Health & Fitness for a New Year 2013

Page 1

Princeton Valley Cyclocross Race

V o l u m e O n e ’s g u i d e t o s e e i n g yo u r N e w Y e a r’s r e s o l u t i o n t h r o u g h Even if you haven’t announced it publicly, you know you made an informal New Year’s resolution to yourself. And, odds are, it had to do with being healthier. Well if you’re like us (except for the fact that every year we tell everyone about our resolutions), after a few months, weeks, or even days you’ve already given up. Well enough is enough. This year is different because you’ve got this guide to help you see it through. We’ve done all the work you could possibly need in terms of nutritional tips, lifestyle changes, and fitness amenities. So put down the burger and roll off the couch, because there are no more excuses. Let’s do this thing!

BROUGHT TO YOU IN PART BY

Editors: Thom Fountain, Tom Giffey, Tyler Griggs /// Photography: Andrea Paulseth /// Design: Brian Moen, Josh Smeltzer VolumeOne.org 27 Jan. 31, 2013


BROUGHT TO YOU IN PART BY

Writing a New Chapter on Health

addition to planning document will encourage active living for Eau Clairians By TOM GIFFEY CONTRIBUTED IMAGE

The phrase “public health” evokes images of vaccination clinics, infectious disease outbreaks and giant health care programs such as Medicare and Medicaid. But is also should cause us to consider topics such as pedestrian pathways, bike trails, and community gardens. At least that’s the philosophy behind a forthcoming chapter about health that will be added to the city of Eau Claire’s Comprehensive Plan. Comprehensive plans are weighty tomes that typically address bread-andbutter municipal issues such as land use, transportation, and utilities – not health. “It’s uncharted territory for us,” acknowledges Ned Noel, an associate planner with the city who is writing the health chapter. Yet when you consider the connections between our “built environment” (think: buildings, roads, sidewalks, and trails) and our personal well-being, the relationships become obvious. “If our communities are more walkable, people are going to be more healthy,” Noel offered as an example. “All of these things kind of interconnect.” The interconnection are both figurative and literal: Among the many suggestions in the forthcoming document is to improve the physical links – trail corridors and bike lanes – between neighborhoods and parks as a way of encouraging residents to get more physical activity. The creation of the health chapter was inspired by the work of a group called ACHIEVE Eau Claire, which was formed with a federal grant in 2010 to promote healthy living. ACHIEVE – the name is an acronym for “Action Communities for Health Innovation and EnVironmental ChangE” – is a partnership between the Eau Claire YMCA, the city Parks Department, the City/County Health Department, hospitals, and a host of others, and it assessed nutrition, physical activity, tobacco use, and other health topics in the community. Another ad hoc committee composed of representatives of a broad section of the community, from neighborhood associations to health care providers to architectural firms, began meeting in September to held shape the forthcoming health chapter. In early February, the City Plan Commission will review the document, and later a public hearing will be held. A draft version of the health chapter, which was released Jan. 25, is chock full of intriguing ideas on how to improve the community’s health in five categories:

older people to stay in their homes. This could be achieved through changes in zoning laws to allow more “granny flats” – i.e., small dwellings for older folks attached to existing homes. • Considering strengthening building codes to improve health, such as by abating lead and asbestos, addressing radon and secondhand smoke, and limiting other indoor pollutants.

SAFETY & CRIME • Adopt so-called Crime Prevention Through Environmental Design principles. These guidelines encourage things like improving lighting, eliminating hiding places, and installing speed bumps to boost safety. • Take more measures to prepare for the “unthinkable” – such as terrorism and mass shootings – by securing doors, keeping vehicles away from building entrances, and the like. • Boost enforcement in areas where drivers often speed and disobey traffic laws.

DRUG USE active living • Strengthen support for existing park programs and further develop Northwest and Otter Creek community parks, Pinehurst Park, and the Jeffers Road Athletic Fields. • Consider the consequences of cuts or changes to parks and recreation programs, particularly those in low-income neighborhoods where access to physical activities can be scarce. • Assess the walkability of new developments by using tools such as the Walk Score website (walkscore. com). City planners should consider using a five-minute walking radius – i.e., about a quarter mile – as a rule of thumb when considering developments. • Encourage the construction of sidewalks in industrial and commercial areas, both for pedestrians and to promote physical activity by employees. • Make streets more livable when they are rebuilt by adding curb extensions, raised crosswalks, median islands, bike lanes, and elements to slow vehicle traffic, such as curved pavement markings, decorative light poles, and boulders. • Work with the school district to create a Safe Routes to School Master Plan to encourage kids to walk to school as a way to combat childhood obesity. • Identify measurable goals that can demonstrate that the health of the com-

“It’s uncharted territory for us.” – Ned Noel, associate city planner, on adding a health chapter to the Comprehensive Plan

munity is improving. For example, Noel said, the goals could include an increase in the percentage of people in the city who commute via foot, bike, or bus.

food & nutrition • Because community gardens promote physical activity, nutrition, and sustainability, encourage their creation in every city neighborhood. • Ensure all city residents have access to fresh food. In some neighborhoods, particularly low-income areas, it’s difficult to get to a grocery store. Under U.S. Department of Agriculture standards, part of the North Side Hill and North River Fronts neighborhoods – the area around Birch Street and Mt. Simon Park – is classified as a “food desert.” • Foster a year-round farmers market, perhaps in the West Bank Redevelopment District on the west side of the Chippewa River, across from downtown. • Address the high prevalence of fast-food restaurants in the community. According to state data, Eau Claire County has the highest density of fast-food outlets in the state. • Consider allowing urban agriculture – such as farming and domestic fowl – in the city while controlling possible nuisances.

land use • Continue to encourage compact, mixed-use urban development. • Use “Complete Street” principles when building new streets or rebuilding old ones. (“Complete Streets” are designed with all users – including motorists, bicyclists, and pedestrians – in mind.) • Encourage “aging in place” to allow

VolumeOne.org 28 Jan. 31, 2013

• Research the relationship between establishments that sell alcohol and criminal activity. (Eau Claire County is ranked as one of the worst in the state for excessive drinking.) Provide more access to safe rides home for those who drink alcohol. Consider prohibiting tobacco use in city parks and multifamily dwellings.

ENVIRONMENTAL EXPOSURES • Complete and implement a plan to address natural hazards such as tornadoes, droughts, blizzards, floods, and health pandemics, and also consider a plan to address the impact of climate change. Require a health impact assessment when considering new heavy industrial development, such as sand loading or processing plants. Develop noise pollution standards. Under the current city noise ordinance, there’s no way to file a complaint when noise is causing a public nuisance. Noel, the associate city planner, said the city’s desire to make public health considerations part of public planning is uncommon for a municipality. “This is unique in the sense that it’s specific to the built environment and health, coming at it from the idea of active living,” he says. To learn more about the proposed health chapter of the Eau Claire Comprehensive Plan, go to tinyurl.com/healthchapter. The Eau Claire Plan Commission will review a draft version of the health chapter at its meeting at 7 p.m. on Monday, Feb. 4, in the City Council Chamber at Eau Claire City Hall, 203 S. Farwell St. There will be a public hearing on the document at a future Plan Commission meeting.


BROUGHT TO YOU IN PART BY

Healthy Tidbits

need a healthful reminder? read up. NANCY COFFEY – NUTRITION COORDINATOR, EAU CLAIRE COUNTY, UW EXTENSION Keep the focus off of weight. Being a certain weight doesn’t really mean you’re healthy or unhealthy. People can be thin and very healthy, or thin and unhealthy, or thick and healthy.

Eat more “anytime” foods, and fewer “sometimes” foods. A slice of whole wheat bread is an “anytime” choice, while a doughnut is a “sometimes” choice.

It’s about getting the most bang for your buck. You only have so many calorie “bucks” in a day (think of it as an allowance), so you want to expend them in the best way possible. Get the most nutrition out of your calories. Know that fatty, sugary foods have more calories.

Visualization can help you make good choices. Cover half the plate with veg-

etables, one fourth with protein, and one fourth with grain.

Some people like to eat a lot, and that’s okay. It’s about calories in/calories out, so as long as you’re getting enough physical activity, you should be fine.

The benefits of eating nutritiously will be many and varied. “It’s like asking someone who just stopped smoking ‘how’ they’re feeling better these days,” says Coffey. Eating healthier gives you confidence, helps you stay positive, generates energy, and makes you “feel better altogether” – which could mean something different for each individual.

Diets are not very effective. What’s effective is changing our behaviors. The weight will come off with time, if that’s your goal. Slowly make healthier eating choices or add exercise to your routine.

