16 cm wide. When including photographs, original files should be sent, indicating the source, with the following requirements: jpg format, 180 pixels per inch and 26 cm wide. If Microsoft Excel is used for graphs, the file should be sent in xls or xlsx format

Receiving and evaluating articles When an article for possible publication is received, the corresponding author will be formally notified of the receipt of the article and

compliance with guidelines and requirements will be verified. After that step, the article will be confidentially sent to two referees, external to the institution, using the double blind method for evaluation. In case of discrepancy, a third referee will be used. In each case the necessary measures will be taken so that the article does not contain elements that allow the referees to identify the authors. The editor will be the only one responsible for communicating the result of the evaluation to the authors. The Editorial Committee and the Editor reserve the right to reject articles that do not comply with the requirements and guidelines, as well as the right to introduce (with the approval of the authors) editorial changes pertaining to grammatical rules, makeup, layout and distribution of editorial space. If the article is approved, a galley proof will be sent to the corresponding author, who will be the only one responsible for socializing, correcting and approving the final version of the article with the coauthors. The Journal MVZ Cordoba conforms to the general uniformity guidelines for biomedical magazines (Vancouver style) with some modifications as mentioned below. 1. Structure of original articles: Titles should be capitalized, text left aligned and in boldface type. They should contain the following information: 1.1. Title of the article: This should be written in Spanish and English, in lower case and in bold, underneath the first line with double spacing and 10 point font. The title should be precise and informative, without abbreviations and a maximum of 15 words. Names in Latin should be written in cursive. Under the title in English an abbreviated title in English should be included with a maximum of 8 words. 1.2. Authors: Are those that participate in the planning, execution, preparation, discussion and writing of the article. The name of the authors should be written in the following way: The first name, first surname and the initial of the second surname in capitals followed by a comma, except in the case of registered signatures, creed or other types. Two surnames could be included if they are joined by a hyphen

(Arrieta-Contreras), followed by a comma and by a superscript that indicates the relationship of each author and the last title or academic degree obtained by the author (the professional or technologist title is required as a minimum. Candidates are not accepted). The following abbreviations will be used according to the case: Specialization (Esp.), Masters (M.Sc.), doctorate (Ph.D.) or the abbreviation of the professional title. The name of the corresponding author should be marked with an asterisk and the email should be included, which will appear in the article and will therefore be public. The institutional affiliation of the authors should be organized hierarchically: Institution, Faculty, Department, Institute, Laboratory, Study Group, etc., address, city and country. Example: Determination of Thermo-resistant Lactic Acid Bacteria Determinación de bacterias ácido lácticas termoresistentes Lactic Acid Bacteria Mario Pérez B,1* Ph.D, Vanessa ArrietaContreras,2 M.Sc, Diva Almentero S,1 Lic. Universidad de Córdoba, Facultad de Medicina Veterinaria y Zootecnia, Instituto de Investigaciones Biológicas del Trópico, A.A. Nro. 354, Montería, Colombia. 2 Lactoanalysis. Calle 27 Nro. 18-62 Montería, Colombia. *Correspondence: elcorreopig@servidor.com 1

1.3. Abstract: It should be structured and have a maximum of 250 words and a minimum of 150, written in one paragraph. It should offer a clear idea of the content of the article including subtitles: objective, materials and methods, results and conclusions, in boldface type. Each subtitle should be followed with a period and space, after which the text of each section should begin. 1.4. Key words: These are short terms that define the content of the article, classify it

and allow it to be found in an automated file. A suggestion is to use a maximum of six words that are not in the title of the article, written in alphabetical order. The terms in the MeSH list or another thesaurus should be used according to the subject of the investigation, such as DeCS, BIREME, NLM, CAB thesaurus, AGROVOC thesaurus, ASFA thesaurus, IEDCYT animal biology thesaurus, environmental thesaurus for Colombia, National Agricultural library, etc., and indicate at the end the thesaurus used, written in parenthesis and in italic type: Key words: Extramedullary, lymph nodes, plasmacytoma (Source: DeSC, CAB). 1.5. Resumen: This is the same summary in English translated to Spanish; it should have the same structure and content. 1.6. Palabras clave: These should be the same key words in English translated into Spanish. 1.7. Introduction: It should clearly indicate the purpose of the investigation, as well as selectively connecting pertinent literature. Data and conclusions on the work that is being discussed should not be included. This section should end with a general objective. 1.8. Materials and methods: Procedures used in the investigation should be clearly described, including statistical design and data analysis. This section should be structured (with subtitles) to specify the type of study, location, geo-climatic conditions, study location coordinates, patients or animals in the study, laboratory methods, ethical aspects, results analysis, etc. Subtitles should be in boldface type, followed by a period and space, and then the text. 1.8.1. Ethical aspects: A brief description of the procedures for handling patients (humans or animals) and the safety risks and guarantees offered during the study according to the type of investigation carried out. It should be stated that the investigation began only after obtaining the authorization of the entities involved. The informed consent form of the participants (humans) and the approval certification

