Graduation Ceremony
Date: 10 July 2024
Time: 09:30
Venue: The Great Hall
A MESSAGE TO GRADUATES FROM THE CHANCELLOR
CONGRATULATIONS! HALALA! GO LEAD SOUTH AFRICA TO GREATNESS!
A hearty congratulations to the class of 2024! Some of you entered university as the world sank into a global pandemic, COVID-19; some were already pursuing their studies at this world class university, the University of the Witwatersrand. We applaud you for strength of character, grit, and commitment to success.
Our country continues to experience a plethora of challenges that threaten our economic stability and social cohesion, further deepening inequality and hopelessness. It is in this century that, as one of the member states of the UN that approved the 2030 Agenda for Sustainable Development, we intend to eradicate inequality, achieve peace, prosperity, and dignity for all, through partnerships while preserving the planet for future generations. We cannot achieve these lofty ambitions without your wisdom and servant leadership as you embark on your careers.
Your hard work and dedication to achieve your dreams is a true reflection of your resilience and commitment. It is this resilience that makes us confident that you have what it takes to build a better future that is equal and just. History has proven time and again that it is the weakest amongst us that determine our strength as a nation. The highly educated have the responsibility to enlighten and fight for social justice for the marginalised, for the good of humankind.
As you venture into the world, take time to expand the depth and breath of your knowledge. Read outside your specialisation, engage with people outside your comfort zone. Be lifelong learners. Understand the plight of people less fortunate than yourself. Leaders who leave footprints worth emulating, are not only the brightest but also those who take time to learn from others, who are accountable for their actions and omissions, who use what they know and what they have, to make the world a better place. Leaders who care! Those leaders do this consistently with Integrity. May you be those leaders!
CONGRATULATIONS! HALALA! GO LEAD SOUTH AFRICA TO GREATNESS!
Dr Judy Dlamini Chancellor Wits University
A MESSAGE TO GRADUATES FROM THE VICE-CHANCELLOR
AND PRINCIPAL
Dear Wits Graduate,
Congratulations on successfully completing your academic programme at the University of the Witwatersrand, the premier University on the continent.
You are now a member of an elite group of graduates of this august institution. More than 200 000 alumni at the cutting edge of excellence, both locally and internationally in business, the public sector, the academy, and in civil society have trodden this path.
Today, you become a member of this illustrious community. Over the past 100 years, Wits has grown into one of the leading universities on the continent and a globally respected institution for its teaching and learning, knowledge creation and generation, and social impact. It has shaped the lives of many and changed society for good. You are now an integral part of this proud and enduring legacy. Here at Wits, we actively pursue excellence and societal relevance in everything we do. From the abstract to the practical, our focus is on creating a space for the best thought, knowledge, and expertise to be unearthed and nurtured. Wits is renowned for its intellectual leadership and for nurturing critical thinkers, creative innovators, problem-posers, and problem solvers. We have strived to match your ambition and drive to overcome the challenges thrown our way by the pandemic. Together we have reached the crest of the hill and proven, once again that excellence is achievable, even in times of uncertainty and adversity.
Your success has furthered our commitment to equipping the next generation of leaders with the skills and determination that you will need to find innovative and sustainable solutions to the pressing problems of the 21st Century.
As a Wits graduate, you had access to an exceptional educational experience. You have been exposed to a world-class academic and research programme and a vibrant community that makes you a true global citizen. You have been part of an institution that generates cutting-edge knowledge and innovation for South Africa and the world. It is now time for you to step into the world and use that experience, for good. We know that you will enter the next stage of your journey with the determination to build a better society tomorrow. I want to encourage you to remain a part of the Wits family by participating in our alumni programme and by further advancing the reputation of your alma mater.
Best wishes for the next steps of your journey and congratulations on being such a big part of the history of this illustrious institution.
Professor Zeblon Vilakazi, FRS Vice-Chancellor and Principal Wits University
Gaudeamus igitur
Juvenes dum sumus
GAUDEAMUS
Post jucundum juventutem
Post molestam senectutem
Nos habebit humus.
Ubi sunt qui ante nos
In mundo fuere?
Vadite ad superos
Transite in inferos
Hos si vis videre.
Vita nostra brevis est Brevi finietur.
Venit mors velociter
Rapit nos atrociter
Nemini parcetur.
Vivat academia
Vivant professores
Vivat membrum quodlibet
Vivat membra quaelibet
Semper sint in flore.
Vivant omnes virgines
Faciles, formosae.
Vivant et mulieres
Tenerae amabiles
Bonae laboriosae.
Vivant et republica et qui illam regit.
Vivat nostra civitas, Maecenatum caritas
Quae nos hic protegit.
Pereat tristitia, Pereant osores.
Pereat diabolus, Quivis antiburschius
Atque irrisores.
Let us rejoice therefore
While we are young.
After a pleasant youth
After a troublesome old age
The earth will have us.
Where are they
Who were in the world before us?
You may cross over to heaven
You may go to hell If you wish to see them.
Our life is brief
It will be finished shortly.
Death comes quickly Atrociously, it snatches us away. No one is spared.
Long live the academy!
Long live the teachers!
Long live each male student!
Long live each female student!
May they always flourish!
Long live all maidens
Easy and beautiful!
Long live mature women also,
Tender and loveable
And full of good labor.
Long live the State
And the One who rules it!
Long live our City
And the charity of benefactors
Which protects us here!
Let sadness perish!
Let haters perish!
Let the devil perish!
Let whoever is against our school
Who laughs at it, perish!
NATIONAL ANTHEM
Nkosi sikelel’ iAfrika
Maluphakanyisw’ uphondo lwayo,
Yizwa imithandazo yethu, Nkosi sikelela
Thina lusapho lwayo.
Morena boloka setjhaba sa heso, O fedise dintwa le matshwenyeho, O se boloke, O se boloke setjhaba sa heso, Setjhaba sa, South Afrika — South Afrika.
Uit die blou van onse hemel, Uit die diepte van ons see, Oor ons ewige gebergtes, Waar die kranse antwoord gee,
Sounds the call to come together, And united we shall stand, Let us live and strive for freedom In South Africa our land.
The Wits Choir
The Wits Choir has been around since 1995. Their repertoire is colourful and vibrant. They perform regularly at graduations and important ceremonies. The Wits Choir has toured internationally as well as playing host to other choirs here. They are also active in the community, undertaking choral outreach programmes.
ORDEROF PROCEDURE
10JULY2024 AT09:30
Theaudiencewillrise astheacademicprocession enters thehallandwillremain standing untilthe Acting Vice-Chancellorisinplace
TheActing Vice-Chancellor willconstitutethecongregation
TheActing Vice-Chancellor willwelcomethegraduands,diplomates and guests
Addressto the congregation
Conferment of degreesand granting ofdiplomas
TheActing Presidentof Convocationwilladdressthe graduatesanddiplomates
TheActing Vice-Chancellor willdissolvethecongregation
Theaudiencewillstandwhile Ihele is played
Membersoftheaudiencearerequestedtostandwhiletheacademicprocessionleavesthehallandnottoleavethe hallbeforethe end oftheceremony.
IMPORTANT NOTICE
Intheeventofload-sheddingorpowercuts,theGreatHallmaybecometotallydarkuntilthegeneratorcomesinto operation.