VolumeOne.org 29 Jan. 31, 2013


VolumeOne.org 30 Jan. 31, 2013


BROUGHT TO YOU IN PART BY

Chiseled for Cheap 10 winter fitness activities through Eau Claire Parks & Recreation

*calorie estimates based on one hour of activity for a 180-pound person

Hockey: No teams necessary for this co-ed free-for-all 8:45-10:15pm every Wednesday at Hobbs Ice Center through March 27. This is for ages 18 and older costs $6 a session and you can slap shot 654 calories away in the first hour. Snowshoeing: Take a stroll over any of the 650 acres of parkland. Don’t own snowshoes? Rent a pair from 6-8pm Thursdays at Boyd Park during Winter After Hours through Feb. 28. In just one hour, you’ll stomp away 654 calories. Cross-country skiing: The city grooms ski trails in Carson and Fairfax parks, as well as the City Wells area to account for about 6 miles of skiing. Depending on your pace, you can burn 572 to 654 calories in an hour. Broomball: Drop in for adult open broomball 8:45-10:15pm every Wednesday at Hobbs Ice Center through March 27. Cost is $5 a session, and in only one hour of broom-to-ball combat, you’ve burned yourself 601 calories. (Brooms provided.) Skating: Enjoy your lunch on ice with “Lunch Break Open Skate” from 11am1pm weekdays at Hobbs Ice Center until May 24. Admission is $2 with another $2 for skate rental. Can’t get away at lunch? Open skate is 5:30-7:30pm Sundays and 6:30-8:30pm Wednesdays until March 27. It costs $5 for adults, $4 for 17 and younger. Either way, it’s 572 calories an hour.

Sledding: What can be so physically demanding about sliding down a hill? Walking to the top of it, for starters. Do that for an hour, and you will have burned 490 calories. Reward yourself with a cup of hot chocolate and a roaring fire during “Come Slide With Us” 1-4pm Sundays at Pinehurst Park through Feb. 10. Dancing: Starting Feb. 5, you can learn how to waltz, rumba, foxtrot, or swing dance (6-7pm) with weekly dance lessons at the Moose Lodge. Melt away up to 449 calories a class. Cost is $49 ($59 for non-residents) and available to ages 16 and older. Water Aerobics: Water fitness classes meet twice a week in area indoor pools, and you can burn 327 calories each class. The next five-week sessions start the week of Feb. 18. Cost is $48 ($58 for nonresidents) and available to ages 17 and older. Walking: With 13 miles of paved bike trails, you’ll need more than a hour to walk it all, but even at a leisurely pace, you’ll shuffle off 204 calories each hour. Ice Fishing: This counts. So access Half Moon Lake or Dells Pond from public boat landings in Carson, Riverview, and Mt. Simon parks to become 163 calories lighter within your first hour of, um, exercising.

VolumeOne.org 31 Jan. 31, 2013


BROUGHT TO YOU IN PART BY

ANDREA PAULSETH

The Fit List

the Chippewa Valley’s many resources for a healthy lifestyle ACUPUNCTURE Acupuncture For Wellness 3420 Mall Dr., Ste. #1,

Eau Claire • 379-6429 • ac4wellness@gmail.com • ac4wellness.com Casey Castona offers a unique brand of healing through acupuncture by bringing together Chinese and Western Medicine. Specializing in Pain Management. Nutritional and herbal formula counseling.

Acupuncture Natural Care Center Sc 1650 Hallie

Rd., Chippewa Falls • 831-8223 • See contact info for details.

Acupuncture Pain Clinic 1650 Hallie Rd., Chippewa

Falls • 830-4055 • nccaomdiplomates.com Richard Polzin is a NCCAOM-certified professional and can help transform your vitality and your life for the better. If you’re looking to naturally enhance your health and take care of your body, you’ve come to the right place.

Elements for Healthcare 431 E Clairemont Ave,

Suite 2A, Eau Claire • 832-2005 • barbara0941@ sbcglobal.net • elementsforhealthcare.com Offers services such as TCM acupuncture, therapeutic massage, and strategies to reduce stress.

Paul Lin Acupuncture & Herbal Medicine 3321 Golf Rd., Eau Claire • 832-1953 • paullinacupuncture. com Paul Lin is from Taiwan with a family rich in the tradition of Chinese medicine. His father specializes in a very unique diagnostic skill, on-the-back-examination, and utilizes topical herbal treatment. Located inside Optima Health & Vitality Center.

tions, basic dance steps and combinations, and the use of finger cymbals. Benefits may include weight loss and increased range of motion. Anticipate a supportive and fun community of dancers to uplift your spirit. No experience is necessary to start.

Sofia Tribal Belly Dance 2131 Fenwick Ave., Eau

Claire • 379-6304 • sofiatribal.com Offering American Tribal Style (ATS) beginner belly dance classes every six weeks. Women have been practicing the ancient art of belly dance for centuries. This dance that celebrates both feminine beauty and feminine strength is the perfect fitness solution for any woman looking to spice up her workout routine. No experience required. Classes are taught by certified belly dance instructors.

BIRTH/PREGNANCY SVCS Apple Pregnancy Care Center 2600 Stein Blvd.,

Eau Claire • 834-7734 • volunteer@applepcc.org • applepcc.org APPLE assists women with caring, counseling and information to help provide those with unplanned pregnancies the facts and services that will help them make choices they can live with.

Earth Mother Midwife 612-801-9967, 273-4081 •

erin@earthmothermidwife.com • earthmothermidwife.com Offering female sexual health care, prenatal care, birthing midwife services, postpartum services, newborn care, doula services, and much more.

Marshfield Clinic 2116 Craig Rd., Eau Claire • 858-

4646, 800-924-8515 x7-4646 • marshfieldclinic.org Providing dedicated and experienced midwives for women’s health care needs.

Gold’s Gym Eau Claire • 577-1285 • DiamondBallet@aol.com • diamondschoolofdance.com Offers ballet, tap, jazz, lyrical, pointe, hip-hop, and competitive performance.

Eau Claire School of Dance 306 Main St., Eau

Claire • 832-9900 • ecschoolofdance@aol.com • eauclaireschoolofdance.com Offering classes in ballet, lyrical, tap, hip hop, pointe, and technique.

Eau Claire Ultimate Performance Gymnastics

3213 Louis Ave. Suite I, Eau Claire • 832-3138 • info@teamupgym.com • teamupgym.com Eau Claire Ultimate Performance Gymnastics provides exceptional USA Gymnastics training using experienced coaching, high-quality equipment and the largest gymnastics facility in the area. Featuring recreational classes, competitive teams, high school training, private lessons, camps and parties.

En Avant School of Dance 3330 North Town Hall

Road, Eau Claire • 874-5575 • enavantdance.com Combination, modern, pointe and jazz.

Goggin Ballroom Dancing Eau Claire Regional

Root and Branch Acupuncture 1227 Menomonie St., Eau Claire • 836-9696 • A retired nurse practitioner offers both needle and non-needle acupuncture, and microcurrent and meridian therapy.

Mayo Clinic Health System 1400 Bellinger St.,

Tao Arts 1215 Gilbert Creek Rd, Menomonie • 2313060 • Sensei Leland is known for his alternative and traditional Chinese approaches to medicine, including acupuncture, use of herbs, and tuina massage.

Arts Center, 316 Eau Claire St., Eau Claire • 8331879 • Email@DancinGoggin.com • dancingoggin. com They teach ballroom, Latin, and swing dancing.

Morning Star Birth Center Menomonie (see contact

Jean Marie’s School of Dance 31 W Spring St.,

Two Rivers Clinic 200 Main St., Eau Claire • 855-

8280 • 2riversclinic@att.net • tworiversclinic.com Two Rivers Clinic offers complete, ambulatory women’s health care and medical acupuncture for men and women - of all ages.

BELLY DANCING Dancing Mountain • 688-9556 • farmcrew@cltcomm.

net • dancingmtn.com Dancing Mountain aims to guide people in joyful movement and to imbue our daily lives with a sense of wonder, exploration, and ease.

ECShimmy Banbury Place, 800 Wisconsin St., Eau

Claire • 926-4233 • laura@ecshimmy.com • ecshimmy.com Laura teaches six-week classes in beginning and intermediate belly dancing.

Pilates, Yoga, and Beyond 4913 River Glen Ct.,

Eau Claire • 832-7335 • sheri@baemmert.com • baemmert.com Private sessions and group classes in Pilates, yoga, Thai yoga bodywork, belly dancing and more.