issued by the Ethical Committee should be annexed. Support documents should be on the letterhead of the corresponding institution and then scanned and sent in. As an example, the following text is cited: “Samples were collected by students of the Faculty of Veterinary Medicine and Zootechny of the Universidad de Córdoba, who took into account the procedures for sample collection, handling and preservation, techniques, and the scientific, administrative and ethical standards for animal investigation contained in Law 84 (Colombian National Congress, 1989). During the study, the confidentiality of information about sampled farms and positive animals was maintained. The investigation was approved by the Ethical Committee of the Institute of Tropical Biological Investigations of the Universidad de Córdoba by means of Resolution 012009 on February 1, 2014”. Additionally, in this section existing and in force regulations of each country should be cited, including clean production and preservation of the environment, as well as those pertaining to international regulations of compulsory global compliance. 1.9. Results: This is the information on the findings, without including comments or references from other studies. The use of tables and figures is suggested. The results should be expressed in the past, noting the level of statistical significance in parenthesis (p≤ 0.05, p≤0.01, p>0.05). Tables and figures should be cited in this section in strict order. Text citation could be done in two ways: a) …as can be seen in Table 2; or b) …capture success of 0.1313 individuals/ hours-network (Table 1). Units of measurement will be cited according to the decimal metric system and a space between the number and the unit should be left except for percent signs (%), centigrade degrees (ºC) and pesos ($) which should always be next to the amount. Units of measurement should not be used in plural or have a final period (example: kg instead of kgs, kg.). When a unit of measurement is used for several numbers, only the last value will have the sign (example: 8 – 15 kg

instead of 8 kg â&#x20AC;&#x201C; 15 kg). Decimals should not be written with commas, but with periods. All the composites, reagents and equipment used should include in parenthesis the main production company, headquarter city, state and country (example: Sigma, St. Louis, MO). No commercial names should be included in the text and the active ingredient will always be referenced. 1.10. Discussion: This is the interpretation of the results obtained and comparison with related studies done by other authors. The limitations of the study should be highlighted and speculations avoided. Conclusions of the study and recommendations for future investigations should be included. 1.11. Acknowledgments: Relate the names of the people, institutions, businesses, laboratories, farms, etc., that have collaborated with the investigation (financing, logistics, etc.). This section is not obligatory though it is recommended. Maximum 50 words. 1.12. References: These should be numbered consecutively according to the order they are first mentioned, using Arabic numerals in parenthesis (1). Only those articles directly related to the investigation should appear in this section in order to avoid extensive bibliography reviews. If an article has from one to six authors, all of them should be included in the reference; but if there are more, after the sixth one the expression et al should be written, in italics and without punctuation (et al). Journal titles will be abbreviated (short name, no punctuation) according to the style used in the IndexMedicus. (http://www.ncbi. nlm.nih.gov/sites/entrez?db=journals). The list of references will be submitted on a separate page, in strict order as they appear in the text, not in alphabetic order. For original articles up to 30 references will be accepted; for literature reviews, up to 50

and for the presentation of clinical cases and short communications, up to 15. Summaries of conferences, seminaries, events, courses, presentations, technical reports, newsletters, personal statements, non-indexed electronic consultations, monographs, websites and undergraduate graduate work are not accepted as references. References should be up to date and not be older than 10 years. If necessary, they could be included with proper justification but cannot go beyond 20% of the total amount of references. Only two books can be included as references. 2. Short communications: These should have the same structural content as the original articles. Minimum 1.800 words and maximum 3.000. 3. Clinical cases: Structural content is similar to that of short communications, but the summary is not structured. Additionally, after the introduction an evaluation of the patient will be included (subtitles: anamnesis, clinical exam findings, diagnostic aids, etc., in boldface type), treatment approach. 4. Literature reviews: These consist of a critical analysis of literature published on a timely subject of interest and pertinent to animal sciences. The above guidelines should be adhered to, without including materials and methods, results and discussion sections; in its place, use the necessary titles and subtitles (in boldface type) related to the subject considered. Authors should discuss, sustain or dispute the information in the review. Additionally, they should make a critical contribution on the strengths, weaknesses and investigation opportunities of the proposed subject. Generally, the editor is the one that invites expert and known authors to make these contributions.