FACULTYOFHEALTHSCIENCES
DEAN:PROFESSOR SA MADHIMBBChMMedPhD (Witwatersrand)FCPaeds(SA) MASSAfRSSAfTWAS CBE
MasterofDentistry
MOTSHOANE, Boitumelo Maxillo-Facial and Oral Surgery
RESEARCH REPORT: Epidemiologicalanalysisoftemporomandibularjointdislocation casestreatedatthe Universityof the Witwatersrand,Johannesburg
MasterofHealthSciencesEducation
BOCCHINO,Loredana Maria (with Distinction)
RESEARCH REPORT: A phenomenographicstudyofclinicianeducators'conceptionsofclinicalmedicalstudents' vocationalhabitus
MasterofMedicine
CHAANE,Nthabiseng
Diagnostic Radiology
RESEARCH REPORT: An auditofbreastcancerinyoung patients,40 yearsandyounger,intwolarge Johannesburg academic hospitals
LORENTZ,Liam Antony
Diagnostic Radiology
RESEARCH REPORT: A descriptive studyof MRI findingsofchildrenwithsuspectedhypoxicischaemicinjury ata Tertiary AcademicHospitalinJohannesburg, South Africa
MAKOFANE,LeratoIngrid Psychiatry
RESEARCH REPORT: ThedemographicandclinicalprofileofHIVinfectedand non-infectedchildrenand adolescentsattendingtwo districtpsychiatricclinicsin Sedibeng: arestrospective recordreview
SELEBELENG, Morakane Violet Paediatrics and Child Health RESEARCH REPORT: Adolescent fracturesandvitamin Dstatus: the birthto twentycohort(Bt20)
MasterofMedicineinAnaesthesia
BUCK, SamanthaClaire RESEARCH REPORT: Videoconference fatigueinan academicDepartment of Anaesthesiology
GAMEDE,IenNomdumiso
RESEARCH REPORT: AnauditofcancellationofelectivesurgeryinpaediatricpatientsatChrisHaniBaragwanath AcademicHospital
KUMALO,NthabisengJacqueline RESEARCH REPORT: Neuroprotectivestrategiesincardiacsurgery
LEROUX,JohannesJacobus
RESEARCH REPORT: Attitudesand perceptions ofcaregivers regardingtheirpresenceat induction of anaesthesia
MFEKA, NtombizabanguniGlory
RESEARCH REPORT: Postcaesareansection outcomesof obstetricvalvularheartdiseasepatientsat Charlotte MaxekeJohannesburg AcademicHospital
MPEMNYAMA,Lerato Nomonde
RESEARCH REPORT: Registrars'perspectivestowardsvirtual teachingprogrammeinanacademicdepartment duringtheCOVID-19 pandemic
PRINSLOO,Nathalie
RESEARCH REPORT: Preoperativefastingpractices and incidence of hypoglycaemia in patients presentingfor caesareansection at acentralhospital
RAPULENG,MoitoiAletta
RESEARCH REPORT: Emergencedeliriuminchildrenundergoingbotulinum toxininjectionsforstrabismus correction
SEPHEU,LetshokgeJulius
RESEARCH REPORT: Asurveyofcaudalanaesthesiapractice in an academic anaesthesiacircuit
STUART-CLARK,Hannah Elizabeth
RESEARCH REPORT: Retrospectivecaseseriesof theanaesthetic managementandoutcomesofpatientswith Rasmussen's aneurysmsat anacademichospital
TALANE, Pulane Adelice
RESEARCH REPORT: Asurveyoftheperceptionsandknowledgeofanaesthesiaandanaesthetistspossessedby Grade12 learnersinfourJohannesburgdistricts
VAN WYK,NatalieJean
RESEARCH REPORT: Audit ofasurgicalbookingsystemfor non-electivecasesin atertiary hospital
WAKABAYASHI, Koji
RESEARCH REPORT: Lowdose propofolasan effectivemethodinattenuating thecardiorespiratoryresponseto extubation:Single-blindedrandomizedplacebo-controlledtrial
MasterofMedicineinClinicalPathology
WILDING, BradleyThomas
Clinical Pathology
RESEARCH REPORT: AlaboratorybasedretrospectivestudyofplasmacellmyelomainthepublicsectorofSouth Africafrom2017 to 2019
MasterofMedicineinDermatology
GWINJI, Tapiwa Munyaradzi
Dermatology
RESEARCH REPORT: Clinicopathologicalspectrum ofcutaneous malignancies attheskintumourclinic,Charlotte MaxekeJohannesburg AcademichospitalinJohannesburg, South Africa: a5-year retrospectivereview
MAKONDO,Rulani
Dermatology
RESEARCH REPORT: Theimpactofchildhood atopicdermatitis oncaregiverqualityof lifeatRahimaMoosa MotherandChildHospital
MasterofMedicineinDiagnosticRadiology
KHWELA, Siphesihle
Diagnostic Radiology
RESEARCH REPORT: Hysterosalpingogramfindings in infertilityinwomen ofreproductive age atChrisHani Baragwanath AcademicHospital
LABUSCHAGNE, Hendrik Christiaan
Diagnostic Radiology
RESEARCH REPORT: Riskstratification of hospitaladmissionsforCOVID-19 pneumoniabychestradiographic scoringinaJohannesburg tertiary hospital
WIECHERS, Lumart
Diagnostic Radiology
RESEARCH REPORT: ClinicalAudit:TransradialUterine Artery Embolisationfor SymptomaticFibroidsat Park Lane Hospital
MasterofMedicineinEmergencyMedicine
HENNING, Jandre Emergency Medicine
RESEARCH REPORT: Theknowledgeandskillofregistered nursingstaffat ChrisHani Baragwanath Academic HospitalEmergencyUnits onendotrachealtubecuff manometry,before andafteratrainingsession
REDANT, Dean Patrick Emergency Medicine
RESEARCH REPORT: Knowledge,attitudesand practicesofclinicianmanagementofadults presenting with acetylcholinesterase inhibitorpoisoning
MasterofMedicineinHaematologicalPathology
MASIA,Tlangelani Vivian
RESEARCH REPORT: Verification andimplementationof achromogenicFactor VIII assaytomonitorFactor VIII levels in patientswith haemophilia Aonemicizumab therapy
NELL,Zanre
RESEARCH REPORT: A multi-centrestudyto evaluatean in-house multi-parameterimmunophenotypicpanelto identifyprecursorB-cellsinthedeterminationofmeasurableresidualdiseaseinpaediatricB-cellacutelymphoblastic leukaemia
MasterofMedicineinInternalMedicine
BAXTER,Jayson Mcneil
RESEARCH REPORT: Afifteen-yearreview ofMultipleMyelomainHIV-1seropositivepatientsatChrisHani Baragwanath AcademicHospital
BROZIN,DanielRichard
RESEARCH REPORT: A Review ofHIV-positive Patientsat ChrisHaniBaragwanath AcademicHospitalon Third-line AntiretroviralTherapy
HES,TamsinFaith
RESEARCH REPORT: PulmonaryManifestationsoftheIdiopathicInflammatory Myopathiesin aSouthAfrican population
KHOSA, MikatekoCain
RESEARCH REPORT: Afifteen-yearreviewofchroniclymphocyticleukaemiainadultsatChrisHaniBaragwanath AcademicHospital
KONDLO,Bafo
RESEARCH REPORT: Astudyoftheprevalenceofvitaminb12deficiencyinpatientswithtype2diabetesmellitusat HelenJosephHospital
MOGASHOA, Vanessa
RESEARCH REPORT: Anticoagulationfornon-valvularatrialfibrillation in South Africa
MPANZA,MbongiVicter
RESEARCH REPORT: Aretrospective audit ofthecytogenetic profile and managementoutcome in AcuteMyeloid Leukemia patientstreated atCharlotteMaxekeJohannesburg AcademicHospital(2017 - 2021)
NAIDU, Yashika
RESEARCH REPORT: Aretrospectivestudyof the epidemiology,management andoutcomes ofpatientswith dialysis-requiringacutekidneyinjury,overa24-monthperiod,atHelenJosephHospital,Johannesburg,SouthAfrica
NDWAMBI,RudzaniWendy
RESEARCH REPORT: Patternsof liverinjury inHIVpositivepatientsinthemedicaladmissionswardatChrisHani Baragwanath AcademicHospital
PERKS, MicheleLinda
RESEARCH REPORT: AprofileofpatientsonproteaseinhibitorsatatertiarylevelantiretroviralclinicinSouthAfrica
SETSHEGO, MothusiKoketso
RESEARCH REPORT: Theprevalence of ArrhythmiasinacuteSt-Segmentelevationmyocardialinfarction
URADE, YusufMohamed Abdillahi
RESEARCH REPORT: Epidemiologyandreferralpatterns ofpatientslivingwithchronickidney disease in Johannesburg, South Africa:asinglecentreexperience
MasterofMedicineinMedicalGenetics
NOVELLIE,MichaelRichard
RESEARCH REPORT: Audit ofLysosomalStorage Diseasestestingat the NationalHealth Laboratory Servicein Johannesburg from 2011-2020
VANIA, Ashira
RESEARCH REPORT: Geneticcharacterisation of epidermolysisbullosainSouth Africanpatients
MasterofMedicineinNeurology
GANESH,Annsureeka (with Distinction)
RESEARCH REPORT: TherelationshipbetweenincreasedBodyMassIndexandPrimaryHeadacheDisordersina group of AntiretroviralTherapy-induced overweight andobesepatients
MasterofMedicineinNeurosurgery
MOHALE, DiapoGerald
RESEARCH REPORT: Glioma histologyatCharlotte MaxekeJohannesburg Hospital, a5yearretrospective study
MasterofMedicineinObstetricsandGynaecology
MASUKUME,Rumbidzai
RESEARCH REPORT: An assessmentof the hospital learningenvironment withinthe Universityofthe WitwatersrandObstetricsandGynaecologyRegistrar Training Programme
MPHAPHULI,MikovheRejoice
RESEARCH REPORT: Pregnancyoutcomesofwomenpresentingwith2017AmericanCollegeofCardiologystage 1Hypertensionduring the firstprenatalclinicvisitbefore20 gestational weeks
STEVENS, Ronwyn Mercia
RESEARCH REPORT: Theclinicalsignificance ofplacentalhistopathologicalevaluation inthe managementof high-riskobstetric patients
MasterofMedicineinOphthalmology
KRÜGER, Hester
RESEARCH REPORT: Acomparison ofreboundand applanationtonometryinanaesthetisedchildrenwith and without primary congenitalglaucoma: across-sectionalcomparativestudy
MAKDA, Ismail
RESEARCH REPORT: Impactofthe COVID-19pandemiconOphthalmicSurgeryatatertiary hospitalin South Africa
WALTERS,Ingrid
RESEARCH REPORT: Spectrumof glaucomatousdiseaseat CharlotteMaxekeJohannesburgAcademicHospital
MasterofMedicineinOrthopaedicSurgery
GQAMANA,Loyiso
RESEARCH REPORT: TheeffectofHIVonthemicrobiologyofadultpatientspresentingwithsepticarthritisatChris HaniBaragwanathAcademicHospital
MKOMBE,Nangamso
RESEARCH REPORT: PrevalenceofvascularinjuryinpatientswithOrthopaedictraumaonthekneeatChrisHani Baragwanath AcademicHospital
NKOSI,CollenSandile
RESEARCH REPORT: Qualityof lifefollowinganopenLatarjet-Bristow procedurein ageneralpopulationwith arecurrentanteriorshoulderinstability
MasterofMedicineinOtorhinolaryngology
GAFFOOR,Nabeela
RESEARCH REPORT: Prevalenceandrecovery time ofolfactory dysfunctionin SARS-COV-2 positive patients: a prospectivesurvey
MasterofMedicineinPaediatrics
DLAMINI, Sibongile
RESEARCH REPORT: Presentationandoutcomesofchildren admittedwith organophosphate andcarbamate poisoningat RahimaMoosaMotherandChildHospital
KEENE, AbigailMarriott
RESEARCH REPORT: InvasiveFungalDiseaseinChildrenwith Cancer: aten-yearanalysisfrom aPaediatric OncologyCentre in Soweto,South Africa
MAFORA,Tshiamo
RESEARCH REPORT: Virologicalresponseinchildrenandadolescentsswitchingtodolutegravirbasedregimensin Johannesburg, South Africa - A LongitudinalCohort Study
MAGOMANI, Xitshembiso Confidence
RESEARCH REPORT: CharacteristicsandoutcomesofHIV -infected children on antiretroviraltherapyreferredfor virologicalfailure
MAHLALELA,Gcebile
RESEARCH REPORT: Aretrospective descriptivestudyofdemographics,treatmentmodalitiesand outcomesof childhoodimmune thrombocytopeniaat atertiary hospitalin Soweto, South Africa
YACHAD,Nouraine
RESEARCH REPORT: An auditofinfantspresenting withcholestaticjaundiceat asecondary hospitalin Johannesburg, South Africa
MasterofMedicineinPlasticandReconstructiveSurgery
PHALAFALA, Refilwe PalesaMokgadi
RESEARCH REPORT: A multicentreretrospectiveaudit ofthetreatment modalitiesof sternalsepsis: a10-year review
MasterofMedicineinPsychiatry
BADAT, Ahmed
RESEARCH REPORT: Preparednessof finalyearmedicalstudents incaringfor lesbian, gay, bisexualand transgenderpatientswith mentalillness.