Sahaja Dance / Jen Bush and Rebecca Whitman 523 Cedar Ave, Menomonie • 688-9556 • farmcrew@centurylink.net, rwhitman@centurytel.net • sahajadance.com Belly dance classes in a friendly, energetic atmosphere with a focus on body isola-

Eau Claire • 838-6100 • mayoclinichealthsystem. org Featuring certified nurse midwives. info for location details) • 231-2100 • morningstarbirth.com Morning Star Women’s Health and Birth Center invites you to explore the many services we have available to pregnant women. We are committed to offering holistic maternity care in the Midwives’ Model of Care and to empower expecting mothers and families through principles of education, communication and shared decision making.

DANCE STUDIOS Arthur Murray Dance Studio 401 1/2 S Barstow St.,

Eau Claire • 834-6166 • arthurmurrayec@sbcglobal.net • arthurmurrayeauclaire.com Arthur Murray teaches rhythm and Latin dances, country western dances, specialty dances and more. Learn from qualified instructors in a friendly and relaxing environment.

Dancers’ Studio 800 Wisconsin St., Bldg 13, Ste

Chippewa Falls • 723-8635 • jeanmariedance.com Specializing in children’s classes, Jean Marie offers tap, ballet, jazz, and basic acrobatics. Classes for adults also available.

Eau Claire Team Revolution/715 Fit Club • 864-9308 • 715fitclub.com ECTR is an exciting networking experience dedicated to bringing active people together in the Chippewa Valley area. ECTR connects fitness team members in for any purpose. Do you a partner for your recreational, fitness, or workout goals? This is your resource to find that person, or group. Women’s Boot Camp Hallie • 563-2370 • rejuvcamp@ yahoo.com • rejuvwellness.blogspot.com Women’s boot camp guarantees to help you lose weight and tone your body. They enjoy working with all fitness levels and provide education on healthy eating, stress reduction and behavior modification.

GYMS & HEALTH CLUBS Anytime Fitness 329 Water St., Suite E, Eau Claire • 831-6400 • anytimefitness.com A membership gets you unlimited, on-your-own access to a wide array of exercise machinery and free weights. Personal training, tanning, nutritional counseling. Open 24 hours, pay as you go plans available.

Anytime Fitness 401 Pinnacle Way, Suite 116, Eau

Sofia Spirit Studio 2131 Fenwick Ave., Eau Claire • 379-6304 • sofiatribal@gmail.com • sofiatribal.com SofiaSpirit is a dance and movement studio offering classes in belly dance, yoga, fitness, and creative and expressive dance. The studio houses a small boutique and resource center offering belly dance textiles, jewelry, media, and accessories. Check website for current class listing.

Anytime Fitness 1700 Stout Rd., Menomonie • 309-4441 • anytimefitness.com A membership gets you unlimited, on-your-own access to a wide array of exercise machinery and free weights. Personal training, tanning, nutritional counseling, daycare, pool, and specialty classes. Open 24 hours, pay as you go plans available.

Swan Lake Ballet Studio Banbury Place Bldg 13

Danz Kraze Building 4/6, Suite 205, 800 Wisconsin

Diamond School of Dance 123 S. Graham Ave.,

University of WI-Eau Claire, Eau Claire • taylordb@uwec.edu • uwec.edu/tango “T3”provides Eau Claire students, staff, and the general community instruction and practice opportunities for various social dances such as Swing, Cha Cha, Waltz, Viennese Waltz, Tango, and Foxtrot.

St., Eau Claire • 832-DANZ • ECDanzKraze@aol. com • ecdanzkraze.com Youth dance teams use Eau Claire’s largest studio space and are modeled after High School dance teams, offering poms, hip hop/ funk, kick, and jazz. Short sessions available for those who are indecisive.

Benji Williford – Chain Reaction Fitness 126 Graham Ave., Eau Claire • 379-4249 • Benji@chainreaction-fitness.com • benjiwilliford.com Boot camps, TRX suspension training, and personal training from a certified fitness, yoga, Pilates, and TRX trainer.

Jewelry Box Dancer 110 West Main St., Menomonie • 563-3534 • jewelryboxdancers@gmail.com • jewelryboxdancers.com This studio teaches children ages 4 through 14 in combined tap, jazz, ballet, and hip hop. Limited adult classes offered as well. Find Jewelry Box Dancer on Facebook too.

Ste 122, Eau Claire • 590-8502 • ganna@swanlakeballetstudio.com • swanlakeballetstudio.com A classical ballet dance studio owned and operated by Ballet Master Ganna Kotenko.

122, Eau Claire • 830-9410 • Ballroom and modern dance lessons for adults.

GROUP TRAINING

Two to Tango McPhee Dance Studio (Room 105),

VolumeOne.org 32 Jan. 31, 2013

Claire • 831-6200 • anytimefitness.com A membership gets you unlimited, on-your-own access to a wide array of exercise machinery and free weights. Personal training, tanning, nutritional counseling. Open 24 hours, pay as you go plans available.

Anytime Fitness 2532 Golf Rd., Eau Claire • 831-8600

• anytimefitness.com A membership gets you unlimited, on-your-own access to a wide array of exercise machinery and free weights. Personal training, tanning, nutritional counseling. Open 24 hours, pay as you go plans available.

Bodyworks Athletic Club, LLC 3019 Schneider Ave East,

Menomonie • 235-6106 • bodyworksmenomonie.com Personal training, free weights, and machines. Classes in strength/endurance, body sculpting, cardio, yoga, pilates, circuit, zumba, and spinning. Saunas, tanning, nutritional counseling, and open 24 hours.

Chippewa Valley Family YMCA 611 Jefferson Ave., Chippewa Falls • 723-2201 • lynnb@chippewaymca.


BROUGHT TO YOU IN PART BY

com • chippewaymca.com Free weights and machines. Basketball, racquetball, indoor track, pool, raquetball, and volleyball. Classes in strength/endurance, body sculpting, cardio, yoga, dance, spinning, circuit, swimming, and gymnastics. First aid, lifeguard, and babysitting training. Massage, kids’ events and classes, childcare, and personal training.

Curves 1417 S. Hastings Way Ste. B, Eau Claire • 552-8783 • curveseauclaire.com Designed around circuit training utilizing hydraulic resistance equipment, Curves’ 30-minute sessions in fitness and weight-loss guidance are hosted in an environment designed for women. Dance classes and nutritional counseling. Curves 509 E. South Ave., Chippewa Falls • 7200304 • curves.com Designed around circuit training utilizing hydraulic resistance equipment, Curves’ 30-minute sessions in fitness and weight-loss guidance are hosted in an environment designed for women. Personal training, dance classes, pro shop, and nutritional counseling.

Curves 1500 9th Street E.,

• eauclairewi@goldsgym.net • goldsgym-ec.com Personal training, free weights, and machines. Basketball, volleyball, cardio cinema, and pool. Classes in strength/endurance, cardio, body sculpting, pilates, yoga, circuit, spinning, and dance. Nutritional counseling, beverage bar, tanning, pro shop, kids’ services, and spa/sauna.

Highland Fitness Center 2221 Eastridge Ctr., Eau Claire • 833-2100 • highlandfitness.com EastRidge offers four group fitness studios, over 60 cardiovascular machines, free weights, and multiple strength circuits. They feature a “swim gym” for those looking for a water-based work out, a hot-tub and sauna for post-workout aches. Highland Fitness Center 2405 Folsom

Street, Suite A, Eau Claire • 833-2100 • highlandfitness.com WestRidge Center offers over 20 cardiovascular machines, free weights, and a Life Fitness strength circuit. Open 24 hours.

For even more reso urces and artic les, visit VolumeO ne.org / Health

Menomonie • 235-6600 • curvesmenomonie.com Designed around circuit training utilizing hydraulic resistance equipment, Curves’ 30-minute sessions in fitness and weight-loss guidance are hosted in an environment designed for women. Personal training, dance classes, pro shop, and nutritional counseling.

Eau Claire YMCA 700 Graham Ave., Eau Claire • 836-8460 • ken@eauclaireymca.org • eauclaireymca. org Free weights and machines. Basketball, volleyball, racquetball, indoor track, and pool. Classes on strength/endurance, body sculpting, cardio, yoga, pilates, dance, indoor cycling, swimming, gymnastics, and martial arts. First aid, lifeguard, and babysitting training. Massage, spa/sauna, kids’ events and classes, and childcare. Tennis center located at 229 Moore St., Eau Claire, 836-8470. FitELITE 2839 Mall Dr., Ste. 3A, Eau Claire • 5141264 • fiteliteonline.com Free weights, personal training, specialty classes, and nutritional counseling. Gold’s Gym 3225 Lorch Ave., Eau Claire • 552-4570

Highland Fitness Center 3022 Commercial Blvd., Chippewa Falls • 833-2100 • highlandfitness.com Lake Hallie Highland fitness features group fitness classes, brand-new state of the art treadmills, free weights and multiple strength circuits. Open 24 hours.