Printing and copy rights: Authors are bound to cede reprinting rights of the published material to Journal MVZ Córdoba. Translation or partial or total publication of the magazine requires written permission from the Editor. The Journal MVZ Córdoba and the Universidad de Córdoba are not responsible for the opinions and results expressed by the authors. Content published in the Journal MVZ Córdoba are under the license “Attribution – No Derivs – Noncommercial” from Creative Commons, 3.0 whose complete text can be consulted in: http://co.creativecommons.org/tipos-delicencias/. Correspondence: Complete name of the corresponding author, work and home address, email, cell phone and landline. This information should be filled out on the Author declaration form. The Journal MVZ Córdoba will keep all information provided by the authors confidential. Consultation: This should be done exclusively by the corresponding author, who will be the only one responsible for administrative communication with the Journal. The name of the article to be consulted should be included in the subject line of the email and sent to the following emails: editormvzcordoba@gmail. com, revistamvz@unicordoba.edu.co and revistamvz@gmail.com. Certificates: These will be issued to the referees once the opinion on the article is delivered. These will only be issued to the authors when the article has been evaluated, approved and corrected for publication. The Journal MVZ Córdoba does not make any commitments to the speedy publication of articles related to obtaining academic degrees (M.Sc., Ph.D.), funding sources, final reports on investigation projects, etc., and therefore those articles will be subject to the same current regulations.

Identity of the authors: Will be held strictly confidential by the editorial team of the journal. Articles withdrawn by the authors and those rejected by the Editorial Committee for publication will be filed in the historic data base of the journal and its contents will not be used under any circumstances. Plagiarism and self-plagiarism: Authors should respect and acknowledge all sources of information in obtaining data, figures, photographs, etc., giving respective credit to the consulted authors. Incompliance with this rule will cause the immediate withdrawal of the article when discovered during the submission process. In case of being detected after publication, whether by members of the journal or because of a complaint or report from other authors, the Journal MVZ Córdoba, after verification, will publish the corresponding retraction notice. Journal MVZ Córdoba will correct typographical or any other type of errors in any published article. Duly argued retraction requests will be accepted. Changes in authorship: Can be due to incorporation, suppression or modification in the order initially sent. In any case the corresponding author should send a letter to the editor justifying such changes and include the signature of the involved parties. Under no condition will changes be allowed after the article is approved. Editorial Committee of the Journal MVZ Cordoba Universidad de Córdoba, Facultad de Medicina Veterinaria y Zootecnia. Telephone: (57) (4) 756 90 27 Montería - Colombia Editor: Marco González Tous. MVZ., M.Sc. editormvzcordoba@gmail.com. http://revistas.unicordoba.edu.co/ revistamvz/.

Árbitros de la Rev.MVZ Córdoba 19(1) 2014 Referees of the Journal MVZ Córdoba 19(1) 2014

Acero P. Arturo Aguirre M. Juan Arredondo F. José Barnabé E. Pierre Cardona Á. José Carulla F. Juan Castelán O. Octavio Chacón J. Liliana Conde P. Abelardo Da Silva Aleksandro De Andrade B. Marco Dourado C. William Duitama C. Luis O Duque M. Leonardo García A. Carlos A García M. Luis J García Ulloa Manuel Giraldo E. Carlos A Gonella D. Ángela González A. Daniel Guisado A. Chita B Hernández V. Aureliano. Karakurum Mehmet C. Labruna Marcelo B. Laterça M. Maurício Ley de Coss Alejandro Loyola Wagner Martínez T. Jaime Mendoza M. Dary Luz Mendoza M. Germán Miranda R. Jorge Mrode Ráphael Ocazionez J. Raquel Ogrzewalska María Orozco H. José Pinto R. René Ramírez N. Gloria Román V. César Ruiz C. Raquel Suárez M. Héctor Taphorn B. Donald Torres H. Glafiro Uribe V. Luis Fernando Velásquez V. Raúl Vivas Q. Nelson