HARLIES,CelesteMichele
RESEARCH REPORT: Sleepqualityof adult psychiatryoutpatientsat ChrisHani Baragwanath AcademicHospital
HUMAN, Allison Kirsten
RESEARCH REPORT: Post-traumaticstresssymptomsin mentalhealthcareworkers duringtheCOVID-19 outbreak
HUNGWE,MichelleMandipa
RESEARCH REPORT: Assessingtheprevalence of anddescribingthepsychoticsymptomsofepilepticpatientsin anoutpatientclinicusingtheprodromalquestionnaire sixteen
NEMAVHOLA, Muthumuni
RESEARCH REPORT: Socio-demographic, forensicandclinicalcorrelatesin femaleobservandireferred for non-violentcrimes
PHUNGULA, Nokukhanya
RESEARCH REPORT: ViewsheldbyprimaryhealthcarenursesinacommunityhealthcenterinGautengProvince, South Africa, oncaringfor people living withmentalillnessand taskshifting
RODRIGUES,JanineBiancaLira
RESEARCH REPORT: Neurocognitive improvement inHIVpositive patientstreatedwith dolutegravirbased regimens
ZIKALALA,NonhlanhlaElizabeth
RESEARCH REPORT: Acomparison ofattachmentstylesin Statepatientswith andwithoutantisocialpersonality disorder atSterkfonteinHospital
MasterofMedicineinRadiationOncology
SCHNEEBERGER,Daniel Clarence
RESEARCH REPORT: Treatment outcomesfor patientsreceivingradiationtherapyforstageIIIBcervicalcancer with lowerthirdvaginalinvolvementinthedepartment ofRadiationOncology, Charlotte MaxekeJohannesburg AcademicHospital
TSHOEU, Phemelo
RESEARCH REPORT: Aretrospective analysisofconcurrentchemoradiationfor patientswith squamouscell carcinoma ofthe anustreatedbetween2014 and2019 inJohannesburg
MasterofMedicineinSurgery
GOVENDER,TarliaRasa
Paediatric Surgery
RESEARCH REPORT: Respondingtotheneed-thedevelopmentofsubspecialtyunitsinpaediatricsurgeryamidst theglobal surgerypandemic
HART,Benjamin Mark
RESEARCH REPORT: Metataxonomicanalysisdemonstratesashift induodenalmicrobiota in acohortof South African patientswithobstructiveJaundice: apilotstudy
HARTFORD,LeilaNompelo
Paediatric Surgery
RESEARCH REPORT: Singlestageproceduresforanorectalmalformations:asystematicreviewandmeta-analysis
JACOB,Joseph
RESEARCH REPORT: ClostridioidesDifficile Infectionin SurgicalPatientsManaged atCharlotte Maxeke Johannesburg AcademicHospital: aRetrospective, DescriptiveStudy
MASOLE,Ludo LoratoCarol
RESEARCH REPORT: Procalcitonininthepostoperative burnspatient
MATHIBELA, SetoniPiet
RESEARCH REPORT: Thefeasibilityofearlychemicalthromboprophylaxisin traumaticbrain injury patients admittedto atrauma ICU
MUKENDI,Ilunga Valerien
RESEARCH REPORT: Assessmentof geneticcounsellingandtesting of patientsdiagnosed withinvasive breast carcinoma in two South Africanbreast units
MasterofPharmacy
AYODELE, Simisola Ayobami (with Distinction)
DISSERTATION: Targeted nanosystemsforTB pericarditis intervention
KIM, Yedam
DISSERTATION: Useof probioticsincommunitypharmacyin South Africa: asurveyofpharmacist attitudes, perceptionsandknowledge
LIPHOLO,LineoJeanett (with Distinction)
DISSERTATION: Knowledge,attitudesandperceptionsofhealthcareworkersonadversedrugreactionreportingin agovernmenthospitalin Botswana
MAZARURA,KundaiRoselyn (with Distinction)
DISSERTATION: Designandevaluationof anon-opioidtripartitereleasetabletforchronicinflammatorypain.
SPINICKUM,LoganJade (with Distinction)
DISSERTATION: AntibacterialstewardshippracticesinSouthAfricaduringtheCovid-19era:aretrospectivereview
MasterofPublicHealth
BOKABA,DorahDorothea
Health Systems Policy
RESEARCH REPORT: Exploring inter-professionalcollaborationbetweencommunity health workers and health careproviders intwoclinicsintheCityof Johannesburgdistrict
DHAR,Nisha
Mother and Child Health
RESEARCH REPORT: AssociationbetweenserumzinclevelanddynamicsofGroupBStreptococcuscolonisation amongpregnantwomenin South Africa
KWATRA, Gaurav
Mother and Child Health RESEARCH REPORT: PrevalenceofGroup B Streptococcuscolonization andserotypedistribution among pregnantwomenin South Asian andAfricancountries
MCGRATH,Robyn Lesley (with Distinction)
Mother and Child Health RESEARCH REPORT: TheeffectsofCOVID-19 on paediatrictherapeuticservicesatChrisHaniBaragwanath AcademicHospital
ROWSE, SavannahMaida Social and Behaviour Change Communication RESEARCH REPORT: Factors thatpromoteand impedetreatment adherence ofout-patient mentalhealth care users atapsychiatrichospitalinJohannesburg
ZAMISA,Thulile Senzekile Occupational Hygiene RESEARCH REPORT: Noiseemissionsandexposuresamongdrilloperatorsandassistantsinanopencastminein South Africa
MasterofScienceinDentistry
HARI, Anisha Anil
RESEARCH REPORT: Theprevalenceandtypesofpathologiesrelatedtoimpactedmandibularthirdmolarsbased onpanoramicradiographs
RAMPERSAD, Yuvti
RESEARCH REPORT: Antibioticprescribing patterns amongdentistsin the DurbanMetroRegion, South Africa
MasterofScienceinEpidemiology
CHIPISE,Elisha
Implementation Science RESEARCH REPORT: Factors associated withextremenonadherencetoTBtreatmentamongadultdefaulters attendingGqeberhaclinic between2018 and 2019
CHISHIBA,Charlotte Njavwa
Implementation Science RESEARCH REPORT: Theassociation betweenintermittent preventivetreatmentuptakeandAnaemiaamongst pregnantwomeninZambia in 2018: aspatialanalysis
DINGA,Aphiwe NomathibaneZilungile
Epidemiology and Biostatistics RESEARCH REPORT: OccupationalcharacteristicsandeconomicactivitiesofHealth Workers intheQuarterly LabourForceSurvey:2008 -2017
DZIMBANHETE,TsitsiCherry
Epidemiology and Biostatistics RESEARCH REPORT: TherelationshipbetweentraumaticeventsandqualityofsleepinolderadultsinruralSouth Africa
ELAKPA,DanielNgbede
Implementation Science RESEARCH REPORT: Factors associated withvectorcontrolforonchocerciacis controlin Sub-Saharan Africa (2000- 2023):asystematic review
GEORGES,Some
Epidemiology and Biostatistics RESEARCH REPORT: Predictors of frailtyand multimorbidity in adultsaged 40 to65 yearsin aruralpopulation cohortinBurkina Faso
JOHNSTON, Leigh Clare Field Epidemiology RESEARCH REPORT: Determinants of sub-optimalglycaemiccontrol among patients enrolledina medicine dispensing programmeinKwazulu-Natal:a cohortstudy,2018-2021
KANZOOLE, Kingsley Implementation Science RESEARCH REPORT: Riskfactors forrecurrenttuberculosisamongHIVpatients who areon anti-retroviral treatment inruralNortheast,South Africa
KUPA, NkgodiObed
Infectious Disease Epidemiology RESEARCH REPORT: Therelationshipbetweenthecombinedeffectsoflife-coursetraumaandHIVoncognitionin ruralSouthAfrican adults: asecondary data analysis
MUCHAI, Lilian Njeri
Epidemiology and Biostatistics RESEARCH REPORT: Earlylifefactors associated withchildhood trajectoriesof violenceamongtheBirth to Twenty-pluscohort in Soweto, South Africa
NHLAPHO, MapuleDorcus Public Health Informatics RESEARCH REPORT: Avisualanalyticsapproachtocharacterisingdiseaseprogressionamongadultswithchronic diseases inruralnortheast South Africa
MasterofScienceinMedicine
BARNARD, Sebastian Genetic Counselling RESEARCH REPORT: Areviewofgenetictestingforfemalesreferredtogeneticcounsellingforapersonalorfamily history of gynaecologicalcancer