Life Fitness Center 312 Bridge St., Chippewa Falls • 723-3800 • lifefitnesscenterofchippewa@ gmail.com Offering personal training, yoga, pilates, tanning, nutrition and massage, plus a variety of group fitness classes and one-on-one classes. Momentum SportFitness, LLC 2615 London Road

Suite B, Eau Claire • 955-4319 • getmo@momentumsport.com • momentumsport.com Training people for high performance in athletics, recreation, or an active lifestyle. The Momentum University individual or group training package emphasizes training techniques and program implementation. Membership options available as well as additional individual or group personal training.

New Image PACE Fitness 13384 49th Ave., Chip-

pewa Falls • 720-7722 • newimagepacefitness@ yahoo.com • newimagepacefitness.com This all-ages

VolumeOne.org 33 Jan. 31, 2013


BROUGHT TO YOU IN PART BY

The Fit List CONT’D gym employs the Progressive Aerobic Circuit Exercise system, which uses unique hydraulic resistance machines. Dance, circuit, and strength/endurance classes, plus nutritional counseling.

Pilates, Yoga, and Beyond 4913 River Glen Ct., Eau Claire • 832-7335 • sheri@baemmert.com • baemmert.com Private sessions and group classes in Pilates, yoga, Thai yoga bodywork, belly dancing and more.

Snap Fitness 3445 E Hamilton Ave., Eau Claire •

830-9999 • snapfitness.com/eauclaire A membership gets you unlimited, on-your-own access to a wide array of exercise machinery and free weights. Personal training, tanning, and open 24 hours. Pay-as-you-go plans available.

Snap Fitness 1320 Broadway St. N, Menomonie •

232-9999 • snapfitness.com/menomonie A membership gets you unlimited, on-your-own access to a wide array of exercise machinery and free weights. Personal training, tanning, and open 24 hours. Payas-you-go plans available.

Snap Fitness 475 Chippewa Mall Dr., # 305, Chippe-

wa Falls • 723-0602 • snapfitness.com A membership gets you unlimited, on-your-own access to a wide array of exercise machinery and free weights. Personal training, tanning, nutritional counseling, and open 24 hours. Pay-as-you-go plans available.

The Garrison 800 Wisconsin St., Bldg 6, Suite 215, Eau Claire • (800) 304-0798 • eauclairemma.com A variety of fitness programs including Brazilian JiuJitsu, boxing, Muay Thai kickboxing, cardio kickboxing, women’s bootcamp, youth self defense and youth wrestling. UW-Stout Health & Fitness Center / North Point

712 South Broadway, Menomonie • 232-1392 • fitness@uwstout.edu • urec.uwstout.edu Free weights, machines, personal training; classes in strength and endurance training, body sculpting, cardio, Pilates, yoga, circuit, dance, specialty classes; basketball, volleyball, racquetball, tennis, a pool and a track; beverage bar, pro shop. 24/7 access at the North Point center.

UWEC Recreation & Sport Facilities 105 Hilltop

Center, Eau Claire • 836-3377 • recreation@uwec. edu • uwec.edu/recreation For UWEC students and staff. Free weights and machines; basketball; volleyball; racquetball; tennis; bowling; indoor track; climbing wall; pool; strength and endurance training, cardio, body sculpting, Pilates; spinning, dance, and wellness classes; massage.

Wissota Fitness Tanning & Massage 16850 Cty.

Hwy. X Suite 2, Chippewa Falls • 723-7006 • wissotafitness@clearwire.net • wissotafitness.com Free weights and machines. Track, massage, tanning, spa, and open 24 hours.

HOSP. & HEALTH CLINICS Chippewa Valley Eye Clinic 2525 Cty Hwy I, Chippewa Falls • 723-9375 • chippewaeyeclinic.com.

Chippewa Valley Eye Clinic 2715 Damon St., Eau

Claire • 834-8471 • chippewavalleyeyeclinic.com.

Chippewa Valley Free Clinic 836 Richard Dr., Eau

Claire • 839-8477 • cvfreeclinic.org.

Chippewa Valley Orthopedics & Sports Medicine 4212 Southtowne Dr., Eau Claire • 832-1400 • cvosm. com.

Eau Claire Heart Institute 659 W. Hamilton Ave., Eau Claire • 831-4444 • echeart.com.

Family Health Associates 2449 County Highway I, Chippewa Falls • 723-9138 • hshsmedicalgroup.org. Marshfield Clinic 2116 Craig Rd., Eau Claire • 858-

4500 // Cancer Care: 900 W. Clairemont Ave., Eau Claire • 839-3956 // 3501 Golf Rd., Eau Claire • 858-4200 // Riverview Center of Psychiatry & Behavioral Health: 1000 Starr Ave., Eau Claire • 8584850 // 2655 Cty Hwy I, Chippewa Falls • 726-4200 // 12961 27th Ave., Chippewa Falls • 738-3700 // 305 S. Hwy 27, Cadott • 289-3102 // 3603 Schneider Ave., Menomonie • 233-6400 • marshfieldclinic.org.

Mayo Clinic Health System 1221 Whipple St., Eau

Claire • 838-6767 • mayoclinichealthsystem.org.

Oakleaf Surgical Hospital 3802 Oakwood Mall Dr., Eau Claire • 839-9833 • oakleafsurgical.com. Pine Grove Family Medicine 3221 Stein Blvd., Eau Claire • pinegrovefamilymedicine.com. Sacred Heart Hospital 900 West Clairemont Ave., Eau Claire • 717-4121 • sacredhearteauclaire.org.

St. Joseph’s Hospital 2661 County Highway I, Chippewa Falls • 723-1811, 877-723-1811 • stjoeschip-

falls.com.

UW-Health: Eau Claire Family Medicine 617 W.

Clairemont Ave., Eau Claire • 839-5175 • uwhealth. org.

Western Wisconsin Urology 3217 Stein Blvd., Eau

Claire • 835-6548 • eauclaireurology.com.

Willow Creek Women’s Clinic • 832-9292 • info@ willowcreekclinic.com • willowcreekclinic.com.

hypnosis Heaven Sent Healing 3548 Cypress St., Eau Claire • 833-1096 • geiglej@yahoo.com • heavensenthealing. us Julie works as a Spiritual Teacher, empowering people to live more mindfully. She specializes in healing relationships: with others, with self, with spirit. Hypnosis Center of Eau Claire Banbury Place 800 Wisconsin St. Bld 2-D, Suite 420, Eau Claire • 5525355 • hypnosiscenterec.com Certified and experienced hypnotherapist Richard Marano, B.S., C.H. will “allow your subconscious mind to replace bad habits with new and healthier ones.” Rid yourself of anything from insomnia and smoking to anxiety and weight problems.

martial arts/boxing AKF Martial Arts Academy of Eau Claire 1606 S Hastings Way, Suite B, Eau Claire • 613-8282 • martialartseauclaire.com Kyuki-Do is focused on helping you and your families achieve goals through martial art techniques, practical self defense, and traditional principles. Offers classes for ages 4 and up, and done in a group setting. Can also accommodate private lessons. American Tae Kwon Do & Fitness Banbury Place 800 Wisconsin St. Bld 13 Suite 5, Eau Claire • 5522777 • contactatf@atf.nu • atf.nu Taekwondo classes in both private and group settings offering fast, hardhitting cardio workouts. Also offers a fitness membership where members can independently use the facility and equipment during non-class hours. Ancient Arts Eau Claire • 514-0388 • Traditional Chinese kung-fu instruction in both private and group settings covering Wing Chun, Qi Gong, and Taoist areas. Instructor Sifu Howard was trained in China and has amassed thirty years of experience.

Chippewa Valley Boxing Club

Hapkido, Jiu-Jitsu, and several other arts. Also offering women’s self-defense and kickboxing classes.24hour fitness room with certified fitness trainer on site.

Red Dragon Academy 438 Main St. E, Menomonie • 235-1122 • reddragonacademy@hotmail.com • reddragonacademy.com Karate instruction for all ages in both private and group settings. The Garrison 800 Wisconsin St., Bldg 6, Suite 215, Eau Claire • (800) 304-0798 • eauclairemma.com A variety of fitness programs including Brazilian JiuJitsu, boxing, Muay Thai kickboxing, cardio kickboxing, women’s bootcamp, youth self defense and youth wrestling. The Grind 513-6621 • steve@thegrindmma.com • thegrindmma.com Train to fight or simply train like a fighter. The classes at The Grind MMA cater to individuals of all skill levels and are inspired by Boxing, Kick Boxing, Karate, Mauy Thai, Wrestling, Jiu Jitsu, Judo, Filipino Martial Arts, and many others. Wing Chun Kuen Kung Fu Tong 605-490-8338 • wckkft@live.com Learn authentic traditional Wing Chun Kuen Kung Fu Tong. Students are 16+ and must pass a pre-screening interview before acceptance. Lessons are taught as fast as students can learn. Serious applicants only.

massage A Quiet Place N7654 690th St., Menomonie • 2357182 • Therapeutic massage-neuromuscular, deep tissue, trigger-point, and relaxation. A Time to Heal Massage 822 S. Hastings Way, Eau Claire • 497-0015 • timetohealmassage@hotmail.com • timetoheal.massagetherapy.com Therapeutic Massage and a relaxing experience. Swedish and amma therapy techniques applied. Advanced Massage Therapies 829 W. Clairemont

Ave., Eau Claire • 833-3505 • advancedmassagetherapiesonline.com Offers deep tissue, Swedish, hot stone, cupping, sports, pregnancy, medical therapy, and Ashiatsu massage.

All About You Massage 405 S. Farwell St., #3, Eau

Claire • 830-0777 • Offering deep tissue, Swedish, and basic relaxation massage; as well as trigger point therapy and foot massages.

For even more reso urces and artic les VolumeO , visit ne.org / Health

310 Main Street E., Menomonie • 271-7717 • scott22robinson@ yahoo.com Instruction for amateurs and children, and training for professional fighters. Focus on cardio work, discipline, and basic fundamentals. Offers kickboxing and mixed martial arts as well. Members compete in local shows.

Clear Water Martial Arts 20 W. Spring St., Chippewa Falls • 723-3321 • clearwaterma.com Offering private and group Karate, Judo, Jujitsu, and Tai Chi instruction to all ages. Karate American is there two days a week. Elite Karate 410 Bay Street, Chippewa Falls • 720-

9218 • jasondutton@elitekarate.cmasdirect.com • elitekaratestudios.com Karate instruction in both private and group settings focusing on the three core values of honor, discipline, and respect.

Healing Choices Oasis LLC 2711 Pleasant St. Suite

1E, Eau Claire • 852-0303 • healingchoices@sbcglobal.net • healingchoicesec.com Classes offered in Tai Chi and AMMA massage, four days a week. Also offers hot stone massage and AMMA Therapy, and has a complete line of nutritional supplements available.

Ju’s Taekwondo Karate Academy 415 S. Farwell St., Eau Claire • 834-5766 • justaekwondo.com Taekwondo classes in both private and group settings. Classes target self-defense, weight control, physical and mental fitness, improved coordination and agility. Karate American 2228 North Hillcrest Parkway, Al-

toona // 100 N. Bridge St., Chippewa Falls // W201 Menomonie St., Elk Mound // Osseo Fitness Center, 56900 Francis St., Osseo // 25952 E Mondovi St., Eleva // Augusta High School, E19320 Bartig Road, Augusta • 832-6488 • info@karate-american.com • karate-american.com Karate instruction for all ages in both private and group settings. Lessons in Karate, Taekwondo, Judo, and Aikido are available.

Menomonie Goju-Ryu Karate 1807 Wilson St. # A,

Menomonie • 233-9927 • menomoniegoju@hotmail. com • menomoniegoju.com Okinawan style Karate instruction in both private and group settings.

One Tree Martial Arts 2015 Fairfax St., Eau Claire

• 514-0656 • info@otma.net • onetreemartialarts.com Martial arts instruction for all ages in Taekwondo,

VolumeOne.org 34 Jan. 31, 2013

Body Focus Massage 705 S.

Barstow St., Eau Claire • 835-8898 • bodyfocusreceptionist@gmail. com • bodyfocusonline.com Offers shiasu, pregnancy, Thai, couples, deep tissue, bamboo, reflexology, cupping, raindrop, Reiki, personal injury, and workman’s comp massages.

Body Health with Roseann 3301 Golf Rd., Ste. 102, Eau Claire // 2889 Cty Hwy I, Ste. 2, Chippewa Falls • 878-9049 • rcbodyhealth.com Licensed massag therapist featuring Swedish massage, individual/corporate chair massage, deep tissue, hot stone, lymphatic, geriatric, prenatal, sports massage, and pain control management. Call for an appointment. Bravo! Salon and Spa LLC 1120 122nd St. Suite S • 552-3200 • bravosalonspa.com Hair care, massage therapy, nails, pedicures, and facials. Bridal and wedding party specials available. Calista 840 Water St., Eau Claire • 832-4001 • calistaonwater.com This salon also offers Swedish, deep tissue, hot stone, and prenatal massage.

Chippewa Valley Physical Therapy 116 N Bridge St.,

Chippewa Falls • 726-1010 • cvptdeb@sbcglobal.net • chippewavalleypt.com Offering massage and bodywork, therapeutic massage, Swedish massage, deep tissue massage, and physical therapy targeting headaches, neck, back and shoulder pain.

Clemona Massage and Day Spa The CORE, 424

Main Street, Menomonie • (920) 853-6668 • clemonaspa@gmail.com • clemona.com Individual bridal services, group wedding party spa services, and mobile on-site services available. Office located in Menomonie, but mobile throughout many areas of Wisconsin and Minnesota.

DaVinci Therapeutic Massage 4714B Commerce

Valley Rd., Eau Claire • 379-1922 • davincimassage. com At DaVinci Therapeutic Massage, we treat each person as a work of art and tailor each session to your individual needs. Whether you are looking to reduce stress, reduce pain, or are recovering from an injury – we are here to help you achieve your goals through therapeutic massage.

Eau Claire Massage 316 N Barstow St. Suite G, Eau Claire • 225-8018 • EauClaireMassage@gmail.com • EauClaireMassage.com Offers deep tissue, relaxation, trigger point therapy, chair, hot stone, couples, and onsite massages. Relief for headache, neck and shoulder


BROUGHT TO YOU IN PART BY

pain, low back pain, sciatica, and overall stress.

Elements for Healthcare 431 E Clairemont Ave, Suite

St., Eau Claire • 834-8867 • Offers therapeutic massage, for neuromuscular therapy and myofascial release, as well as integrative movement (inner-guided dance).

Emerald Isle Massage 3461 London Rd., Eau Claire

Sans Souci Massage 927 Loring St., Suite 4, Altoona • 830-9890 • sanssoucimassage.com Offering Swedish, hot stone, integrative, trigger point, craniosacral, ashiatsu, prenatal, and Thai Yoga massage. As well as polarity therapy, Reiki, and body treatments.

2A, Eau Claire • 832-2005 • barbara0941@sbcglobal. net • elementsforhealthcare.com Offers services such as TCM acupuncture, therapeutic massage, and strategies to reduce stress. • 831-7050 • See contact info for details.

Essential Massage Therapy Center 2519 North

Hillcrest Pkwy Suite 102, Altoona • (888) 213-0820 • essentialmassagetherapy.com Offers Swedish, deep tissue, hot stone, chair, prenatal, couples, sports, Fourhand, neuromuscular, and Thai yoga massages.

Gordon Green LMT: Massage Therapy 515 South

Barstow St #112A, Eau Claire • 533-5020 • gordongreenlmt@gmail.com • gordongreenlmt.com Specializing in Myofascial Release, Deep Tissue, PNF, Swedish, Trigger Point Therapy, and Sports Massage. Other Services include: Pregnancy Massage, Workshops, Outcalls, Chair Events, and Yoga.

Harmony Healing Center 2519 N. Hillcrest Pkwy, Eau

Stucky Chiropractic Center 2105 East Clairemont

Ave., Eau Claire • 955-4006 • Stucky@StuckyChiropractic.com • stuckychiropractic.com Featuring therapeutic massage, prenatal massage, lymphatic drainage, Thai massage, reflexology, and hot stone massage.

The Lotus Spa 4956 Bullis Farm Road, Eau Claire

• 835-1100 • lotusspaeauclaire.com Relaxation, sport, or deep tissue massages available. Also offering aromatherapy scalp massages, maternity massage, and hot stone treatments. Relaxation facials, pedicures, and hydrotherapy tubs.

Claire • 835-1421 • 2519 N. Hillcrest Pkwy, Ste. 102, Altoona • harmonyhealingcenter.net Offers Swedish, deep tissue, hot stone, trigger point, chair, prenatal, sports, and AMMA massage; as well as reflexology and neuromuscular therapy.

Healing Arts Center 710 4th St. E, Menomonie • 235-7711 • bubishi.com A school for massage therapy and Asian bodywork therapy. Specializing in AMMA Therapy, which is concerned with the balance and movement of life energy in the human body. Healing Choices Oasis LLC 2711 Pleasant St. Suite

1E, Eau Claire • 852-0303 • healingchoices@sbcglobal.net • healingchoicesec.com Classes offered in Tai Chi and AMMA massage, four days a week. Also offers hot stone massage and AMMA Therapy, and has a complete line of nutritional supplements available.

Life Fitness Center 312 Bridge St., Chippewa Falls

• 723-3800 • lifefitnesscenterofchippewa@gmail.com Offering personal training, yoga, pilates, tanning, nutrition and massage, plus a variety of group fitness classes and one-on-one classes.

Life Massage by Becka 800 Wisconsin Street, Bldg D02, Ste. 313, Eau Claire • 492-3166 • lifemassagebybecka.com Featuring couples massage, weekly maintenance, deep tissue, hot rocks, Swedish massage, pregnancy massage, chair massage, and more by Rebecca Peterson.

London Massage 2412 London Rd., Eau Claire • 8321010 • eauclairelondonmassage@yahoo.com Escape to London Massage for the perfect balance between a beneficial, therapeutic treatment and the ultimate stress free, relaxation experience. Find us on Facebook. Mayo Clinic Health System 1221 Whipple St., Eau

Claire // 2321 Stout Rd. Menomonie • 838-6767, 2355531 • mayoclinichealthsystem.org Our licensed massage therapists have training in traditional massage, myofascial release and other massage styles.

Mission Accomplished S4530 Porterville Rd., Eau

Claire • 831-0909 • kim@kimayres.com • missionaccomplishedstudio.com Mission Accomplished offers counseling, classes in yoga and a crossbreed called yogilates, massages in the style of Swedish, office chair, deep tissue, sports and prenatal. Plus, personal training for brides, golfers, boxers, bodybuilding and in-home.

Nicole’s Inc. 303 S. Barstow St., Eau Claire • 8353510 • nicolesinc.com Certified massage therapists will feature essential oil blends, and hot stone options to relieve mind and body. Nirvana Massage 2403 London Rd., Eau Claire •

864-1851 • massageeauclaire.com Nirvana Massage Therapy provides licenses massage services. Robin Gaulrapp, a certified and licensed massage therapist, specializes in Swedish, deep tissue, and prenatal massage. Come to us for a relaxing experience that is as close as you can get to reaching true nirvana. By appointment only.

Optimum Therapies, LLC 517 E. Clairemont Ave.,

Eau Claire • 855-0408 • optimumtherapies.com Offering deep tissue, trigger point release, myofascial release, neuromuscular, sports, Swedish, and hot stone massage and physical therapy.

Optimum Therapies, LLC 1309 Stout Rd., Menomonie

• 233-6320 • optimumtherapies.com Offering deep tissue, trigger point release, myofascial release, neuromuscular, sports, Swedish, and hot stone massage and physical therapy.

Path to Health Massage Therapy and Wellness 316 N. Barstow St. Suite G, Eau Claire • 225-0461 • pathtohealthmassage.com Offering Swedish, aromatherapy, hot stone, reflexology, prenatal, sports, deep tissue, Reiki, and AMMA massage. Poppy Moelter, Massage Therapist 820 Chauncey VolumeOne.org 35 Jan. 31, 2013


VolumeOne.org 36 Jan. 31, 2013


THE BIG BEAUTIFUL

An yti me Bo Fit dy ne At wo ss hle rk tic s Ch Clu ipp Fa ew b mi ly a Va YM lle Cu CA y rv es Ea uC lai re Fit Y EL ITE MCA Go ld’ sG ym Hi gh lan dF Lif itn eF e itn ess ss Ne w Ce Im nt a er UW ge P AC Fit Sto E ne ut ss Sp Ce or UW n t E Sp C R ter & or e c t F re ac at i Sn ili on ap tie & Fit s ne Wi ss sso 24 ta -7 Fit ne ss

BROUGHT TO YOU IN PART BY

GYM GRID find contact info in the listings on the previous pages

Free weights Machines Personal training Classes Strength & endurance Body sculpting Cardio Pilates Yoga Circuit Spinning Dance Specialty Sports Basketball Volleyball Racquetball Tennis Swimming Track Massage Nutritional counseling Beverage bar Tanning Kids’ services Pro shop Spa / Sauna Open 24 hours

= Menomonie location only

= Eastridge location only

= except Menomonie location

= except Eastridge location

VolumeOne.org 37 Jan. 31, 2013

= Chippewa Falls location only


BROUGHT TO YOU IN PART BY

The Fit List CONT’D Wissota Fitness Tanning & Massage 16850 Cty.

Hwy. X Suite 2, Chippewa Falls • 723-7006 • wissotafitness@clearwire.net • wissotafitness.com Free weights and machines. Track, massage, tanning, spa, and open 24 hours.

medical spas Denovo Medspa 745 Kenney Ave., Eau Claire • 835-

2285 • info@denovomedspa.com • denovomedspa. com A visit to Denovo Medspa will provide you with the knowledge you need to preserve your natural beauty. Feel free to contact us learn more about our staff, products and services. Schedule your consultation and begin looking and feeling more beautiful today.

Enza Medispa 3221 Stein Blvd., Eau Claire • 832-

1774 • info@enza.com • enza.com Enza Medispa is a medical spa specializing in skin care with highly experienced aesthetic professionals who customize treatment for incredible results. Enza offers microdermabrasions, customized chemical peels, laser treatment, hair removal, facials, Botox, dermal fillers, and Latisse.

nutrition All Natural Wellness, LLC. 2415 Boardwalk Cir., #1,

Eau Claire • 864-4970 • SkinnyACE.com All Natural Wellness, LLC. supplies beverages and supplements for a wide variety of customers.

Just Six • JustSix.com A nutritional service provided

by a licensed dietitian that involves creating nutritious meal and snack plans, and tracking your habits and relationships with food.

M’lis inside Rochelle’s Salon & Spa, 2736 Mall Dr., Eau Claire • 570-3084 • Mlis.com Among Wellness Consultant Terre Retzlaff’s services is nutrition/ weight management.

Mission Accomplished S4530 Porterville Rd., Eau Claire • 831-0909 • kim@kimayres.com • missionac-

complishedstudio.com Mission Accomplished offers counseling, classes in yoga and a crossbreed called yogilates, massages in the style of Swedish, office chair, deep tissue, sports and prenatal. Plus, personal training for brides, golfers, boxers, bodybuilding and in-home.

Mother Nature’s Food 2434 London Rd, Eau Claire • 834 - 2341 • mothernaturesfood.net Mother Nature’s Food is provides quality fresh, natural, organic and whole foods, nutritional products, body care products and health information in a fun comfortable clean, safe environment. Optima Health & Vitality Center 3321 Gold Road, Ste. A, Eau Claire • 832-1953 • optimahvc.com A chiropractic practice that also offers nutritional counseling and naturopathic services. Physician’s Weight Loss Center 2839 Mall Dr., Eau Claire • 830-9355 • pwlc.com PWLC have nearly a quarter century of experience working to help people lose excess weight. They feature effective weight loss systems, personalized consultations and reviews, and have developed 150 specialized food, nutrition and weight loss products. Sioux Creek Wellness 386 22 1/2 St., Chetek • 642 - 3360 • tammy@siouxcreekwellness.org • siouxcreekwellness.org Certified Health Educator Coach Tammy Schwartz does nutrition education and Juice Plus (a whole food program) on site or comes to you. Tammy also does classes twice a week for varied levels.

personal care Aging & Disability Resource Center 721 Oxford

Ave., Eau Claire • 839-4735, 1-888-338-4636 • adrc@co.eau-claire.wi.us • co.eau-claire.wi.us The ADRC aims to help people fine info to access community resources and services to people ages 60+, adults with disabilities, and their families and caregivers regardless of income. Personal assistance is available at hte center, over the phone, or at requested in-house visits.

Ava Anderson Non-Toxic • 877-2043, 210-9707 • sarahnontoxic@yahoo.com • avaandersonnontoxic.

com Ava Anderson Non-Toxic are committed to an important mission of educating consumers about the health risks, doing business with industry consultants, and providing clients with non-toxic personal care products. Sarah Steinke is a non-toxic skin care consultant.

PERSONAL TRAINING Anytime Fitness 2532 Golf Rd., Eau Claire • 831-8600 • anytimefitness. com A membership gets you unlimited, on-your-own access to a wide array of exercise machinery and free weights. Personal training, tanning, nutritional counseling. Open 24 hours, pay as you go plans available. Benji Williford – Chain Reaction Fitness 126 Graham Ave., Eau

Lifetime Health Coaching 800 Wisconsin St., Build-

ing D02, Ste 405E, Eau Claire • 495-7923 • Find us on Facebook What could be different in your life a year from now? Maybe you want to exercise consistently, reduce chronic pain, improve your nutrition, lower your blood sugar, become tobacco-free, or enhance your quality of life. Lifetime Health Coaching can help you realize your dreams.

For even more reso urces and artic les, visit VolumeO ne.org / Health

Claire • 379-4249 • Benji@chainreaction-fitness.com • benjiwilliford.com Boot camps, TRX suspension training, and personal training from a certified fitness, yoga, Pilates, and TRX trainer.

Capture Life, LLC • 829-2761 • jessica@capturelifellc.com • capturelifewellness.com Capture Life offers individual and small group fitness training, workshops, and yoga classes. Creative Fitness • 379-0304 • imsumthing@yahoo. com • creativefitnessec.com Offers classes, life coaching, and personal training (everything from fitness and nutrition to stress management, meditation, and holistic practices). Evolve Wellness, LLC 412 1/2 Water St., Eau

Claire • 864-7000 • cheri@livewellevolve.com • livewellevolve.com Cheri Dostal, Founder and CPT of Evolve Wellness LLC is a NASM certified personal trainer and offers offers personal training services as well as customized group workshops. Complimentary consultation available upon request. Private lessons available.

Life Fitness Center 312 Bridge St., Chippewa Falls

• 723-3800 • lifefitnesscenterofchippewa@gmail.com Offering personal training, yoga, pilates, tanning, nutrition and massage, plus a variety of group fitness

VolumeOne.org 38 Jan. 31, 2013

classes and one-on-one classes.

Mission Accomplished S4530 Por-

terville Rd., Eau Claire • 831-0909 • kim@kimayres.com • missionaccomplishedstudio.com Mission Accomplished offers counseling, classes in yoga and a crossbreed called yogilates, massages in the style of Swedish, office chair, deep tissue, sports and prenatal. Plus, personal training for brides, golfers, boxers, bodybuilding and in-home.

Momentum SportFitness, LLC 2615 London Road Suite B, Eau Claire • 9554319 • getmo@momentumsport.com • momentumsport.com Training people for high performance in athletics, recreation, or an active lifestyle. The Momentum University individual or group training package emphasizes training techniques and program implementation. Membership options available as well as additional individual or group personal training. Quantum Health & Wellness 817 Chauncey St., Eau Claire • 456-6734 • DrLynnThompson.com Dr. Lynn Thompson specializes in stress reduction, pain management, and weight loss.

physical therapy B Natural 2421 E Clairemont Ave, Eau Claire • 8367021 • bnaturalwi.com Dr. Amy Emch practices immuno-therapy and offers services such as health & nutrition consultations, reflexology, chi machine therapy, and infra red therapy. Back on Track Family Chiropractic 2751 Commercial Blvd. Suite 4, Chippewa Falls • 720-1800 • info@backontrackfamily.com • backontrackfamily.com Back on Track is part of the Maximized Living network of Chiropractors nationwide who are on a mission to change


BROUGHT TO YOU IN PART BY

the way healthcare is viewed and delivered. We have up to date techniques and education, plus the passion the staff has to help others is inspiring.

Chippewa Valley Physical Therapy 116 N Bridge St.,

Chippewa Falls • 726-1010 • cvptdeb@sbcglobal.net • chippewavalleypt.com Offering massage and bodywork, therapeutic massage, Swedish massage, deep tissue massage, and physical therapy targeting headaches, neck, back and shoulder pain.

Hayden Integration 815 Main St. E, Menomonie • (608)

630-0664 • haydenintegration@gmail.com • haydenintegration.com Chris Hayden is a certified Rolfer, a method of structural integration that involves balancing a person’s tissue structure to release constrictions (from injuries, overuse, posture, etc.) and bring relief to your body.

Kromrey Chiropractic 500 S. Main St., Cadott • 289-

5000 • dockfixspine@centurytel.net • kromreychiro. com Unlike conventional medicine, which focuses on attempting to treat disease once it occurs, Kromrey Chiropractic S.C. emphasizes improving your health in an effort to reduce the risk of pain and illness in the first place.

Thompson specializes in stress reduction, pain management, and weight loss.

Radiant Living Yoga & Ayurveda, LLC The Center for Healing Arts, 2722 London Rd., Eau Claire • 529-3061 • patricia.wickman@gmail.com • rlyaa.com Services include private and small–group yoga lessons, Ayurvedic consultations and Ayurvedic Spa therapies.

wellness centers Angel Care Healing Touch 2436 Lynn Ave, Altoona • 832-7250 • contact@angelcarehealingtouch.com • angelcarehealingtouch.com Judy Meinen is a healing touch practitioner, reiki master, certified angel therapy practitioner, and certified hypnotherapist. Provides energetic biofeedback and presentations, workshops, and reiki classes. Chippewa County Aging and Disability Resource Center 711 N Bridge Street Room 118, Chippewa Falls •

726-7777 • ADRC@co.chippewa.wi.us This resource center offers the public a single entry point for informa-

tion and assistance on issues affecting older people, and people with disabilities regardless of their income. Welcoming and convenient places for you and your family to get information, advice, and access to a wide variety of wellness services.

Chippewa Valley Family Wellness • 507-313-1705 • Renee@chippewavalleyfamilywellness.com • chippewavalleyfamilywellness.com Chippewa Valley Family Wellness is here to provide families in the valley with a new tool to provide healthy living in your family. We plan family related events to get people involved in enjoying the community and meeting others. We provide in-home family nutrition and fitness coaching by appointment. See our website for upcoming events. Chippewa Valley Wellness & Chippewa Falls Chiropractic 4751 Cty Hwy J, Chippewa Falls & 2228

N. Hillcrest Parkway, Suit • CF: 723-2713; Atoona: 514-1168 • cvwellness.net Chippewa Valley Wellness aims to help as many people as possible through uppercervical chiropractic care, nutrition response testing, education. Their clients attain maximum health benefits through comining nutrition response testing with per-

McMahon Chiropractic and Physical Therapy 3004 Golf Rd Suite 100, Eau Claire • 834-4516 • mcmahonchiroandpt.com Specializing in chiropractic and physical therapy work. Northwoods Therapy 4210 Southtowne Dr., Eau

Claire; and 757 Lakeland Dr., Chippewa Falls • 8399266 • pwnorthwoods@yahoo.com • northwoodstherapy.com In business or over 30 years, Northwoods Therapy is owned and operated by local physical therapists specializing in sports and orthopedic rehabilitation.

Optimum Therapies, LLC 1309 Stout Rd., Menomonie • 233-6320 • optimumtherapies.com Offering deep tissue, trigger point release, myofascial release, neuromuscular, sports, Swedish, and hot stone massage and physical therapy. Optimum Therapies, LLC 517 E. Clairemont Ave., Eau Claire • 855-0408 • optimumtherapies.com Offering deep tissue, trigger point release, myofascial release, neuromuscular, sports, Swedish, and hot stone massage and physical therapy. Radiant Health Chiropractic 534 Water St., Eau Claire

• 838-9432 • radianthealthchiro.com Delivering quality chiropractic care to the Eau Claire community since 2004.

Wissota Chiropractic 17191 County Hwy X, Chippewa Falls • 723-3333 • wissotachiro.com Wissota Chiropractic provides a state-of-the-art facility for quality chiropractic care.

spiritual wellness A-Ok Stress-Release MDs Prefer • 379-4901 • enjoy-

humanbeing@yahoo.com Offering transcendental meditation (or TM) stress-release, meditation techniques. The certified instructor will come to you, or invite you to his home, in an individual or group setting for a fourday class. Christian independent teacher stream-lined technique without Hinduism eastern religious program.

Audrey Van Wey Reiki • 720-1055 • Reiki is an energy-

balancing and de-stressing technique originating in Japan. It draws on various Oriental traditions including hand healing, energy cultivation, martial arts, Shintoism and mystical Buddhism.

Colors of Joy Healing Arts Center 405 S. Farwell St., Ste 2-A, Eau Claire • 805-909-9674 • colorsofjoy@ msn.com • jeankowalski.com Colors of Joy is here to assist your awakening and reclaiming love, light, health, freedom, creativity, sacredness, spirituality and your strength to stand with grace. Colors of Joy is about laughter, empowerment, inspiration, joy, happiness, healing, support and sharing. Colors of Joy is about finding the juicyness in Life. I am here to assist you with all your healing needs - physically, mentally, emotionally and spiritually.

Heaven Sent Healing 3548 Cypress St., Eau Claire •

833-1096 • geiglej@yahoo.com • heavensenthealing.us Julie works as a Spiritual Teacher, empowering people to live more mindfully. She specializes in healing relationships: with others, with self, with spirit.

Holistic RX by Jody Hagedorn 3529 Starr Ave., Eau

Claire • 834-0883 • hagedorn5@msn.com Enjoy a variety of holistic services including access consciousness, reflexology, reiki, EFT, body talk access, metamorphosis, and de-cluttering. Available for indivudal, couple and family sessions, group presentations, and motivational speaking.

Martha Nieman Life Coaching • 577-9335 • Martha

provides clients the capacity t explore values, life purpose, hopes, dreams; to recognize strengths, resources, and barriers; to identify goals, ways of being and actions for change that will maximize one’s personal potential and quality of life.

Quantum Health & Wellness 817 Chauncey St., Eau Claire • 456-6734 • DrLynnThompson.com Dr. Lynn VolumeOne.org 39 Jan. 31, 2013


BROUGHT TO YOU IN PART BY

sonalized, clinically-designed nutrition.

Holistic Therapy, LLC 1440 Badger Ave, Eau Claire •

379-5331 • holistictherapyllc.com Ann Recine provides integrative therapies for people with chronic medical and psychiatric illnesses.

Medifast 4112 Oakwood Hills Parkway, Eau Claire • 718-4925 • eauclaire@mymedifast.net Medifast Weight Control Centers deliver healthy, lasting weight loss results.

Patterson Chiropractic 836 Richard Dr., Eau Claire • 831-9950 •

Radiant Living Yoga & Ayurveda, LLC The Center for

Healing Arts, 2722 London Rd., Eau Claire • 529-3061 • patricia.wickman@gmail.com • rlyaa.com Services include private and small–group yoga lessons, Ayurvedic consultations and Ayurvedic Spa therapies.

ReJuv Wellness • 563-2370 • rejuvwellness.blogspot.

com Offers fitness events (boot camps), seminars, nutritional counseling, and classes. Locations vary.

Tao Arts 1215 Gilbert Creek Rd, Menomonie • 231-

3060 • Sensei Leland is known for his alternative and traditional Chinese approaches to medicine, including acupuncture, use of herbs, and tuina massage.

yoga, pilates, & more AnandaWorks Various locations • (952) 356-5640 •

christine.varnavas@anandaworks.com • anandaworks. com Christine Varnavas has taught wellness classes for over twenty years with training in yoga, spinning, and exercise. Her classes are designed for beginners to advanced practitioners.

Benji Williford – Chain Reaction Fitness 126 Graham

Ave., Eau Claire • 379-4249 • Benji@chainreactionfitness.com • benjiwilliford.com Boot camps, TRX suspension training, and personal training from a certified fitness, yoga, Pilates, and TRX trainer.

Capture Life, LLC • 829-2761 • jessica@capturelifellc.

com • capturelifewellness.com Capture Life offers individual and small group fitness training, workshops, and yoga classes.

Evolve Wellness, LLC 412 1/2 Water St., Eau Claire •

864-7000 • cheri@livewellevolve.com • livewellevolve. com Cheri Dostal, Founder and CPT of Evolve Wellness LLC is a NASM certified personal trainer and offers offers personal training services as well as customized group workshops. Complimentary consultation available upon request. Private lessons available.

Gordon Green LMT: Massage Therapy 515 South

Barstow St #112A, Eau Claire • 533-5020 • gordongreenlmt@gmail.com • gordongreenlmt.com Specializing in Myofascial Release, Deep Tissue, PNF, Swedish, Trigger Point Therapy, and Sports Massage. Other Services include: Pregnancy Massage, Workshops, Outcalls, Chair Events, and Yoga.

Life Fitness Center 312 Bridge St., Chippewa Falls •

723-3800 • lifefitnesscenterofchippewa@gmail.com Offering personal training, yoga, pilates, tanning, nutrition and massage, plus a variety of group fitness classes and one-on-one classes.

Mission Accomplished S4530 Porterville Rd., Eau

Claire • 831-0909 • kim@kimayres.com • missionaccomplishedstudio.com Mission Accomplished offers counseling, classes in yoga and a crossbreed called yogilates, massages in the style of Swedish, office chair, deep tissue, sports and prenatal. Plus, personal training for brides, golfers, boxers, bodybuilding and in-home.

New Day Yoga • 703-9176 • newdayyogawellness.com

Find a refreshing perspective on yoga that’s more accessible than traditional at New Day Yoga. They offer a wide variety of classes taught by experienced certified yoga instructors who love what they do.

Pilates by Penny 6108 Aspen Ridge Dr., Eau Claire •

296-0836 • pilatesbypenny@gmail.com Penny Crochiere is an STOTT and Master Certified Pilates Teacher who has been teaching for 13 years. She runs a fullyequipped studio out of her home, offering private, semiprivate, and small group classes.

Pilates, Yoga, and Beyond 4913 River Glen Ct., Eau Claire • 832-7335 • sheri@baemmert.com • baemmert. com Private sessions and group classes in Pilates, yoga, Thai yoga bodywork, belly dancing and more.

Radiant Living Yoga & Ayurveda, LLC The Center for Healing Arts, 2722 London Rd., Eau Claire • 529-3061

• patricia.wickman@gmail.com • rlyaa.com Services include private and small–group yoga lessons, Ayurvedic consultations and Ayurvedic Spa therapies.

Sioux Creek Wellness 386 22 1/2 St., Chetek • 642 -

3360 • tammy@siouxcreekwellness.org • siouxcreekwellness.org Certified Health Educator Coach Tammy Schwartz does nutrition education and Juice Plus (a whole food program) on site or comes to you. Tammy also does classes twice a week for varied levels.

Sofia Spirit Studio 2131 Fenwick Ave., Eau Claire • 379-6304 • sofiatribal@gmail.com • sofiatribal.com SofiaSpirit is a dance and movement studio offering classes in belly dance, yoga, fitness, and creative and expressive dance. The studio houses a small boutique and resource center offering belly dance textiles, jewelry, media, and accessories. Check website for current class listing.

Highland Fitness Center 2405 Folsom Street, Suite

A, Eau Claire • 833-2100 • highlandfitness.com WestRidge Center offers over 20 cardiovascular machines, free weights, and a Life Fitness strength circuit. Open 24 hours.

For even more reso urces and artic les VolumeO , visit ne.org / Health

The Yoga Center of Eau Claire 412 1/2

Water St., Eau Claire • 830-0321 • yoga@ infinitejoy.com • yogacenterec.com Featuring classes, workshops, private lessons and special events.

ZUMBA Bodyworks Athletic Club, LLC 3019 Schneider Ave East, Menomonie • 235-6106 • bodyworksmenomonie.com Personal training, free weights, and machines. Classes in strength/endurance, body sculpting, cardio, yoga, pilates, circuit, zumba, and spinning. Saunas, tanning, nutritional counseling, and open 24 hours. Eau Claire School of Dance 306 Main St., Eau

Claire • 832-9900 • ecschoolofdance@aol.com • eauclaireschoolofdance.com Offering classes in ballet, lyrical, tap, hip hop, pointe, and technique.

Highland Fitness Center 2221 Eastridge Ctr., Eau

VolumeOne.org 40 Jan. 31, 2013

Claire • 833-2100 • highlandfitness.com EastRidge offers four group fitness studios, over 60 cardiovascular machines, free weights, and multiple strength circuits. They feature a “swim gym” for those looking for a water-based work out, a hot-tub and sauna for post-workout aches.

Highland Fitness Center 3022

Commercial Blvd., Chippewa Falls • 833-2100 • highlandfitness.com Lake Hallie Highland fitness features group fitness classes, brand-new state of the art treadmills, free weights and multiple strength circuits. Open 24 hours.

New Image PACE Fitness 13384 49th Ave., Chippewa Falls • 7207722 • newimagepacefitness@yahoo. com • newimagepacefitness.com This allages gym employs the Progressive Aerobic Circuit Exercise system, which uses unique hydraulic resistance machines. Dance, circuit, and strength/endurance classes, plus nutritional counseling. Sofia Spirit Studio 2131 Fenwick Ave., Eau Claire • (715) 379-6304 • sofiatribal@gmail.com • sofiatribal.com SofiaSpirit is a dance and movement studio offering classes in belly dance, yoga, fitness, and creative and expressive dance. The studio houses a small boutique and resource center offering belly dance textiles, jewelry, media, and accessories. Check website for current class listing.


VolumeOne.org 41 Jan. 31, 2013


Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.