Ph.D. Universidad Nacional de Colombia. Ph.D. Universidad Autónoma de Chiapas, México. Ph.D. Universidad Autónoma de Aguascalientes, México. Ph.D. Universidad Federal de Alagoas, Brasil. M.Sc. Universidad de Córdoba, Colombia. Ph.D. Universidad Nacional de Colombia, Colombia. Ph.D. El Colegio de la Frontera Sur, México. Ph.D. Universidad de La Salle, Colombia. M.Sc. Universidad de Cundinamarca, Colombia. Ph.D. Universidad Federal de Santa Maria, Brasil. Ph.D. Universidad Estadual Paulista, Brasil. Ph.D. Fundação Educacional de Andradina, Brasil. Ph.D Universidad Estadual Paulista, Julio de Mezquita Filho, Brasil. M.Sc. Universidad de Antioquia, Colombia. Ph.D. Universidad del Atlántico, Colombia. Ph.D. Universidad de Colima, México. Ph.D Universidad Autónoma de Guadalajara. M.Sc. Universidad de Antioquia, Colombia. M.Sc. Universidad Cooperativa de Colombia. Ph.D. Universidad de Concepción, Chile. M.Sc. Universidad de Valparaíso, Chile. Ph.D. Universidad Nacional de Colombia. Ph.D. University of Mehmet Akif Ersoy, Brasil. Ph.D. Universidad of São Paulo, Brasil. Ph.D. Universidad Federal de Santa Catarina, Brasil. Ph.D. Universidad Autónoma de Chiapas, México. Ph.D. Empresa Brasileira de Pesquisa Agropecuária, Brasil. Ph.D. Universidad Autónoma de Chiapas, México. M.Sc. Universidad del Atlántico, Colombia. Ph.D. Universidad Autónoma Metropolitana, México. M.Sc. Universidad de Córdoba, Colombia. Ph.D. University of Edinburgh, Reino Unido. Ph.D. Universidad Industrial de Santander, Colombia. Ph.D. Universidad de Sao Paulo, Brasil. Ph.D. Universidad de Guadalajara, México. Ph.D. Universidad Autónoma de Chiapas, Mexico. Ph.D. Universidad Nacional de Colombia. Ph.D. Universidad del Quindío, Colombia. Ph.D Universidad del Quindío, Colombia. Ph.D. Universidad Nacional de Colombia. Ph.D. UNELLEZ, Venezuela. Ph.D. Colegio de Postgraduados, México. Ph.D. Universidad de Caldas, Colombia. Ph.D. Universidad Nacional de Colombia. M.Sc. Universidad del Cauca, Colombia.

Índice de Árbitros de la Rev. MVZ Córdoba Volumen 19(1), 2014 Referees Index of the Journal MVZ Córdoba Volume 19(1), 2014 A Acero P. Arturo Aguirre M. Juan Arredondo F. José B Barnabé E. Pierre C Cardona Á. José Carulla F. Juan Castelán O. Octavio Chacón J. Liliana Conde P. Abelardo D Da Silva Aleksandro De Andrade B. Marco Dourado C. William Duitama C. Luis O Duque M. Leonardo G García A. Carlos A García M. Luis J García Ulloa Manuel Giraldo E. Carlos A Gonella D. Ángela González A. Daniel Guisado A. Chita B

H Hernández V. Aureliano. K Karakurum Mehmet C. L Labruna Marcelo B. Laterça M. Maurício Ley de Coss Alejandro Loyola Wagner M Martínez T. Jaime Mendoza M. Dary Luz Mendoza M. Germán Miranda R. Jorge Mrode Ráphael

O Ocazionez J. Raquel Ogrzewalska María Orozco H. José P Pinto R. René

R Ramírez N. Gloria Román V. César Ruiz C. Raquel S Suárez M. Héctor T Taphorn B. Donald Torres H. Glafiro U Uribe Vásquez Luis F. V Velásquez V. Raúl Vivas Q. Nelson

Índice de Autores de la Rev. MVZ Córdoba Volumen 19(1), 2014 Authors Index of the Journal MVZ Córdoba Volume 19(1), 2014 A Aldemir OS, 4023 Aysul N, 4023 B Benítez MM, 3921 Bermúdez CS, 3984 Bravo OV, 3954 C Castro DFA, 3984 Claudiano GS, 3944 Cosenza GR, 3944 Cosio M, 4003 D Díaz MC, 4003 E Enríquez R, 3990 Eren H, 4023 Espinoza JC, 3990 Eto SF, 3944

J Jiménez EC, 3970

Q Quicazán de CM, 4003

K Kuznar J, 3990

R Raffo CE, 3954 Restrepo GA, 3930 Reyes GJ, 3962 Rodríguez SS, 3990 Romero A, 3990 Rosero NR, 4015