BENNETT,Matthew Biokinetics RESEARCH REPORT: Theeffectivenessofamultidisciplinary,protocol-basedapproachtopatientsofdifferentage groupswith lowerbackpainin Bloemfontein,Gqeberha,Polokwane,andJohannesburg
BEUKMAN,Danielle Genomic Medicine
RESEARCH REPORT: RB1andbeyond: Determining geneticcauses ofRetinoblastoma in South-African patients
BLIGNAUT,Chanel Pharmacy
DISSERTATION: Assessingthe potentialinteraction betweenCBDandTBR1T-boxDomain
BRESLER, Anréé Genomic Medicine
RESEARCH REPORT: Predicting exomesequencing outcomesfrom phenotypic data in an Africanpatientcohort with developmentaldelay
DUVENHAGE,Megan Genetic Counselling RESEARCH REPORT: Theutilisationofgeneticcounsellingservices amongstprenatalhealthcare providersin Gauteng, South Africa
ELONGA,Jessica Pharmacology
DISSERTATION: The invitrodiffusionacrossexercisedporcineskin ofvariousformulationsofcompoundsused topically inthetreatment of skinafflictions
EME,Ifeanyi Clinical Microbiology & Infectious Diseases
DISSERTATION: Effectof pneumococcalconjugatevaccineoninvasive pneumococcaldiseaseinchildren hospitalised atChrisHaniBaragwanathHospitalover a13-year period
FONGUH,Oliver Khan Vaccinology
RESEARCH REPORT: FunctionalconsequencesofnovelIgG3allelicvariation onCAP256-VRC26.25
FUTI,Benedicte Malonda Physiology DISSERTATION: Theepidemiologyof menstrualpain ina South AfricanUniversitypopulation
GALLANT,Simone
Anatomical Sciences DISSERTATION: Characterizing luminalA breastcancerheterogeneityandinvitroresponse to hormonetherapy
GAVIN,JessicaRobyn
Anatomical Sciences DISSERTATION: Assessmentofdisabilityresulting fromdegenerative jointdiseasein asouthern Africanskeletal population
GOLDFEIN,Batsheva Chana Physiology DISSERTATION: microRNAexpressionandarterialfunction in typeIIdiabetesmellitus
GOVENDER,DemiNatisha Anatomical Sciences DISSERTATION: TheeffectsofIbogaine on myelinationinSpragueDawleyrats
GROBLER,Nico (with Distinction) Physiotherapy DISSERTATION: Thedevelopmentofaquestionnairetoassesstrainingandmatchdemandinadolescentcricketers
ISMAIL,Tahir Clinical Pharmacy RESEARCH REPORT: Asurveyofthe delivery of clinical servicesin independent community pharmacies in South Africa
KAIRUZ,Dylan Matthew (with Distinction) Haematology and Molecular Medicine DISSERTATION: Developingnon-viralvectorformulationsforthe delivery ofsyntheticself-amplifyingRNA
KHAN,Muneerah (with Distinction) Bioethics and Health Law RESEARCH REPORT: Epistemic(in)justice,socialidentityand the BlackBox problem in patient care
KHOZA,Nhlamulo (with Distinction) Human Genetics DISSERTATION: Characterisingthecombinedeffectsofcytochrome P450 missensevariantswithinthestar allele nomenclature
LUBBE, Andrea Physiology
DISSERTATION: Neurophysiologicaleffectsofcitalopraminarodentmodelof ACTHinduced HPAaxis dysregulation
MAKHA, LeratoMathabelo Pharmaceutical Affairs RESEARCH REPORT: Designandsynthesisofananocapsulesystemfortransdermaldeliveryoflignocaineacross theskin
MALINGA,Thandeka VuyiswaBongiwe
Genomic Medicine RESEARCH REPORT: Characterisation ofthegeneticvariation inpharmacogenesinvolved inanti- tuberculosis drugmetabolism acrossAfricanpopulations
MANGENA,ZaneleGrannyMahalia (with Distinction)
Clinical and Experimental Pharmacology DISSERTATION: An evaluationof the effectsofmetal complexeson lungcancer celllines
MATHABELA,Nomfundo Ntombikayise
Chemical Pathology DISSERTATION: Sequencing forhigh-risktype 1diabetesgenotypesin the SouthAfricanblackpopulation using ampliseqNanoporenextgenerationsequencing
MATHIKHI,KhethaniThendo Physiology DISSERTATION: Investigating the toxiceffectsof nyaope onthebrain,liverand kidneyofSprague-Dawley rats
MCCARTHY,DylanJames (with Distinction)
Genomic Medicine RESEARCH REPORT: Analysisofsinglenucleotidevariants andcopynumbervariants in patientswithfeatures suggestive of aRASopathyusing whole exomesequencing
MHLATHI, Xolisiwe
Anatomical Sciences DISSERTATION: Microarchitectureof the human postnatalmaxilla inrelationto tooth developmentand eruption
MINNS,Chantelle
Clinical Pharmacy RESEARCH REPORT: Investigatingthecorrelation betweendemographicandcomorbidityprofileswith chemotherapeutictoxicityexperiencesinearly-stagebreastcancerpatientsinaprivatemedicaloncologypracticein South Africa
MMBI, PhophiMmapole
Genomic Medicine RESEARCH REPORT: Investigatingthegeneticcauseof oculocutaneousalbinismtype 2inindividualsofAfrican descentthroughexomesequencing
MNGOMA,Ndabenzinhle Ronald
Anatomical Sciences DISSERTATION: Effectsofbinge alcohol consumptionon the developmentof thefemurof adolescent Sprague Dawleyrats
MOHUN, Shameeda Clinical Pharmacy RESEARCH REPORT: Aretrospectivereview onthe utilisation of meropenem in atertiary hospitalsetting
MOTLHALE,Gomotsegang Physiology DISSERTATION: Effectsoflycopeneonthebone, kidneyandpancreatichealth ofgrowingWistarratsfeda high fructosediet
MUNIAN, Pariska Physiology DISSERTATION: The impactofaltitudeontheprevalenceandcharacteristicsof RestlessLegsSyndrome
NAICKER,Racilya (with Distinction)
Genomic Medicine RESEARCH REPORT: Analysisof Whole ExomeSequenceDatafrom African Patientswith HD-Like Featuresand NoKnownHD PhenocopySyndrome
NCHIMUNYA, Bbautu Exposure Science RESEARCH REPORT: Efficacyofnoise controlmeasures athigh noisezonesfromacopper mine inZambia
NEVES,KeilaDias (with Distinction) Haematology and Molecular Medicine DISSERTATION: Expressionand immunogenicity of HBV surfaceantigensfollowing in vitro and invivogene delivery usingrecombinant adenoviruses
PEYA, Yolanda (with Distinction) Anatomical Sciences DISSERTATION: Adocumentationof the morphology ofthelungsoftheSprague Dawleyratafterchronicheat exposure
PIKETH, AimeeJane
Clinical Microbiology & Infectious Diseases
DISSERTATION: Investigation of mono-andpolymicrobialantibiofilm activities of Defensin-likeantimicrobial peptide-2againstCandida aurisand Pseudomonasaeruginosa
PILLHOFER, Gabriella Peta
Genomic Medicine RESEARCH REPORT: GermlineCancerPredispositionVariantsin PaediatricRhabdomyosarcoma
RABINDA, KentieRofhiwa
Genomic Medicine RESEARCH REPORT: Exomesequencingof individualswithvitiligoandtheirrelativeswith and without autoimmunedisorders
RAJCOOMAR,Yashmika Pharmaceutical Affairs RESEARCH REPORT: Thewound healing effect ofexosomesderivedfrom Lobostemon fruticosus
RAMTAHAL, Kieara-Lee Bioethics and Health Law RESEARCH REPORT: Themoralobligationtoincludepregnantwomen inclinicaltrials
SAMUDH,Nazia (with Distinction) Haematology and Molecular Medicine DISSERTATION: Characterizationof the murine immuneresponseto self-amplifyingmRNAsequencesencoding HepatitisBvirussurfaceproteins
SARANGARAJAN,Ruach
Bioethics and Health Law DISSERTATION: Dogovernmentshave anyprima faciedutiestofund influenzavaccination(forthe elderly in SA) and adults65 yearsandabovetovaccinate against influenza,respectively?
SCHEEPERS, VanessaChristina Bioethics and Health Law RESEARCH REPORT: Isitfair and morallyjustifiedto limit accesstofree Human Papillomavirusvaccinationsto onlygirls inpublicschoolsinSouth Africa?
SHRILALL, CreanneJizell
Haematology and Molecular Medicine DISSERTATION: DevelopmentofinvitrotranscribedRNAinterferenceactivatorsforthetherapeuticinhibitionofthe hepatitisBvirus
SIMBU,Shivar Bram (with Distinction) Pharmacy DISSERTATION: Essentialoilcompoundsincombination withconventionalantibioticsfordermatology
SMIT, IngridMaria Genomic Medicine RESEARCH REPORT: Cysticfibrosis: an update onthevariantprofile andcarrierfrequencyinthe BlackSouth African population
STEYN, StephanusFrederik (with Distinction)
Clinical Pharmacy RESEARCH REPORT: Brainconcentrationsandthe neurochemicaleffectsof passivelyadministered fluoxetine in Flinderssensitivelinerat offspring
TSOLO,SemakalengTheresia
Vaccinology RESEARCH REPORT: EvaluationofnovelassayformatsforIndoleamine 2,3 dioxygenaseasaTBbiomarker
ZUNGU,Zwile
Vaccinology RESEARCH REPORT: UnderstandingSARS-CoV-2vaccinehesitancyamong pregnantwomeninSoweto, South Africa: aqualitativestudy
MasterofScienceinNursing
CLAY,Nadia Susan
DISSERTATION: PrivateSectorHealth Care users'forchoosingmaternityservicesina District in Mpumalanga
CLUFF,Megan Andrea
RESEARCH REPORT: AstrategicassessmentofemergencycarecapacityatPrivatePrimaryHealthCareFacilities inGauteng
MARE,Magdalena Elizabeth
DISSERTATION: Guidelinesforthe implementationofblended learningina nursingcollege campusin Gauteng: a mixed methodsstudy
MOTSUMI,TheodoraMapadime
RESEARCH REPORT: Thepsychosocialwork environmentof primary health carenursesintheNorthern Sub-DistrictCityof Ekurhuleni
QUIROGA,NeilDylan
RESEARCH REPORT: Theemergencymanagement ofpatientswhohave experiencedsexualviolence: an integrativeliteraturereview
MasterofScienceinOccupationalTherapy
PRETORIUS, Jeanette Maria
RESEARCH REPORT: Impactof aruralcontextin Kwazulu Natalon primary caregiver'smanagementofpain non-communicatingchildrenwithsevere neurologicalimpairment
MasterofScienceinPhysiotherapy
CHIROMBO,Hannah Edith
RESEARCH REPORT: Investigatingthephysiotherapymanagement ofpatients with polytraumaadmitted to acute caresettingsandfactors thatinfluenceservice deliveryafterdischarge: aNamibiansurvey
DAHYA, Karishma
RESEARCH REPORT: Mappingelectro-acupunctureinthe treatmentof lowerbackpain. aScopingreview
DAWOOD,Zaheerah
DISSERTATION: Factors contributingtouncontrolled highbloodpressure in Ekurhuleni,Johannesburg:the communityhealthworkers'perspectives
HURST, Samantha Lee Anselmo
RESEARCH REPORT: Breathing Pattern Dysfunction amongst patientswithMedianSternotomy PostHospital Discharge: across-sectionalstudywithin a South African context
LEANDER,Natalie
RESEARCH REPORT: Exercisedosagesforthe management ofgeneralized anxietydisorder: ascopingreview
MASILANA, Masocha Vusi
RESEARCH REPORT: Running-related injuriesandriskfactors amongrunnersinSoweto townshipclubs, Johannesburg
STEYN,Joretha
RESEARCH REPORT: Modeof delivery,analgesic, andneuromusculoskeletalprofileofwomen developing new onset lower backpain postpartum
VANHEERDEN,Martin Harry
DISSERTATION: Patient'sperspectives,pain,andhealth-relatedqualityoflifeinsame-daydischargehipandknee arthroplasty
BachelorofClinicalMedicalPracticeHonours
ALEXANDER,Fatima Emergency Medicine
BachelorofHealthSciencesHonours
BOOYSEN, Brandon Mark Physiology
CHINGUNO, Shingirai Pharmacology
DU-PONT,Justine Manda (with Distinction) Biokinetics
GERBER,RachelBatya Physiology
GUMEDE,GcinathinaNkazimulo Biokinetics
KUHN, SebastianCJ Forensic Sciences
KUNUTU, Prudence Boniswa Anatomical Pathology
MAHLAELA,Malope Valentia Lebogang Physiology
MAZIBUKO, NoxoloQueenUnity Molecular Medicine and Haematology
MOETAPELE,Keitumetse DeboraFlavia Forensic Sciences
MOTAUNG,Lerato Mapaseka (with Distinction) Human Biology
NCUBE, MbaliFaith (with Distinction) Human Genetics
NDOU,Onakesa Pharmacology
NYAWO,Sithabile Forensic Sciences
NYONI, Emmanuel Virology
PATJANE, MamodianeAnna (with Distinction) Virology
PISANTI,Rosa (with Distinction) Human Biology
PRENTICE,Kaylee (with Distinction) Biokinetics
SEBOLA, Mokgaetsi Albertina Exercise Science
SHUSHA,NomceboNonjabulo Immunology
TAMLIN, AmberRebekah (with Distinction) Pharmacology
TSIBOGO,Pahora Veronica
Clinical Microbiology and Infectious Diseases
TSWAI,Refilwe Bridgett Health Systems Sciences
BachelorofDentalScience
GUMEDE,Nhlanhla Prince
KÖSTER, Emma
LANGA,NanikieBetty
LATEGAN,Carissa
MACDONALD, Sean Nicholas
MAKHETHA,Zoliswa
MARKOULIDES,Stelios
MOKALE,Teboho Macdonald
NAST, KimberleyAmber
NGOMANE, Tricia Pertunia
PATHER, KeashtraPragason
PIENAAR, Marcia
SALLEY, Sameer
SUJEE, Ammaarah (with Distinction)
TAKADIYI,MirandaTadiwa
TLAKANE, Mpinane Eunice
VANDENHEEVER,Deniell
VANDE WETERING, Monique
YASIN,Mohammed Abdiqafar
BachelorofMedicineandBachelorofSurgery
AMADI-IHUNWO,Glory Chukwuka
ASHER,Horeb
AZIZOLLAHOFF,Liat Devorah
DEGOUVEIA, Tammi
DLAMINI, Awongiwe KamvelihleHlonela
FEENEY,Connor Mcleod
HOFFMANN,Hilton Allan
KABEYA, KapembGloria
KHWASHA, NokuthulaPrecious
MABIZELA,Tshegofatjo Selaelo
MAHARAJ, Kashiv
MAKUA, Nelisiwe Kemalo
MASEMOLA, LeratoAdelaide
MATLOGA,KabeloFortune
MILLER,Georgina Michele
MOHETA, Boitumelo
MOOLLA,Ahmed Mohammed
MUNIEN,CameronDevan
NAIDOO,Vishen
NDLOVU,Nceba
NHLAPO,Nhlonipho Emelinah
NTSHANGA, Asithandile
PHILIP,Serin Ninan
RADEBE,NolwaziDorcas
RAMOSHU,Lehlogonolo Pleasure
SENGANE, Nomzamo Ayanda
SHABALALA,Sanele Lwazi
BachelorofNursing
BEILING,Claireece Carise (with Distinction)
DUPLESSIS,RenschePetronella (with Distinction)
KGAGARA,KgotsofaloPebetse
KHOABANE,Palesa
MAKHUBELA, ColwynTanaka
MAKHUVHA, Uhone
MALEPE, RegaogetsweTracy
MAZALENI,Nosiphiwe Hope
MBALENI,Tokazi Lilitha
MBUTHO,Minenhle NonjabuloHopewell
BachelorofPharmacy
DAMARI, KabeloJohn
DUPLESSIS,Nerine
ESSA, Mohamed
LUBISI, Linda Ebenezer
STAMPER,Mbasa
STANDER,Lizette
TIFO,MpunduJennette
WAFAWANAKA,TadiwanasheNathanTawanamubatsiri
WIRSIY, John-Leroy Njofon
ZONDO,SiphokuhleNombusoSanda
METHOLA,Thapelo Patrick
MPEPELE, Lethabo Audrey
MPHAHLELE,Leago
NDLOVU,ThabileLindokuhle
NHLEKO, Ayanda
NTEMA, NalediNathaly
SAMIMI, Sahra
SANGWENI,Tholakele Ayanda
THOMPSON,AliciaGeorgia
ULLBRICHT,ChanelJesse
MALAPANE, Boitumelo Pretty
MALATJI, Karabo Advice
PILLAY, CaitlynnElizabeth
BachelorofScienceinOccupationalTherapy
LAMULA,Luyanda Samukelisiwe
BachelorofScienceinPhysiotherapy
NKOSI,ThandolwethuZinhle
BachelorofClinicalMedicalPractice
CHEPAPE,TebogoLesiba Mukelo
MAHUDU,Dimakatso Agnes
MNGUNI, Sthokozile Asande
MOGARI,LebogangOuma Emily
BachelorofHealthSciences
BOOI,Sisipho Biomedical
DAHIR,FatimaHasan Biomedical
DUNCAN, Robyn Erin Biomedical
KHANYI,FezekaHappy Health Systems Sciences
KHUMALO,NosiphoThandeka Biokinetics
KHUMALO, SanelisiweNomhle Health Systems Sciences
LETSELELA, RekhotsoMatshepiso Biomedical
MAKGATHE,Deborah Khowele Health Systems Sciences
MALEKA,KeletsoPortia Biomedical
MASOLA, MahlatseDanny (with Distinction) Health Systems Sciences
MASWI, Boikanyo Health Systems Sciences
MATLALA,Otshepegile Salvina Biomedical
MATYANA,Luthando Biokinetics
MCHUNU,Thandeka Health Systems Sciences
MLGUNI,ThembekaAnele Pearl Biomedical
MOHAMMAD, Amaarah Ali Biomedical
MOKGWADI,LethibeOdgah Biomedical
MPHAPHULI,Neo (with Distinction)
MTHEMBU, Kwanele Phindile (with Distinction)
MULEWA, Keziah
Health Systems Sciences
Health Systems Sciences
Health Systems Sciences
MUNESAR, Kavish Biomedical
NCUBE, QueenMbali Biomedical
NOMPULA, Aphindiwe Biomedical
SIBIYA, PrincessNompumelelo (with Distinction)
SKOSANA, XolaniJosiah
TSHIWANDIMONI, Khodani
BachelorofOralHealthSciences
DUMA, KhensaniPatricia
Health Systems Sciences
Health Systems Sciences
Health Systems Sciences
MQALA,Phumelele
PostgraduateDiplomainHealthSciencesEducation
MAFOJANE,TumaneDaniel
MATLHADISHA, PhutiGermina
PostgraduateDiplomainOccupationalHealth
JINNY,MutambayNdaya
MABEBA,DanielMphenywa (with Distinction)
MAKHWITING, Podile Prodexcel
MAROLE,ThapeloHenry
NTSHANGASE,Sesiphiwe SandaNomfundo
OMOYENI,OlusholaOluranti
ZIKALALA,Hlengiwe
PostgraduateDiplomainTropicalMedicineandHygiene
MHLONGO,WandileMason
THEWITSHEALTHPROFESSIONAL'SHIPPOCRATICPLEDGE
AsaHealthProfessionalgraduandoftheUniversityoftheWitwatersrand,Isolemnlypledgethat:
- Iwilldedicatemylifetotheserviceofhumanity;
- Iwillexercisemyprofessiontothebestofmyknowledgeandabilityinaccordancewith soundhealthpracticesandwithcompassion,conscience,integrityandhumility;
- Thehealthandwell-beingofallpersonsentrustedtomycareandthewell-beingofthe communitywillbemyfirstconsideration;
- Iwillrespecttheautonomyanddignityofmypatientandwillnotknowinglydoanythingto theirdetrimentorprejudice;
- Iwillnotpermitconsiderationofage,religion,nationality,politics,race,gender,sexual orientation,disability,disease,lifestyle,economicstatus,socialstandingoranyother factortointerferewithmydutytomypatient;
- IwillnotimproperlydivulgeanythingIhavelearnedinmyprofessionalcapacity;
- Iwillupholdanddefendmyprofessionalindependence;
- Iwilladvocateforhumanrightsandwillnotviolatesuchrightsandcivilliberties,even underthreat;
- Iwillconductresearchonpatientsonlyinaccordancewithsoundethicalprinciplesand with theapprovalofaformallyconstitutedethicscommittee;
- Iwillembracelife-longlearningtoimprovemyprofessionalknowledgeandskillsandwill sharemyknowledgeforthebenefitofpatientsandtheadvancementofhealthcare;
- Inmyrelationswithpatients,colleaguesandothers,Iwillconductmyselfasbecomesa memberofanhonourableprofession.
Imakethispledgesolemnly,freelyanduponmyhonour.
GRADUATIONAWARDS
FACULTYOFHEALTHSCIENCES
Prizestobepresented at theGraduationCeremony
GoldMedalofthe SouthAfricanDentalAssociation: AwardedtotheDentalGraduandwho hasachievedthemostdistinguishedacademicrecordoverthefiveyearsof study.
Ammaarah Sujee
Raymondand Marjorie DartMedals:
Thismedalisawardedto themost distinguishedgraduandwho performed ataconsistentlyhigh levelthroughout thefouryearsofstudyinBNursing.
Rensche Petronella Du Plessis
Prizestobepresented at theFaculty’s prizegiving ceremony
AfricanOxygenBronzeMedal:
Thismedalisawardedto thefifth-yeardentalstudent adjudgedthemostdistinguished inthe administration of generalanaesthetics.
Ammaarah Sujee
BarbaraRobertson Prize forIntegratedGeneralNursing(IGN)IV:
Thisprize isawarded tothe studentwhohas achieved thehighestmark in both thetheoreticaland practical components oftheIntegratedGeneral Nursing(IGN)IVcourse.
Rensche Petronella Du Plessis
BronzeMedaloftheHenryScheinDentalWarehouse:
Awardedtothemostdistinguishedstudent in Prosthodontics.
Ammaarah Sujee
CommunityDentistryPrize:
Tothestudentwhoachievesafirstclasspassandthe highestmark in PublicOralHealth
Ammaarah Sujee
Dean's MeritListBachelorof Health SciencesYear 3:
Citationforachieving an average of75%inthethirdyearofstudyforthedegree ofBachelor ofHealth Sciences.
Fatima Hasan Dahir
Robyn Erin Duncan
Fezeka Happy Khanyi
Deborah Khowele Makgathe
Mahlatse Danny Masola
Thandeka Mchunu
Neo Mphaphuli
Kwanele Phindile Mthembu
Keziah Mulewa
Princess Nompumelelo Sibiya
Dean's MeritListBachelorof Nursing Year4:
Citationforachieving an average of75%inthefourth yearofstudyforthedegree Bachelor ofNursing.
Claireece Carise Beiling
Rensche Petronella Du Plessis
Regaogetswe Tracy Malepe
Sahra Samimi
Alicia Georgia Thompson
Chanel Jesse Ullbricht
Dean's MeritListBachelorof Oral Health Sciences (OralHygiene)Year 3:
Citationforachievinganaverageof75%inthethirdyearofstudyforthedegreeBachelorofOralHealthSciences
Khensani Patricia Duma
Dean's MeritListBachelorof Pharmacy Year4:
Citationforachieving an average of75%inthefourth yearofstudyforthedegree ofBachelorof Pharmacy. Boitumelo Pretty Malapane
Henrietta StockdaleFloatingTrophyforNursing:
Thisprize isawarded tothe studentwhoachievesthe highestlevelofprofessionalmaturity duringthefour-year Nursing degree.
Rensche Petronella Du Plessis
JockGearMemorialAwardforNursing:
AwardedtothefinalyearNursingstudentwhohas achieved ahigh levelofclinical competence and provided meritoriousserviceincaringforclients and patientsin bothcommunityand hospitalsettings. Claireece Carise Beiling
LesterBrownMedalfor MeritinMaxillo-Facial&OralSurgery:
Thismedalisawardedto thefinal yeardentalstudent adjudgedthe mostdistinguishedinMaxillo-Facialand Oral Surgery.
Emma Köster
Nestlé Prize inMidwifery II:
Thisprizeisawardedtothe finalyearNursingstudent adjudgedthemostdistinguishedinthecourseofMidwifery. Claireece Carise Beiling
OHASA/Oral-BAward:
Thisprizeis awardedannuallytothefinalyearstudent inthe BachelorofOralHealth Sciencesadjudgedthe most distinguished inthecourse Fundamentals ofClinicalOralHygieneIII.
Khensani Patricia Duma
Operative DentistryMedaloftheSouthAfricanDentalAssociation:
Thisprize isawarded tothe mostdistinguished final yearstudentinRestorative Dentistry.
Ammaarah Sujee
OrthodonticsBronzeMedaloftheSouthAfricanDentalAssociation:
Thisprize isawarded tothe mostdistinguished student inthecourse,Orthodontics.
Ammaarah Sujee
PeriodontologyPrize:
Thisprize isawarded tothe mostdistinguished final yearstudentinthecourse, Periodontology.
Emma Köster
Rousseau ViljoenMemorialPrizeinOral Medicine:
Thisprizeisawardedtothefifth-yeardentalstudentwhohasshownthegreatestpromiseinOralMedicine,orwho hasattained adistinction in thecourse.
Emma Köster
SidSetzer-MillnersPaedodonticMedal:
AwardedtothemostdistinguishedfinalyearstudentinClinicalPaediatricdentistry.
Teboho Macdonald Mokale
SouthAfrican Dental AssociationLeadership Medal:
Awardedannuallytothe DentalGraduandwhoisdeemedtohavehada satisfactory undergraduatecareerandto havedisplayedconspicuousleadership qualities,characterand sportsmanship. Stelios Markoulides
TheAnnAndrewAward:
Thisprize isawarded annuallyforthe beststudentin MedicalCellBiologyIII. Robyn Erin Duncan
TheJCAllanHonoursAward:
Thisprize isawarded tothe beststudent in the BachelorofHealth Scienceswith Honours inHuman Biology. Rosa Pisanti
OFFICERSOFTHEUNIVERSITY
Chancellor
DRNJ DLAMINIMBChB(Natal)DOH(Free State)MBA(Witwatersrand)DBL(Unisa)PGCE(Witwatersrand)IEC (Stanford-USA)
Vice-Chancellorand Principal
PROFESSORZ VILAKAZI BSc(Manchester)MScPhD(Witwatersrand)FRS, FAAS, MASSAf
Chairman of Council
MRI SHONGWE BA(Wesleyan)MPhil(Oxford)
Senior Deputy Vice-Chancellor (Academic)
PROFESSOR ROSMAN BA(Witwatersrand)HDipEd BEd(Unisa)MEd PhD(Witwatersrand) MASSAf
DeputyVice-Chancellor (Research andInnovation)
PROFESSOR LMORRIS BSc(Hons)(Witwatersrand)DPhil(Oxford)FRSSAFAAS MASSAf
DeputyVice-Chancellor (SystemsandOperations)
PROFESSOR IRJANDRELLBSc(Eng)GDE PhD(Witwatersrand)IntPE(SA)PrEngFSAAEFSAIEE SMIEEE
DeputyVice-Chancellor (People Developmentand Culture)
PROFESSORGSTEVENSBA(CapeTown)BAPsychHonsMPsych(WesternCape)DLittetPhil(Unisa),MASSAf
Registrar
MSCG CROSLEYBAHDipEd(Witwatersrand)BEd Hons(Unisa)MEd(Witwatersrand)
ChiefFinancialOfficer
MSMMMANYAMACA(SA)BComAccounting(CapeTown)BComptHons(Unisa)BComHonsTaxation(Pretoria) MBA(GIBS)
DeanofStudentAffairs
MRJAPSEPTEMBER BA MPhil (CapeTown)
DEANSOFTHE FACULTIES
FacultyofCommerce,LawandManagement
PROFESSORJCOHEN BComHonsPhD(Witwatersrand)
FacultyofEngineering andtheBuiltEnvironment
PROFESSORT MAJOZIBScEngMScEng(Natal) PhD(UMIST)CEngPrEngFIChemEFAASMASSAfFWISA FSAAE
FacultyofHealthSciences
PROFESSOR SAMADHI MBBCh MMed PhD(Witwatersrand)FCPaeds(SA)MASSAf,RSSAf, TWAS,CBE
FacultyofHumanities
PROFESSOR MMUSEMWA BAHons(Zimbabwe) MA(CapeTown) PhD(Minnesota, USA)MASSAf
FacultyofScience
PROFESSOR NCHETTY BScHons(Natal)MS PhD (U.IllinoisUrbana-Champaign) MASSAf, MSAIP
President of Convocation
MSKMUFAMADI BALLBLLM(Witwatersrand)
FACULTYOFHEALTHSCIENCES
The Faculty of Health Sciences at the University of Witwatersrand in Johannesburg, South Africa has been established for more than 100 years and is regarded as one of most reputable institutions for health sciences education in sub-SaharanAfrica.
RankedbytheShanghaiRankingsinthetop300intheworldinsubjectrankingsforclinicalmedicineandthetop70 in the world in subject rankings for public health, the faculty holds its own amongst the top 400 universities internationally and preparesstudentsforafuture inthehealthcaresectoracross theglobe.
As South Africa’s largest and most comprehensive health sciences faculty, with over 7000 registered students, it offers undergraduate degrees in dentistry, medicine, medical and health sciences, nursing, occupational therapy, physiotherapy and pharmacy. It also offers a graduate entry medical and physiotherapy programme, Masters degreesinscienceand medicineanda PhDprogramme.
Teaching programmes in the faculty are student-centred, internationally recognised, socially responsive and exemplify excellence in all dimensions. More than 1200 health sciences professionals graduate each year and are sought-afternationally,regionallyandglobally.
The faculty provides excellent support and an intellectually stimulating environment for postgraduate study. Significantly, the Faculty has increased its postgraduate output significantly in the last five years and boasts excellent postgraduatesupervisors who participate in cutting-edgeresearch in clinical,appliedand basicsciences, providing fertile and varied fieldsofresearchto undertake.
The Faculty of Health Sciences is home to one Nobel Prize Winner;seven research intensive Schools; nine NRF A-rated scientists; twoDepartment of Science & Innovation (formerly the Department of Science and Technology) andtheNationalResearchFoundation’sCentresofExcellence(DSI-NRFCoEs);twoAfricanNetworkforDrugand Diagnostics Innovation Centres (ANDI) and to eight Department of Science and Technology/National Research Foundation South African Research Chairs. There are currently 28 research entities based in the Faculty and two Research Thrusts (Diseases of Lifestyle and Molecular Biosciences). The quality of the Faculty’s research output ranks amongst the best in the country and is respected internationally. The faculty publishes more than 2000 researchpapers eachyear.
AnumberofprogrammesforthetrainingofthenextgenerationofacademicsareprovidedthroughtheFaculty.One suchprogrammeisCARTA(ConsortiumforAdvancedResearchTraininginAfrica),amulti-disciplinaryprogramme aimedatgrowingprofessional,academicandresearchcapacityinAfricainthefieldofpublicandpopulationhealth. Its Pan-African focus of research includes reproductive health and sexuality as well as killer diseases in Africa, notablyTB,HIVand malaria.
One of seven Schools in the Faculty of Health Sciences, the School of Clinical Medicine is the largest with nine departments and about 40 divisions, which include sub-specialities. The School trains undergraduate and postgraduate students across a number of teaching platforms, including Chris Hani Baragwanath Hospital, the largest hospital on the Africa continent. Training is also undertaken at the Charlotte Maxeke Johannesburg Academic Hospital, the Helen Joseph Academic Hospital and the Rahima Moosa Hospital as well as 20 additional hospitals and clinics throughout Gauteng. The School prides itself on its high throughput of Bachelor of Medicine andBachelorofSurgerystudents.Ithasthreerecognisedresearchcentres,withtheCentreforRuralHealthandthe Steve Biko Bioethics Centre for Medical Bioethics being pillars of the Faculty’s social accountability stance, addressingmatters of accesstohealthcare forall SouthAfricans.
The School of Public Health enjoys an exceptional national and international reputation in teaching, research, academicserviceand partnerships.
Full-timeacademicsintheSchoolaredrawnfromdifferentdisciplinarybackgroundsthatrangefromthesocialtothe bio-medical sciences, enhancing multi-disciplinary approaches essential for public health. The School’s academic activities are also supported by more than 100 honorary staff members The School has an impressive research recordand hoststwo MRC researchunits, the AgincourtRuralPublic Health and HealthTransitions ResearchUnit (Agincourt) and the Centre for Health Policy (CHP), both of which are internationally renowned with a long track recordofsupportingtransformationinitiativestoimprovepopulationhealthandtheperformanceofthehealthsector. PRICELESS SA (Priority Cost Effective Lessons for Systems Strengthening South Africa) has produced translational researchdirectlyimpacting health policy inthe salt and sugar areas inSouthAfrica
The School of Therapeutic Sciences provides high-quality professional education for pharmacists, nurses, occupational therapists and physiotherapists who continue to make significant contributions to the national health sector by rendering professional services. With a focus on health and wellness, and exercise rehabilitation the School also prepares individuals for careers in biokinetics, exercise science and sports medicine. As a significant contributor to research excellence and output at the University, the School continues to produce meaningful research that serves communities, such as through its involvement with the Wits Research Institute for Malaria whichprovidesanenvironmenttoenhancegroundbreakingresearchintooneofAfrica’sdeadliestdiseases,andthe Wits Advanced Drug Delivery Platform (WADDP) Research Unit which conducts and delivers innovative drug delivery research solutions such as RapiDiss Wafer Technology. Other research initiatives have contributed to the understanding ofhumanmovement,sportsmedicineandsportseducation.
TheSchool of Pathology provides excellence in pathology in the form of service, teaching and research and contributes to the public health in South Africa through the provision of cost-effective, high-quality diagnostic laboratory services to the public sector. Research departments support diagnostic services and contribute to basic researchintheunderstandingofdiseaseprocesseswhilstalsoallowingforR&Dtyperesearch.TheSchoolteaches at both undergraduate and postgraduate levels. The School is home to a number of highly successful research entities including the Antiviral Gene Therapy Research Unit, the Wits Vaccines and Infectious Diseases Analytics ResearchUnit, and the HIV PathogenesisResearchUnit.
TheSchool of Oral Health Sciences is a leader in dental education on the continent graduating dentists, oral hygienistsandspecialiststomakeasignificantcontributiontotheoralhealthofthecommunity.Trainingisprimarily undertaken at the Wits Dental Hospital, located within the Charlotte Maxeke Johannesburg Academic Hospital Primary dental care is provided comprehensively by the undergraduate students of the School, who are under the closesupervisionofexperiencedfacultymembers.TheSchoolalsosupportsextensiveoralhealthcareservicesto distant communities, through initiatives such as The Transnet-Phelophepa Health Care Train, hosted by the TransnetFoundationandviaMobileDentalUnits.
TheSchoolofPhysiology isthelargestentityteachingphysiologyinSouth Africa,andprobablyonthecontinent. It plays a significant role in the training of physiologists; some of its graduates hold high-profile and prestigious appointments in South Africa and throughout the world. Indeed, its graduates can be found as academic staff in many universities teaching physiology in South Africa and overseas. The School is well known locally and internationally for the outstanding quality of its teaching and research and includes top-rated scientists as well as manyexpertsrenownedworldwideintheirfields.EveryyeartheSchoolisproudtobe“home”toundergraduateand postgraduatestudentsof bothhumanand animalphysiology.
Theoldest School in the Faculty, the School of Anatomical Sciences undertakes studies in morphological anatomy, structural biology (histology), and biological anthropology. Undergraduate students are instructed on the structureand development ofthe humanbody,inadditionto humanbiologyandcellbiology. Researchactivitiesof the School are broad, covering the fields of Biological Anthropology, Comparative Neurosciences, Adult Neurogenesis, and Reproductive Biology. The recently formed Human Variation and Identification Research Unit (HIRU) offers a professional forensic anthropological and archaeological service of the highest international standard.
EmergencyandFirePlansduringGraduations
1.Intheeventof anemergencyand/orfire:
• The presiding official (Chancellor/Vice-Chancellor/Deputy Vice-Chancellor) will make an announcement requesting guests, graduandsandstaff tokeepcalm andremainseated;
• TheUsherswillassistgueststoproceedtothenearestEmergencyexitsinordertoevacuatetheGreatHall inanorderlyfashion;
• Emergencyexitsignsarevisibleinredaboveallexitdoorssituatedonyourleftandrighthandsidesaswell asthe backoftheHall;
• TheUsherswillassisttheelderly and disabledguests outofthebuilding;
• Theacademicprocessiononstage must exitthroughthebackstagedoor;
• OnceoutsidetheGreatHallallguests,graduandsandstaffmustproceedtothemainassemblypointonthe piazza.
2.Intheeventof a Bomb threat
All bomb threats will be treated as real in order to protect lives and property and the premises will be evacuated immediately.
A MESSAGE TO GRADUATES FROM THE PRESIDENT OF CONVOCATION
Dear Wits Graduate,
There are a few defining moments in life – and it is without doubt that graduation is one of them!
Today, you enter the world as a graduate from one of the top universities on the African continent. You enter into a world filled with many challenges, but a world that is also filled with limitless possibilities. May you meet all the challenges and opportunities that await you with pride, drive, passion, innovation, social-conscience and positive-purpose.
In addition to earning the degree conferred upon you today, you have also earned the right to be associated with a special group of individuals – the Convocation of Wits University. Convocation represents all the degreed graduates of Wits and forms a vital link between the University and the global community in which it operates. Membership to Convocation is free and serves as an official channel, allowing you, the members, to convey to the University management your views about the University. This membership comes with several unique privileges, which include nominating the Chancellor of the University. The Convocation Executive has two members on the Wits Council (the governing body of the University) and maintains other regular contact with the University to ensure the voice of the Convocation is represented at the highest levels of The University.
There are approximately 200 000 Wits alumni worldwide. The distinction of our university is important to the prestige of our collective qualifications. We call upon you to nurture and enhance the value of your degree by promoting Wits’ image, preserving our values, and contributing towards our ongoing development, ensuring that we grow in stature as a globally competitive, proudly South African institution of higher learning. Please engage with us via our numerous social media channels and keep connected with us so you can access career support, receive invitations to events and reunions and have sight of all the latest news about Wits and prominent Witsies: www.wits.ac.za/alumni/updateyourdetails/
I would like to extend a warm welcome to you – you are now a #Witsie4Life!
Ms Kgomotso Mufamadi President of Convocation Wits University
Convocation is a statutory body that includes all graduates of the University. Convocation is the largest constituency of the University (since the founding of the University in 1922, graduates number over 200 000). Its statutory mandate is to “… discuss and state its opinion upon any matters relating to the University including matters referred to it by the Council” and allows for the views of graduates to be represented at the highest levels of governance of the University.
IHELE THE PROCESSION
IHELE
Words and music by S.B.P. Mnomiya
Anhom
Falalala
Obani labo?
Baphi Ahhom?
Ngibona beza
Beyikazela
Bathwel ‘ongiyane
Bavela kuphi na?
Obani labo?
Ongqondongqondo
Osibakhulu
Yibo labo hhom!
Yini na leyo?
Ihele
Ihele lezingwazi zakithi
Ahhom udwendwe
Ahhom
Udwendwe lwezingqwele zakithi
Nant’ ihele
Longqondongqondo
Nant’ ihele
Losibakhulu
Udwendwe
Udwendwe Iwezingqwele zakithi
THE PROCESSION
Who are those?
Which, Falalala?
I see them coming
Walking with swinging garments
They are wearing head rings
Where do they come from?
Who are those?
They are people with knowledge
They are people in authority
These are the ones
What is that?
It is a procession
A procession of our heroes
It is a procession
A procession of our champions
Here is a procession
Of people of knowledge
Here is a procession
Of people of knowledge
A procession
A procession of our heroes
Ihele is known as the ‘Black’ Gaudeamus Igitur. In song, the writer, Mnomiya uses very poetic language to describe a graduation ceremony. The soloist sings of the ‘strange’ procession of people in long robes and head gear. The choir responds by saying that these people are academics who read profound books of knowledge.
Mnomiya goes on to say that the graduates are an inspiration to all of us, and we will also graduate like them one day. The song goes on to wish the graduates well and it ends with a resounding “Halala” (well done!).
THE UNIVERSITY MACE
Maces were originally weapons of defence, designed to break through armour. In medieval times, bishops carried a mace instead of a sword into battle to enable them to defend themselves in accordance with the canonical rule that forbade a priest to shed blood. In time, the mace has come to be regarded as a symbol of delegated authority vested in a person or an institution. At this University, it is a symbol of the authority vested in the Chancellor and a reminder of the mandate given by the legislature of this country to the University to grant degrees.
The University mace is the work of the Edinburgh designer, silversmith and engraver, William Kirk, who designed and made the mace of the University of Stirling and of other institutions. It is silver-and gold-plated, is 1070 millimetres long and 180 millimetres broad and weighs seven kilograms. The heraldic devices used in the decoration reflect the character of this University as an institution of learning, set in a mining centre within the Republic of South Africa.
The head of the mace with its spreading vertical blades is symbolic of the horns of a springbok. The central vertical spike is representative of a rock drill on the mine, and the amber stone set in the head is intended as a tribute to a past Chancellor through its association with his name, Bernstein, which in German means amber stone. The heavy quality of the head is consistent with the traditional concept of the mace as a weapon of defence. The collar repeats the shape of the head. It consists of eight cogs which symbolise the cog-wheel in the University coat of arms and represents mining and industry. The shaft is octagonal and divided into three sections. The coat of arms of the University is placed on the shaft under the collar. Below this the words Universitas Witwatersrandensis Johannesburgi: are inscribed, followed by the date in Roman numerals – MCMLXXVI (1977) – which signifies the year of the dedication of the mace.
The mace is a symbolic portrayal of this University, this city, the Witwatersrand and the Republic of South Africa. It is a constant reminder to members of Council and Senate to uphold at all times the rights, powers and privileges of the University and its governing bodies.
ACADEMIC DRESS
The academic dress of this University is patterned on that of the Universities of Oxford and Cambridge, with modifications based on the model of the University of London and certain individual features, particularly in the costumes of office bearers and the hoods of degreesof bachelor and master.
Dress for Office Bearers
• The Chancellor wears a scarlet silk gown with a broad facing of black velvet down each side, embroidered in gold and a black velvet cap with gold cord and tassels.
• The Vice-Chancellor and Principal wears a blue silk gown with a broad facing of gold silk down each side, embroidered in blue, the sleeves being lined with gold silk. The cap is of the same design as that of the Chancellor.
• The Chairman of Council wears a black silk gown with a broad facing of red velvet down each side and around the neck, the sleeves being lined with gold silk. The cap is of the same design as that of the Chancellor.
• The academic dress of the Deputy Vice-Chancellors and the Executive Directors is the same as that of the Vice-Chancellor and Principal, except that the colour of the facing and sleeves of the gown and of the cord and tassels of the cap is silver-grey.
• The gown of the President of Convocation is of blue silk, with a broad facing of gold silk down each side, the sleeves being lined with white silk. The cap is the same as that of the Chancellor, but with a blue cord and tassels.
• The Registrar wears a black silk gown with a broad facing of blue silk down each side, bordered with gold braid. The cap is the same as that of the President of Convocation.
• A member of Council wears a black silk gown with a broad facing of gold silk. The cap is the same as that of the Chancellor.
• The gown of the President of the Students’ Representative Council is black with a broad facing of blue satin.
Graduands’ Gowns
• The gowns for all degrees of bachelor and master of the University are black, of the same pattern as the gown for a Master of Arts at the University of Oxford.
• The gown for the degree of Doctor of Philosophy is scarlet, after the University of London pattern.
• The gown for a senior doctorate is the same as that for the PhD, but with a gold satin facing on each side of the gown and with the sleeve button and cord in gold.
The Academic Hood
The academic hood is the principal feature of the costume for holders of our degrees of bachelor and master. The hood for the PhD is standard, regardless of the Faculty in which the degree was obtained. It is scarlet silk, lined with white silk.
Degree Colours
The hoods reflect the colour or colours of a particular degree or associated degrees.
DISTINCTLY WITS
As a 100-year-old public university in South Africa, Wits is proud of its record of achievement as a significant contributor to our society. We contribute people to society that are training in their chosen field that are engaged and able to tackle problems using evidence-based solutions. We also contribute knowledge that has a positive impact on the quality of life. Wits for Good.
Wits is a world-class research university based on our intellectual excellence, international competitiveness, and commitment to social justice; all of which have a measurable impact.
What makes Wits distinct? Here are a few of many differentiators:
• An international perspective that helps us maintain high standards in teaching and learning and research while not distracting us from our place in Johannesburg, South Africa, and Africa. 60% out our 2021 publications included international collaborators.
• An intellectual hub of Africa, a founding member of the African Research University Alliance. In 2021 Wits published 167 articles with Namibia, 220 with Botswana, 326 with Zimbabwe and 137 with Mozambique.
• An active and engaged community leader that takes a stand on social issues and is fully committed to the advancement of the public good.
• A growing contribution to the body of knowledge through peer reviewed academic publications: 4 400 in 2021 and an average growth rate of 500 per year over the last five years.
• Knowledge contribution that is above global quality averages in several fields including: clinical and pre-clinical health studies (76% above global norms); arts and humanities (58% above global norms); life sciences (36% above global norms); physical sciences (12% above global norms).
• Wits is particularly associated with the study of the fields of virology, particle physics and the Higgs Boson, malaria, archaeology, paleontology, paleoanthropology, violence, local and regional politics, geochemistry, rock mechanics, deep mining, forensic anthropology, climate change, migration, social justice, and many more.
• Proud of the four Nobel laureates and the 98 Rhodes Scholars.
• Proud of our current 40 000 students of whom 16 000 (40%) are undertaking postgraduate studies and learning to make their own unique contributions to the global knowledge base.
• Proud of our 200 000 graduates. More than 90% of Wits graduates obtain permanent employment within 12 months of graduation.
• Proud of its ability to raise external funding to support and drive its research efforts, with contributions exceeding R 2 billion per annum.