L Lazar C, 4033 Loureiro BA, 3944 M Mancera RN, 3930 Mannino S, 4003 Manrique WG, 3944 Marcusso PF, 3944 Mercado PR, 3954 Montañez VO, 3962 Moraes FR, 3944 Morales TG, 3954 Muñoz AP, 3954 N Nava S, 3984

F Fuenmayor BC, 4003

O Ortega SC, 3990

G García GG, 3984 Ghita E, 4033 Gómez OL, 4015 Gras MA, 4033 Guáqueta MH, 3970 Guerra MC, 3962

P Palma GJ, 3962 Pelmus RS, 4033 Pistol GC, 4033 Ponce PJ, 3921 Posada OS, 4015

S Salvador R, Moraes JRE, 3944 Shimada MT, 3944 U Ulutas B, 4023 Ural K, 4023 V Voyvoda H, 4023 Z Zambrano VJ, 3970 Zuluaga DC, 4003

Índice de temas de la Rev. MVZ Córdoba Volumen 19(1), 2014 Topic Index of the Journal MVZ Córdoba Volume 19(1), 2014 EDITORIAL •

Veinte años divulgando ciencia.

ORIGINALES

• Effects of different dietary of protein and lipid levels on the growth of freshwater prawns (Macrobrachium carcinus) broodstock. 3921 • Trophic ecology of Saccodon dariensis (Pisces: Parodontidae) in Guatapé River tributaries, Magdalena River Basin, Colombia. 3930 • Influence of glyceryl guaiacolate ether on anesthetics in tilapia compared to benzocaine and eugenol. 3944 • Cryptosporidium spp., comparative diagnosis and geospatial distribution in diarrheic calves from dairy farms, Valdivia, Chile. 3954 • Effect of sugarcane silage on productive parameters of replacement HolsteinFriesian heifers. 3962

• Risk factors for ovarian postpartum resumption in Holstein cows, under high tropical conditions. 3970 • Some ecological aspects of free-living Haemaphysalis juxtakochi Cooley, 1946 (Acari: Ixodidae) in Panama. 3984 • Relationship between apoptosis and the BH2 domain sequence of the VP5 peptide of infectious pancreatic necrosis virus. 3990 • Evaluation of the physicochemical and functional properties of Colombian bee pollen. 4003 • Application of the logistic model to describe the growth curve in dogs of different breeds. 4015 COMUNICACIÓN BREVE •

Single dose of secnidazole treatment against naturally occuring Giardia duodenalis infection in Sakiz lambs. 4023

•

Estimation of genetic parameters for milk traits in Romanian local sheep breed. 4033

Revista

Formulario de suscripción / Subscription form Rev.MVZ Córdoba / Journal MVZ Cordoba ISNN: 0222-0268

Córdoba Journal

Cordoba

Región/Country

1 año/1 year

Colombia

$ 100.000.oo

América Latina y el Caribe / Latin America and Caribbean

US $55

EUA y Canadá / U.S.A. and Canada

US $60

Otras regiones / Other regions

US $75

Información personal /personal information Fecha/Date: Nombre y apellido / Name and Last name: Institución / Organization: Dirección / Address: Ciudad / City: Departamento, Estado o Provincia / State: Código Postal / Zip code:

Apartado Aéreo / P.O. Box:

Teléfonos / Phones:

Fax:

Correo electrónico / e-mail: Nota: Por favor, envíe el presente formulario por correo certificado junto con un cheque o giro postal en pesos colombianos o en dólares americanos a la siguiente dirección: Universidad de Córdoba, Facultad de Medicina Veterinaria y Zootecnia. A.A. Nº 354 Montería - Córdoba - Colombia. Note: Please, send this form by certified mail with a check or money order in Colombian pesos or American dollars at the following address: University of Córdoba, Facultad de Medicina Veterinaria y Zootecnia. A.A. No. 354 Monteria - Córdoba - Colombia.

Revista

Formulario de suscripción / Subscription form Rev.MVZ Córdoba / Journal MVZ Cordoba ISNN: 0222-0268

Córdoba Journal

Cordoba

Región/Country

1 año/1 year

Colombia

$ 100.000.oo

América Latina y el Caribe / Latin America and Caribbean

US $55

EUA y Canadá / U.S.A. and Canada

US $60

Otras regiones / Other regions

US $75

Apartado Aéreo / P.O. Box:

Teléfonos / Phones:

Fax: