Uytgh

Page 128

757 YOUR SCHEME NEW SEASON! INSPIRING IDEAS AMAZING PRICES SEPTEMBER 2022DECORATING SHOPPING FOOD MAKING STYLING Creative looks for every room THRIFTY CHIC WIN! SOFA SET, NURSERY FURNITURE, BLINDS & MORE! CUT YOUR BILLS, SAVVY STORAGE & MORE THE HOTTEST AW22 TRENDS YOU’LL LOVE DESIGN THE PERFECT HOME OFFICE DIY PROJECTS FOR A WEEKEND, A DAY, OR AN HOUR BUDGET & ECO-FRIENDLY DECOR E X P E RT A DV I C EEXPERT ADVICE OF£4,190PRIZESTOWIN Quick recipes for dinner in a dash We’ve filled our rental home withcoloursjoyful GET COSY FOR AUTUMN SWITCH UP decorgeniusideas FROM£3.50 GREATVALUEHOMESMAG How to furnitureupcycleyourselfBest buys from the high street and beyond homesReal & makeovers 6

to

from you! 18 14 6370

to

it

a

HomeStyle cover star? A creative home and a smile is all you need! Take a quick snap of yourself in your favourite room and email it to us at homestyle@ourmedia.co.uk. We can’t

here’s a new season around the corner, and for homes lovers like us, that means one thing – amazing new trends to look forward to! Check out our edit of the most exciting Autumn/Winter 2022 looks (p63), and affordable ways to recreate the look in your home. Another key trend that’s on the rise is sustainable style – if you’re keen to make more eco-friendly choices, you’ll find a round-up of gorgeous green buys on page 84, plus a cheat sheet for what to remember when you’re at the shops and you see a piece that you love, but you can’t tell if it’s environmentally friendly or not. One certain way to reduce your impact on the planet is to refresh tired furniture, rather than buying new – learn all the skills you need with this month’s upcycling challenge on page 112. It will save you money too! Speaking of savings, over on page 88 you’ll find 10 quick and easy ways to cut your electricity bill (and next month we’ll help you to slash your heating usage too!).

Get in touch T ED’SSEPTEMBERPICKS ISSUE! Welcome to our COULD YOU BE OUR NEXT COVER STAR? Reckon you’ve got

WEBSITE yourhomestyle.uk FACEBOOK facebook.com/homestylemaguk TWITTER @homestylemaguk INSTAGRAM @homestylemaguk PINTEREST pinterest.com/your_home_style PS. Don,t miss the next issue On sale 1st September – see what’s

This issue’s real homes belong to an especially savvy bunch. We’ve two sets of renters – our cover star Leila and her girlfriend Fleur (p48) as well as artist Denise (p36) and her family – who have transformed their homes with loads of creative hacks that can be easily reversed when they leave. And for some seriously stunning room redos, flip to page 94. I particularly like Helen’s compact kitchen-diner – the way that she has squeezed so much style into the tiny space is almost as impressive as how little she spent on it! coming up on page 91 what takes be future wait hear

4 yourhomestyle.uk STYLINGDECORATING,&LIVING 14 The wish list Our favourite high-street home buys 18 Things to do in September Welcome in autumn with foraged finds, spruce up your stationery and discover local gems 21 Colour crush Dial up smokey, sultry, coffee bean hues with glam details 63 Decorator’s moodboards This month we warm ourselves on the hottest AW22 trends 70 One problem room, two new looks Bringing magic to a child’s bedroom 74 Tick tock Refresh your space in three time slots 80 Work it, baby! Create the ultimate WFH space 84 The green room How to balance style with environmentally smart choices 88 Say watt? Tips to save on your electricity bill READER HOMES 24 ‘Our electic home has timeless style’ Katie mixes old with new and adds in a large dose of vibrant colour 36 ‘I love the Japandi vibe in my house’ Savvy renter Denise has used all the tricks to create a stylish home 48 ‘We’ve filled our home with colour’ Bright hues and smart, space-saving solutions make Leila and Fleur’s rented property their own unique space MAKEOVERS 94 ‘My tiny space pops with colour’ With only a small budget, Helen has transformed her modest kitchen-diner 100 ‘This is my happy place’ Filled with treasured gifts, Sarah’s sitting room has become a retreat 106 ‘Finally, I have my dream sanctuary’ Technology helped Amy achieve the bathroom she’d always wanted SHOPPING 08 Shop the high street Our best-buy edit for September 16 Style insider Going around in circles with spheres 32 Vintage floral Be bold with your blooms 48 122 80 Contents

September 2022 5 Contents 44 Artfully curated Go high-end with sculptural pieces 56 Golden hour Be cheerful with sunny hues 98 Pop & pattern Mix and match prints and colours 104 Global luxe Travel-inspired buys for your home 110 Savvy storage Be clutter free and stylish! 119 Home tech Spruce up with handheld steamers, it’s the gadget you never knew you couldn’t live without! MAKING 34 Pink pampas Dip dye your fronds 46 Vintage vase An easy hack to rejuvenate an old vase with paint and baking powder 58 Painted leaf cushion A botanical design for plant lovers 112 Bright bureau Give a tatty desk a colourful update COOKING 120 Foodie corner New buys, books and bloggers 122 Midweek meals Get thrifty with leftovers 124 Eats from the street Food to be held and devoured REGULARS 60 Subscribe and receive... A Sara Miller travel wallet 62 #myHShome Your pics take centre stage 90 Reader offer Save 25 per cent on Kukoon Rugs! 91 Next issue A sneaky peek at the October edition 114 Ask the experts Your home-based queries answered 117 Savvy home solutions Top tips for a smooth-running home 128 Shopping guide Where to buy all the products featured in this month’s issue 130 In conversation with... Elizabeth Scarlett Petrides Founder of her own homeware brand 70 94 112 84 PRIZES TO WIN On our cover Plus 92 Win! A stylish nursery set from Ickle Bubba 59 Win! Make My Blinds dressings & Triton shower 57 Win! Sofa and chair from ScS worth £2,698!

HANNAH TRIBE Features Editor

HMNQQJIFQQKWTRYMJXFRJYFUQYJWJIXUFWPQNSL\FYJWȂ

KATIE DUTTON

hot and cold. Add a Cube

‘I am so excited about the Hint of a Tint look on page 66. It’s cosy, but also light and fresh – it’s such an inspiring combo.’

With a in your always have 100 °C alongside regular and you will also have

kitchen you

Get to know the HomeStyle editorial crew, and find out which AW22 trend they are most excited about…

CATRIONA BURNS Staff Writer

Take a tour of artist Denise Pop’s home on page 36… ‘I’m so maximalismhappyisback. I love to display all of my collections, layer patterns and add even more character to my space. This trend is all about being bold and I will definitely jump in.’

‘I’m loving the increase in eco-friendly materials – cork, plywood and bamboo are all perfect for chillier months!’

Senior Production Editor

boiling water

KEY CONTRIBUTORS Staff Writer

Quooker

‘I adore The Collector trend on page 64 – it’s so moody and the dramatic wallpapers have got me planning feature walls.’

The tap that does it all 100°C BOILING, CHILLED AND SPARKLING WATER

MEET THE TEAM

And here are a few of the people we couldn’t have made this issue without…

‘The iced coffee-themed Colour Crush on page 21 has inspired my autumn revamp plans. I will glam it up with gold and brass.’ KATIE NICHOLLS

This upcyclingmonth’schallenge(p112)issetbyourfabulousformerEditor-in-Chief, Anna-Lisa De’Ath ‘I love The Collector trend (p64)! The rich colours and fabrics are perfect for winter. Plus, it’s a great excuse to display my vintage finds.’

We talk to Elizabeth Scarlett Petrides, designer for her own homewares brand, on page 130… ‘I’m looking forward to deep colours and plush textures. I’ll be swapping out any bright pops for inky blues and rich rusts to create a cosy and tranquil haven.’

Xxxxxxxxxxxxxxxx The tap that does it all 100°C BOILING, CHILLED AND SPARKLING WATER Interested? Book a virtual experience with a Quooker expert. You control the appointment and what you see. For further details and to book your appointment, scan the QR code or visit quooker.co.uk EditorEDITORIAL Kirstie Duhig Art Editor Emily Waite Deputy Art Editor Olivia Watkins Features Editor Catriona Burns Senior Production Editor Katie Nicholls Staff Writers Hannah Tribe & Katie Dutton Senior Digital Editor Debbie Graham Digital Editor Rebecca Messina Digital Writer Thea Jeffreys Special thanks Chris Borgman Group Acting Editor Mel Sherwood ADVERTISING Group Advertising Manager Laura Jones Advertising Manager Heather Golden Business Development Manager Phil Wallington, phil.wallington@ourmedia.co.uk Brand Sales Executives James Beckett, james.beckett@ourmedia.co.uk Ava Holdstock, ava.holdstock@ourmedia.co.uk Classified Sales Executive Alex Armstrong Ad Co-ordinator Bryony Grace Senior Ad Designers Andrew Hobson, Cee Pike MARKETING AND PRODUCTION Subscriptions Director Jacky Perales-Morris Direct Marketing Executive Emma Hunter Director of Licensing and Syndication Tim Hudson Syndication Manager Richard Bentley Production Director Sarah Powell Production Manager Emily Mounter Production Co-ordinators Lauren Morris, Georgia Tolley PR Manager Toby Hicks ManagingPUBLISHINGDirectorMarie Davies Head of Brand Marketing Rosa Sherwood Group Managing Director Andy Marshall CEO Tom Bureau CONTACT HomeStyle at Our Media Ltd, Eagle House, Bristol BS1 4ST Advertising enquiries: Tel: 0117 300 8805 Subscription enquiries: Email: buysubscriptions.com/contact Tel: UK 03330 162 139; US/Canada: 855 827 8639 (toll free); Rest of the world +44(0)1604 973748 Editorial enquiries Email: homestyle@ourmedia.co.uk Tel: 0117 927 9009 © Our Media Ltd (an Immediate Group Company) 2022, member of the Audit Bureau of Circulations. Unsolicited manuscripts and transparencies are accepted on the understanding that the publisher incurs no liability for their storage or return. The contents of this magazine may not be reproduced without permission. All prices are correct at the time of going to press. The publisher, editor and authors accept no responsibility in respect of any products, goods or services that may be advertised or referred to in this issue or for any errors, omissions, misstatements or mistakes in any such advertisements or references. HomeStyle is published by Our Media Ltd (an Immediate Group Company), Eagle House, Bristol, BS1 4ST, UK. Every effort has been made to secure permission for copyright material. In the event of any material being used inadvertently, or where it proved impossible to trace the copyright owner, acknowledgment will be made in a future issue. Our Media Ltd is working to ensure that all of its paper is sourced from well-managed forests. This magazine can be recycled. We abide by IPSO’s rules and regulations. To give feedback about our magazines, please visit immediate.co.uk, email editorialcomplaints@ immediate.co.uk or write to Legal Director, Immediate Media Co, Vineyard House, 44 Brook Green, London, W6 7BT.

8 yourhomestyle.uk HIGHDunelm STREET SHOP THE Here’s our pick of the best bargain buys the high street and web have to offer SHAPING UP This range gives a nod to the geometric patterns and dark wooden shades of the Seventies, along with a modern colour palette of bold corals and earthy greens Elements Alva walnut stained dining table, £469; Elements Alva dining chairs, natural fabric, £149 each; Elements Alva benches, natural fabric, £169 each; Tollose five light ceiling fitting, £115; Olle rug, from £39, all Dunelm Elements Lokke cushion, £12 Elements Skara vase, 28cm, £20 Luxe MoroccanTravellertray, 32cm, £28 Elements coloured glass mirror, 70cm, £50 Luxe Traveller Nolan ribbed glass table lamp, £22

September 2022 9 Best-buy edit HOW TO style the look 1Invest in quality wooden furniture, like this mid-century-inspired set. You can adapt and switch up the style through the years with interesting tableware, lighting and chair cushions. 2 For a bold punch of colour, add a large feature rug under your dining table. Or, for a more creative approach, why not try making your own wall mural? For inspo, search ‘how to paint a wall mural’ at yourhomestyle.uk. Feature DuttonKatie Debenhams.com DAYDREAMING Keep the sunshine alive with this bright and cheerful collection featuring bold pastels and cut-out shapes Cosmo king duvet set, Debenhams.com£55,DesignForLifeHector duvet set, from £32 Pastel check cushion, £15 Hestia leaf side table, Egyptian£100cotton bath sheets, from £10 Orient & Amber cork lidded candle, £10

10 yourhomestyle.uk Kimono, £19; basket with handles, £9; Yoga rug, £25, all Vårdande range at IKEA IKEA CONSCIOUS CARE IKEA’s new Vårdande range has been created in partnership with five social enterprise businesses in Bangladesh, Thailand, India and Vietnam. Many of the items are made materialssustainablefromtoo Basket potpourriwith , £3 Poster, £5 Plant pot, £5 Yoga rug, £25

September 2022 11 Best-buy edit George Home 1 This range focuses on self-care practices. Promote calm by adding spa-like elements, such as an oil diffuser and a tinkling wind chime. 2 Focus on natural, sustainablymade furnishings and accessories. Bamboo, banana fibres and jute are three materials to look out for. HOW TO style the look DELI DELIGHTS Recreate the charm of a rustic café at home with these staple dining accessories Tortoise shell wine glasses, set of four, £14; Salter bamboo paddle chopping board, set of three, £15, all George Home decorationHanging , £7 Green goblet wine glasses, set of four, £12 Natural diamond macramé cushion, £12 Natural water hyacinth planters, from £20 Green reactive glaze 12-piece dinner set, £34

The Infinity Plus Milano Contour in Castle Rock Matt kitchen has the perfect mix of luxe design and family-friendly storage for Anna, Phil and their two daughters

‘When we saw this kitchen in the Wren showroom, it was love at first sight!’ 12 yourhomestyle.uk

Ten years later, though, they realised the layout wasn’t working for them anymore. Instead of the existing separate rooms, they wanted a social, open-plan space that incorporated a kitchen, dining area and lounge to relax in with their daughters, Libby, 13 and Polly, eight. After a few recommendations from friends, the couple decided to go to Wren. They visited the local Bolton showroom with an open mind, and immediately fell for one of the kitchens they saw on display when they walked in. ‘It was love at first sight,’ smiles Anna. So, they sat down with Wren designer, Tom, to talk through how to tailor the showroom kitchen to their space, style and needs.

Feature GradyMichelle

For more inspiration, search #wrenovation

INSTANT APPEAL As their Manchester home had been renovated just before they bought it in 2009, Anna and Phil decided to live with it as it was.

Anna and Phil knew this sleek, dramatic kitchen was for them as soon as they saw it, so their designer helped them to make it work for their family home

W hen choosing a new kitchen, finding the right balance between style and practicality to create a scheme that works for busy family life can be tricky. That’s where the experts at Wren come in – the knowledgeable designers work with you to create a kitchen that will transform the way you use your home. Need a layout that makes the most of the space, with lots of stylish storage solutions? Wren can help, as Anna and her husband Phil discovered. They wanted a sleek kitchen in which they could spend quality time with their daughters. Wren helped them create a space that does that, but also has the dark, dramatic look they envisaged. Here, as part of the #wrenovation series, which showcases real customer kitchen renovations, we explain how.

Advertisement feature September 2022 13 good job; it looks like the fridge is meant to be there.’ Another of Tom’s suggestions turned out to be one of the family’s favourite parts of the kitchen – rather than a solid island, he incorporated a breakfast bar into the design. ‘We love that element,’ says Anna.

A big island and breakfast bar give the family plenty of space for food prep and socialising, with an easy-to-clean concrete worktop

EASY LIVING

Thanks to the 3D render of their kitchen that Tom created, Anna and Phil could easily visualise how the final layout would look. ‘It gave us a great idea of the space and how everything would fit together,’ Anna says. The delivery and fitting was as seamless as the design process: ‘Phil did it himself as he’s quite handy and has helped other friends with kitchen fitting,’ Anna explains. ‘He didn’t experience any issues as delivery was on time and the instructions were very clear.’ Anna and Phil are happy that their finished kitchen not only looks the part but is easy to maintain – a must with two children. As a keen cook, Anna loves the induction hob because The couple wanted a minimalist feel, with units across one wall and a large island. They saw a few colour options at the showroom, but the charcoal-grey Castle Rock Matt colourway with copper profiles stood out to them. ‘The colour is gorgeous. It changes in different light, and it’s very dramatic and classy,’ Anna says. ‘I still look at it and think that we made a great selection.’

A DESIGNER’S EYE

The couple were glad of the designer’s expertise throughout the renovation. They weren’t sure where to place the hob, so Tom presented them with a few options and talked them through the pros and cons of each. They also wanted to keep their original fridgefreezer, but were worried about it looking out of place, so asked Tom how best to integrate it into their design. He went above and beyond their expectations, adding tall units on each side and one across the top to ‘frame’ the fridge. Anna loved the idea: ‘He did a really ‘it’s easy to clean, and looks so sleek and lovely on the worktop,’ she says. ‘I also love the feel of the island. The concrete worktop looks amazing and doesn’t scratch.’ They’re glad they followed their hearts and chose the design they first fell in love with at the showroom: ‘We love it, as it’s quite different and works great for our family – it also gets a lot of compliments when we have friends over!’

The fridge-freezer is framed with cabinets to boost storage space

14 yourhomestyle.uk

cottonSamuel&linen cushion, £32,MADEMustard House Pink weave placemats, set of four, £32, MADE Malibu table light, white glass, £62, MADE British Colour Standard striped candles, set of six, £27, MADE Clam shell centrepiece, from £30; Duo Candelabra, from £25, both Sculpd Donut vase, fromSculpd£30, Mini shelfcosmetics , from £30, Sculpd lovewe

WAXING LYRICAL Candles are a key element when it comes to self-care and relaxation, and this was the inspiration for Melted Flames, a London-based indie brand founded during the pandemic. Initially just a hobby for Melted Flames founder, Stephany, candle-making soon became a full-time job, and the brand now stocks a range of stylish designs, each made in small batches. Sustainability is core to Melted Flames and all of its candles are vegan, free from additives and made with 100 per cent, ethically sourced cotton wicks. We love its Perfectly Imperfect collection too, where damaged candles are sold at a reduced rate, making it a totally waste-free brand. Shop its candles at meltedflames.com

New this month: exciting collections, collaborations, creations and more WE ARE LOVING... Looking to bring a blank corner to life? These bright and playful accessories from MADE are just the thing for adding depth and interest to a bare spot. Whether it’s a set of bold, geometric candles and placemats to spruce up your dinner table, or a glowing, cosy lamp to greet the darker evenings, sometimes all it takes is one or two key pieces to make your interior scheme shine! made.com

The Large bubble candles, £12 each, Melted Flames

PLAYFUL POTTERY Are you on the hunt for a specific accessory that you can’t pin down? Or perhaps the cost of a lust-worthy ornament is just too high. Well, clay crafting company Sculpd asks, ‘Why not make it yourself?’ The brand has released a second homeware collection after the success of its debut range, letting you create even more iconic homewares, such as a shell centrepiece, duo candelabra, two vase styles and a seriously cute cosmetics shelf. There’s a charm to owning unique, one-off pieces, and it’s even more special when those pieces are handmade. The clay kits range in price from £25 to £39 and can be bought at sculpd.co.uk

WISH LIST...

Feature DuttonKatie

Marble table lamp, £89; Abstract print, £65; Mystic rug, from £165, all Barker & Stonehouse MAXIMALIST BIBLE

BOUTIQUE BUYS: BARKER & STONEHOUSE Since it was founded in 1946, Barker & Stonehouse has aimed to deliver understated glamour to UK homes. From investment furniture to budget-friendly decorative features, its pieces ride trends and stand the test of time.

SECOND-HAND STYLE

Narchie, dubbed ‘the Depop of interiors’, is our new app obsession. With a simple news feed, similar to Instagram, you can follow and browse indie homeware brands, vintage shops and designers, and like and shop your favourite pieces. And, you can sell your wares on there too! The app champions second-hand homewares and sustainable style, so it’s a haven for eco-savvy design lovers. Download it for free on the Apple App Store or Google Play.

September 2022 15 Wish list SAVE VS SPLURGE Rattan headboards

We were super excited to discover Siobhan Murphy, one of our favourite contestants to come out of BBC’s Interior Design Masters, is releasing her debut book titled More Is More Décor this month. It’s a must-read for the‘It’sAscolourwhenandmaximalist-fansrulebreakersitcomestoandpattern.Siobhansays,timetoditchdrab!’

More is More Décor by MurphySiobhanisout on 18th August (£25, Bonnier Books Ltd) lovewe Petali vintage rattan headboard, £199, La Redoute Myla rug, from £95 bubbleGolden vase, £20 Coral dyed throw, Coral£29tufted cushion, £29 ceramicbrownDark vase, £36 Bali flora natural rattan headboard, £295, Oliver Bonas @studiogabrielleuk homewares, available on the Narchie app

Around the globe Cassini ceiling light shade in Matt Black, £25, Iconic Lights Moon light Brass Opal disk wall light, £79, houseof Totally stacked Triple bubble vase in Blue & Pink, £23, Sass & Belle Feature TribeHannah STYLE PERFECTINSIDERCIRCLE Join the merry-go-round and freshen up your look This tactile trend has been bubbling up since we first saw orb lights in Spring// Summer 2019 high-street collections. This season,, spheres are popping up everywhere from curvaceous candlesticks to playful vases to elegant footed bowls –– all perfectly formed circles to add a playful minimalist vibe to your home. Bowled over Raawii medium strøm bowl, £60, Fenwick Wiggly wonder Elements Viggo table lamp in Tiger Lily, £40, Dunelm Take a sip Skittle bottle in Navy and Coral, £20, Oliver Bonas Keep a lid on it Mairet glass trinket pot, £9.50, Oliver Bonas Holding the flame Julien candle holder, £11, Maisons du Monde 16 yourhomestyle.uk

Space Isn’t that what we all want? Here’s a way to create some. 21 stores | 0345 609 4455 | futoncompany.co.uk Experts in small space living

18 yourhomestyle.uk Easy updates and seasonal style ideas to try this month... WEEKEND PROJECT splendourAutumn Make the most of the changing season by bringing sculptural autumn foliage into your home. All you need is a heavy, empty vase and pretty branches from the garden. You could also gather a few fallen sticks from parks and woodland – but be careful not to over forage as they’re an important part of the habitat. If your foraged finds are too heavy to stand in the vase, provide some support with pebbles. Septemberp THINGS TO DO IN... Parquet desk, £259; Baldwin table lamp in Mustard, £55, John Lewis & Partners

Take the plunge and turn your living room pink this autumn. Berry colours are set to be a huge trend at the end of the year, so you’ll already be halfway there. Head to yourhomestyle.uk and search for ‘Pink living room ideas’ to discover our top tips

Indulge your curious nature this month at open doors events taking part across the UK. You’ll be able to take a sneak peek at places that are rarely open to the public and find out more about the history of the space. It’s a great way to engage with the story of your local area and uncover untold secrets. Each nation is holding its own events, so head to cadw.gov.wales to find out what’s going on in Wales. Visit heritageopendays.org.uk to see the events in England. In Scotland, take a look at doorsopendays.org.uk and in Northern Ireland search for EHOD 2022

In the pink beautyBespokeDiscover

A new leaf

It’s time to start lighting candles and fires to create a golden glow as evenings gradually start to darken. Elevate your fireside style with a beautiful box of matches that you won’t want to hide away. When you’ve used them all up, fill the fancy packaging with ordinary safety versions – we won’t tell if you don’t!

QUICK WIN Base unit with two doors, from £245 each, base tower unit, from £280 each, foam seat pad, from £310, The Dormy House Be inspired by the hidden stories waiting to be uncovered at hundreds of open doors events

Are big coats and jackets taking over your hallway? Well we know how you feel! Turn down the volume on your bulky coats with clever, customised furniture. Try out The Dormy House‘s online design tool to turn its modular units into your dream hallway storage solution. You can even send them your own fabric to make the seat cushion, so you can create a perfectly co-ordinating, tailor-made look, and all for less than you might expect.

PROBLEM SOLVED DAYS OUT YOURHOMESTYLE STYLE SWITCH Sunflower luxury matches, £6.95, Annabel James Cheekybudgettrick Night Sky display book, £2.50; A4 project book, £4; lever arch file, £2.50, all Wilko

Nothing says ‘September’ like the smell of a new pencil case. Spruce up your stationery with Wilko’s Night Sky collection. We love the autumnal, witchy vibe and the positive mantras that will help to cast a spell of productivity.

Angelic three-seater sofa in pink, £499, DFS

Feature TribeHannah Photo

Strike a light

more

LaceyChrisDays,OpenHeritage

Xx September 2022 19 September at home

#ûnÓ ĄĄ×áªÓn×¥@á ª¥ü enª ªüìת¥ü ªÁ[ª   ·Ï¨eæ[ÝÓæQ n[ÝݨAóA AQ Ýö½$£ £nen ónÏö[ AÏ nÓ AöA·· ö½ Ðͳyé Ą áÓ /(WŏV0D.HG5\,Q*D E5H(]( ÐØy гÍy ãÜ» VDYHVSDFHZLWKRXUUHWUDFWDEOH ZDVKLQJOLQH

September 2022 21 Dial this earthy shade up with gold accents or blend it with rustic wooden furnishings ICED COFFEE Colour crush 1 1 Diamond Berber cushion, £16; footed tray, £8.50; tapered candle holder, £5; dinner candles, set of two, £2; tall woven vase, £25; wood tray, £12.50, all Matalan 2 Manhattan FSC eucalyptus rocking chair, £399, La Redoute 3 Dutchbone woody pendant lamp, £45, Cuckooland 4 Lilo tortoiseshell easy-fit pendant, £38, Dunelm 5 Bellingham glass vase, Vintage Brown, £45, Cult Furniture 6 Orsen small sideboard, £329, Dunelm 7 Ajouter Squiggly and Bolt pillar soy candle, £20, Fy! 8 Charal storage jar, Smoke Brown, from £34.50, nkuku 9 Burnt Orange shapes framed art, £53, Abstract House 10 Drax Berber-style runner, £75, MADE Feature DuttonKatie 2 4 5 6 7 8 9 10 3

ACTRIONABURNS, HO M ES GENIE Fancy seeing your home here? Send a snap of yourself in your favourite room to Catriona at ourmedia.co.ukhomestyle@ 48 RAY OF SUNSHINE Fleur and Leila’s one-bed flat is bursting with colour FOREVER24HOME Katie turned a Victorian semi into her dream house Reader homes Get inspired by this month’s gorgeous real homes, packed with stunning ideas to steal! PLUSshopthe lo o k 32 44BEAUTIFUL3656BUNGALOW Renter Denise transformed her home with clever DIYs

TIMELESS STYLE Our

By lightening dark spaces, mixing old and new and bringing in vibrant colour, Katie Dawson has created a unique look in her home eclectic home has a Bespoke units from deVOL, wood-effect flooring by Camaro, a white Attica worktop by Caesarstone and plenty of colourful accessories create a kitchen-diner that is full of character and personality

and needed lots of love and attention, plus a brand new kitchen and bathroom. Matt wasn’t convinced, but I felt sure that we could make it work. We instantly fell in love with the wide hallway. Period houses like this often have dark and narrow hallways but ours is lovely and light. Décor-wise, we wanted a really eclectic, timeless style. We’re not particularly into the contemporary look as we like to create something truly personal to us.

Inspiring homes

WHERE I LIVE My home is a three-bedroom Victorian semi in Stamford, Lincolnshire. We moved here in 2016.

‘Six years, two children and a pandemic later, we’ve finally got it the way we like’

A BIT ABOUT ME

MY STORY Matt and I both grew up in Stamford, but had moved away, come back, and got together. First, we bought a two-bed terrace, which we did up from scratch. But it was on a busy road and not ideal for our dog, Luna. We were also thinking about having children, so we knew we’d need more space, and we didn’t want to be worrying every time we opened the front door. When we started looking around, we loved what this house offered in terms of the quieter location, the number of bedrooms and the possibility of creating a kitchen-diner. But it was very dark and dingy

The whole house was dark and dingy, and the back of the property needed a serious rework. The bathroom was totally unsuitable with a brick wall in front and a tiny window at the side.

Feature SmithStephanie Photos GilesDavid

WHAT I WANTED TO CHANGE

Six years, two children and a pandemic later, we’ve finally finished everything and got it the way that we like it. We can’t imagine ever moving again.

MY FAVOURITE PART I love the kitchen-diner. I really enjoy cooking and baking, so it was important for me to have a big space. I also adore the hallway now that I finally have my pink wall.

HOW I MADE IT MY OWN We created a big kitchen-diner by extending out into the garden while a roof lantern added light. We put a big new window in the bathroom and changed the sanitaryware. Then it was a case of bringing in vibrant colour on the walls and personalising the rooms with original artwork and accessories.

I’m Katie Dawson, 37, a homeware designer, katie-alice.co.uk. I live here with my partner, Matt, 37, co-owner of the business, and our daughters, Delilah, four, and Coco, 10 months, plus our dog, Luna.

TO MY HOME Welcome

Katie loves to display all her favourite kitchenware. Plus, it gives her more space for pendant lighting

26 yourhomestyle.uk

Kitchen-diner

The mix of old and new is highlighted with the old wooden dresser next to the contemporary blue metal unit from IKEA, which Katie uses to store vegetables. As well as the open shelves, where Katie displays cookbooks and favourite mugs, the dresser has plenty of storage for tableware

A stunning Limerence wallpaper mural by House of Hackney makes a dramatic statement in the kitchen-diner

VINTAGEFLORALSp32

‘The original kitchen was very dark and chopped in half by a strange section that stuck out and made the kitchen area far too small. Plus, the units were old-fashioned and falling apart. So, we extended outwards into the garden and brought in more light with a lantern window in the new part of the roof. Once we had removed the units, we could start again. I love mixing old and new, and we’d saved a dresser from our old house, plus a reasonably new range cooker, our aqua Smeg fridge-freezer and trusty vintage table and chairs. We built the kitchen around the recycled pieces and splashed out on new units, worktop and flooring, putting a large island in the middle of the room. I absolutely love the quartz worktop by Caesarstone as it looks like marble but is really easy to clean and totally heat-resistant. It’s great for taking shots of my products for my Instagram, @katie_alice_official.’

September 2022 27 Vogue Bernice wall light, Get Katie’s eclectic home style with these buys Steal my style ‘We divided up the kitchen-diner with a wallpapered section. I love how the dramatic foliage-themed design gives the impression that you’re sitting in a vintage conservatory, or in a garden’ ‘We loved the quieter location, the number of bedrooms and the possibility of creating a kitchen-diner’ Waves cushion, The Effortless Trading Co Blue bread bin, Dunelm

Living room

‘We wanted a big comfy sofa that could fit everyone. I saw a green velvet one that I loved in DFS and that really decided the colour scheme, although we then spent ages choosing the right green for the walls. In the end we decided to go dark with Duck Green by Farrow & Ball. I spent lots of time selecting the personal pieces for the room and created a mini gallery. I’ve also got an old Parker Knoll chair from my grandparents that I’ve reupholstered and a rug from my brother’s company, Roxy Rugs. They all mean something.’

By pairing a dark green sofa, the Jules Patterdale in Forest Green by DFS, with walls in Duck Green by Farrow & Ball, Katie has created a luxurious feel, while a vintage Moroccan rug adds texture, along with a leather footstool from MADE.com

Style idea Match your wall colour to the sofa for cosy vibes

Choose a base colour to cover all the walls first, something that the stencilled section will show up against clearly.

Choose the colours you want to use.

Katie selected a series of blue sample paint pots to create her leaves, rather than buying a big pot that she didn’t need. It’s also an opportunity to bring in several colours at Rememberonce.to have a ladder handy to reach the tops of the walls.

Paint a room to create the illusion of wallpaper, just like Katie

Hallway

The couple spent ages choosing the right wall colour but went with Cinder Rose by Farrow & Ball in the end. ‘We chose the deep green for the living room first, but we wanted something that went with it when the door was open. Pink and green are made for each other.’ After failing to find a decorator, Matt did most of the painting himself.

Inspiring homes September 2022 29

The former cloakroom has been transformed into a toilet space. Katie hand-painted the wall, creating a wallpaper effect. ‘With small children it’s handy to have a downstairs loo,’ says Katie, ‘but they don’t need to be dull’. The finishing touch was the artisan tiles that Katie has used as a splashback. ‘I spotted these gorgeous tile samples in Liberty. I only needed a few, so I splashed out.’

‘I admired this ballerina picture at a friend’s house. Years later, they unexpectedly gave it to me’ Katie spotted the distressed chest in her local vintage shop, Foxtail Lily. ‘I knew it was just what this corner needed,’ she says Katie used Farrow & Ball Arsenic on the walls, and she fitted a shelf in the alcove to display favourite books, jugs and candles

Make your own stencil with tracing paper. If you’re painting small details, like leaves on a big surface, go for a piece with several cut-out sections, all slightly different shapes so you can choose to vary the pattern if you want to.

‘The hall was the last space to be completed, which makes sense because when you’re decorating other rooms you’re traipsing in and out all the time, so it can get ruined before you’ve finished.’

Downstairs toilet

Stencil walls

HOW TO...

Making every corner and space special, Katie has added a mini gallery of favourite pictures up the staircase

PINK p34PAMPAS make

Once the walls are dry, draw out your stencils on the wall in pencil so you have a good idea of how many designs there are and how close together they should be.

Katie’s love of mixing old and new can be seen with the vintage mirror above the contemporary shelf.

‘I wanted our bedroom to be calm and relaxing, so I avoided colour on the walls, and just went for a neutral off-white and matching painted floorboards.’ Katie couldn’t leave colour out altogether, and invested in a vibrant bedspread from Anthropologie, as well as painting the fireplace bright yellow. ‘I’ve slowly put up my favourite pictures over the bed and added in a few accessories so it’s a joy to walk in here every evening.’

30 yourhomestyle.uk

The Delissa quilt from Anthropologie was Katie’s statement buy for her Wilson bed from Next. She’s picked out some of the colours in accessories, as well as the rug from Roxy Rugs

Delilah,sbedroom

Decorating the IKEA bed with a canopy from Dunelm makes this a special space. The rug from Roxy Rugs ties in with the Old Garden Majvillan wallpaper from Wallpaper Direct Style idea

‘This used to be our bedroom before we had the kids and it’s at the back of the house. I wanted to make it a room that could grow with Delilah, and something she (and we) wouldn’t get bored with.’ Painting the walls in Farrow & Ball’s Peignoir was the starting point, while a Victorian-style metal bed ties in with the age of the house. ‘I wanted to do something different with one wall, and found some lovely Swedish wallpaper, Majvillan, with a range called Old Garden, which really appealed to me, and I found a rug to match. I wanted it to be a long-lasting room, but I was keen to add in fun elements for Delilah to enjoy now. I added a canopy over the bed, plus some cute cushions, including her favourite flower-shaped one from Dunelm.’

Add easy colour with a statement quilt

‘We’re big fans of Japanese design and we had a fantastic trip there a few years ago, so a lot of the artwork in our bedroom is from Japan. I’ve had the vintage Ercol chair for years and I teamed it with a bright yellow cushion from John Lewis & Partners’

Master bedroom

A roll-top bath from the Cast Iron Bath Company is the focal point of the bathroom, which Katie painted in Marine Blue by Little Greene

September 2022 31

‘Coco’s cot is the Stamford mini by Obaby. I upholstered the chair, in fabric from Madder Cutch & Co’ ‘We like to trulysomethingcreatepersonaltous’ homes

WHAT I LEARNED...

Coco,s bedroom

Bathroom

‘It’s surprisingly easy to turn a piece of furniture into a vanity unit. We painted the legs of this old school desk in Little Greene’s Marine Blue’

Inspiring

Check your timings so you can manage your expectations. We had a long delay to the kitchen because we had to wait for the screed to dry before we could lay the floor. It took a few weeks longer than we had hoped and it nearly broke us at one point, to be honest. This meant that the kitchen couldn’t be fitted until the floor was laid. See yourhomestyle.uk for more great real homes

Accept help from friends and family! My dad, Stan, did all the wallpapering and assisted with DIY jobs while my mum, Pat, brought me all her pattern books for wallpaper and fabrics.

Katie painted the walls in Farrow & Ball’s Smoked Trout left over from the kitchen. ‘I like to have continuity with colours throughout the house,’ she says. After putting up contemporary shelving, Katie added some personal touches. ‘I made the weaving above Coco’s cot. I bought a cheap loom from Etsy and a pattern book and used some wool that I had already had plus some extra chunky pieces.’

Try to have a vision of how a room will look before you start. We love to mix old and new, but it’s a delicate process.

‘When we moved in, the bathroom had an awful layout. The problem was that, from the doorway, you looked at a brick wall as there was no window in the wall in front of you and a tiny one on another wall. After clearing everything out, we put in a new window. I’d always wanted some dramatic patterned floor tiles and we fell in love with this design from Mosaic del Sur in shades of bright blue and mustard, which are two of my favourite colours. Brass fittings and lights were the finishing touch.’

Feature TribeHannah VINTAGE FLOR AL Life’s a bed of roses when you decorate with bold blooms, just like Katie lovewe Style idea Bouquets on deep backgrounds are ideal for winter 1 Vibrant floral shaped rug, from £199, Joe Browns 2 John Lewis & Partners + Matthew Williamson Leo Rose tapered lampshade, from £40, John Lewis & Partners 3 Blooming Margaret dinner plate, £14.99, Katie Alice 4 Leikny cushion cover, £5, IKEA 5 Pink Bouquet garland, £12, East End Press 6 Nathalie Lété Mon Coeur chopping board, £29.99, Oklahoma 7 Antique Rose pillowcases, £20 for set of two, Cath Kidston 8 Bee recipe tin, £19.99, Lola Design Ltd 9 Floral beaded coasters, £12.99 for set of four, M&Co 10 English Rose cream jug, £14, David Austin Roses 1 2 4 6 7 8 3 10 5 9 32 yourhomestyle.uk hop the look...

LOOKING TO RENOVATE YOUR HOME? At Cedral we believe in building beautiful, lasting homes. With striking facades that exceed the highest standards, we help you create a home [ M X L E TI VJIG X½ RMWL X LE X[ M PPP EW X E P M JI X M Q I Find out more and request your free sample at cedral.world 01283 501555infouk@etexgroup.com

1 Create an area where the fronds can hang upside down to drip after they’ve been dyed. These drips will stain surfaces so it’s best if you can find a place outdoors. If you don’t have a garden or balcony, place a bucket under each frond to catch the drops.

2 Put on your rubber gloves then prepare your chosen dye according to the packet instructions. It’s best to do this in a bucket or a stainless-steel sink.

Make your fronds fabulous, like Katie, by giving them a new wash of colour.

4 Leave the fronds submerged for 30 minutes so that the dye has a chance to absorb into the pampas.

5 Take the fronds out of the dye bath and place them into an empty bucket. This will help you to transport them. Then hang each one to dry. This can take up to a week.

3 Dip the damp fronds into the dye bath. Rotate them to ensure the fluffy tips get completely covered.

6 To speed up the drying process you can use a hair dryer on a low to medium heat. It’s sensible to wait until the fronds have stopped dripping before you do this, as the spray will dye. To be on the safe side, direct the stream of air downwards onto a dust sheet.

7 Once dry, it’s time to fluff up your fronds. Start by gently teasing them apart with your fingers, then use the hairdryer to give them a final flourish to make them as splendid as possible!

Top tip Paler shades of pampas will produce brighter results

Try it with on-trend pastels, or get set for autumn with rich jewel tones

You will need ł natural pampas fronds ł hand dye, such as Dylon or Rit ł rubber gloves ł buckets

34 yourhomestyle.uk Make TribeHannah Photo GilesDavid Make the look... DYED PAMPAS

Bespoke furniture makers, Parker Howley & Co, understands just how much bathrooms, and the furniture in them, can impact our day to day. As the UK’s number 1 manufacturer of bespoke vanity units, it uses the finest American prime grade oak, tulipwood and oak dovetailed drawers to create a timeless yet contemporary range combining clever storage with stylish design. All lovingly hand-crafted by a team of experienced cabinet makers in Yorkshire, Parker Howley & Co’s custom-made creations are handmade to your specifications, so you can be guaranteed a vanity unity that’s as unique as you. And for those finishing touches, the company works with all the big bathroom brands, so you can easily pick out a basin, tap, mirror and lights to complement your piece. Not only does the company specialise in other bathroom furniture, including WC units and tallboys, it also makes tailor-made kitchen islands, lounge and bedroom furniture and more, so you can bring timeless charm and contemporary design to every room in your home. Find out more at parkerhowleynco.co.uk, or speak to a member of the team on 0333 444 0406.

Bespokedesigns bathroom

Using traditional carpentry methods, it’s easy to turn design ideas into a reality and create stunning pieces of custom-made furniture for your home. When Parker Howley & Co says it can do anything bespoke, it means it!

September 2022 35 Advertisement feature

A s the place where we start and end our day – from getting our glam on ahead of that allimportant work meeting to brushing our teeth before bed – the bathroom is one of the most important rooms in the home.

Parker Howley & Co, Unit 10a Bankfield Business Park, Huddersfield Road, Mirfield, WF14 9DQ Traditional craftsmanship meets contemporary design in Parker Howley & Co’s stunning vanity units

Long-term renter, Denise Pop, has used all the tricks of the trade to create a stylish space that reflects her artistic style FOR A JAPANDI VIBE I blended nature and texture ABSTRACT ART p44

Inspiring homes TO MY HOME Welcome

I painted the kitchen tiles white and wrapped the wood-effect worktops with white contact paper. I had a hunch that there was original parquet flooring, so I ripped up the carpets and, thankfully, I was right, though I did need to sand and stain the wood. Most of our furniture is secondhand or DIY upcycles, though we did invest in our classic sofa, as I know it’s something that we’ll keep for years and we can take it with us if we ever move. I’d never say the house is completely ‘finished’ as I’m always looking for new ways to update it and make it feel unique, but so far I’m really pleased that we’ve created a happy family home.

WHAT I WANTED TO CHANGE Without spending too much money, I wanted to personalise the space. I couldn’t wait to take up the carpets and reveal the wooden floors. HOW I MADE IT MY OWN I concentrated on easy, renter-friendly updates, such as changing door knobs, laying down rugs and using peel-andstick tiles; I did invest in sanding the living room floors though.

MY STORY We’ve rented in the UK since moving here from Romania 10 years ago. We were initially living in a one-bedroom flat, but when the children came along, we needed a bigger place. When we viewed this bungalow, I thought the bathroom and kitchen were quite small, but I loved the bright and airy living room. The house was really clean, which isn’t always the case with rentals, and it was already painted in this lovely stone colour, so that was a bonus. Even though we rent, it’s really important for me to personalise a space so that it feels like our home. I spoke to the landlord about my DIY ideas, which luckily they agreed to.

‘Add interest to a neutral colour scheme with unique pieces of furniture, like these second-hand chairs that I found on eBay. Everyone loves them and they are my most-liked piece of furniture on Instagram. I made this coffee table by attaching plastic pipes to the bottom of a dismantled second-hand dining table, and then I covered it with two layers of wood filler to add a textured finish. The sofa is from MADE.com’

Style idea Position a swing arm lamp over a sofa for adjustable task lighting

WHERE I LIVE Our home is a rented three-bedroom Seventies bungalow in Maidenhead, Berkshire. We’ve lived here since January 2021 and I’ve recorded our interiors journey on my Instagram @sculptureyourhome.

A BIT ABOUT ME I’m Denise Pop, 29 and I’m an artist. I live with my husband, Augustin, 41, who owns a construction company, and our two children, Sofia, seven, and Enoch, who is four.

stylingandFeature MosesLisa Photos WatsonJaneKatie

MY FAVOURITE PART The calmness of our bedroom; it’s my sanctuary. I also love the living room because it includes my favourite elements; a muted colour palette full of art and sculpture.

Bali hand chair & Teak

, Rattan

‘If I could only keep one thing from my home, it would be sculptures.the I bought the lips and eyes from Etsy, but I always keep a look out for unique pieces at places Homesense’like apleasedreally‘I’mthatwe’vecreatedhappyfamilyhome’

Aftas jute rug, La Redoute Dinah table lamp, Dunelm

Always check for imperfections and if necessary, ask for more photos. Make sure that you have exact measurements, particularly if you want a piece of furniture to fit a certain spot in a room. If you are going to pick something up, take someone with you, or make sure that you share the full address and pick-up time and location with a friend or family member. Also, have a quick read of a seller’s reviews to spot any red flags.

Buy second-hand Shop pre-loved and be kind to the planet and your purse

TEXTURED VASE p46 make

Get Denise’s cool and calm home style with these buys Steal my style

HOW TO...

‘This cabinet came from Facebook Marketplace and I’m still deciding what to do with it. I try not to rush a project as I know it will happen in time’

For example, words that are regularly misspelled will be harder to find and so they will have fewer bids. Look for items near your home that are easy to pick up, and if you have transport or you can hire a van, keep an eye out for anything tagged as ‘pick up only’, as often these go for a song because a lot of people want items that can be delivered.

38 yourhomestyle.uk

Put alerts on your phone if you’re looking for something specific, and have a five-minute scroll at the start or end of each day to check out any new listings.

There are lots of brand new items, often unwanted gifts, selling at a fraction of the original cost, so take a look at anything tagged as brand-new-in-box (BNIB) or brand-new-with-tags (BNWT). Be clever with keywords to grab a real bargain.

Living room

‘Being an artist, I really love colour, but I’m not so keen on having too much in my home as I like a calm, cosy space. I was pleased that this house was already decorated in this lovely, muted colour as I would have chosen something like this myself, and it saved me a job. We splurged on the sofa as we wanted to invest in quality seating that would last, so we chose a classic style that will hopefully suit our future homes. I really wanted linen curtains but my budget wouldn’t stretch. Then I spotted a dust sheet that Augustin had brought home from work. At only £10 per large sheet, I knew it would give me the look I was after and the curtains I made from it actually look really expensive.'

Dining area

‘These IKEA chairs were bought years ago in a sale for £30 each. They are solid wood and such a classic design that I knew they wouldn’t go out of fashion, so we kept them in storage until we had a place big enough to make the most of them’

Inspiring homes September 2022 39

‘I would have liked a bigger kitchen as we love entertaining, but we are lucky to have this big space for dining. When we first moved in, we had very little furniture as our last place was much smaller, but I’m a real bargain hunter and I’ve filled our home with lots of second-hand pieces. This large wooden table was only £80 on Facebook Marketplace, though it took me a few months to find because I had an idea of what I wanted and didn’t want to compromise. I love the slightly pared-back Japandi look so I’ve incorporated its core elements of nature, symmetry and texture into my scheme. I would love to paint the doors, but luckily the wood complements the look, as do the bespoke pieces of art I’ve created in monochrome tones.’

Style idea Bring interest to a blank wall with a fire surround

‘Upcycling lamps with leftover acrylic paint is easy. I covered these £2 charity-shop shades with the same colour mixed with fabric conditioner’

‘I’m a real bargain hunter and I’ve filled our home with lots of second-hand pieces’

‘The kitchen has seen the most changes as the countertops were originally woodeffect laminate, the tiles were covered in a beige floral pattern, the knobs were silver and the floor was grey. As a long-term renter, I knew exactly what improvements I could make to reflect my taste, without spending a fortune. I find it’s always a good idea to make a moodboard for a landlord, showing how the changes will look, particularly for updates like painted tiles. They were happy for me to go ahead so I changed the door knobs, covered the worktops with white contact paper, and put peel-and-stick tiles on the floor; all quick and easy budget hacks that have completely transformed the look of the space.’

Kitchen

‘Augustin made the breakfast bar out of MDF. We have these bar stools from Dunelm on both sides so we can all eat here together, and as it’s moveable it will be easy to take with us’

homes September 2022 41

Hallway

‘Lots of rentals don’t have much outside space, so this beautiful garden was one of the main reasons we wanted to rent this house. It’s a really big area, which the children love, and because this is a bungalow, our bedroom and the living room have sliding doors that look onto it, which feels like a real luxury after living in a one-bedroom flat.’ Garden

‘I love the idea of pendants above an island but we don’t have lights here, so I’ve faked it by hanging these cheap shades, just £2.50 from B&M, from hooks to achieve the visual effect’

Head to yourhomestyle.uk for more inspirationstyling Garden ideas

‘We all absolutely love hanging out in the garden, so I created this cosy living area to maximise our time out here. The outdoor furniture is from B&Q and the rug is from Benuta’

Inspiring

‘The curtain [far right] was hung CommandusingHooks and a wooden dowel so that I didn’t damage the walls, which means no extra repairs when we eventually move out. The mirror is from IKEA, the rug is from Dunelm and the wall sconces are from H&M Home’

‘I needed decent storage and I wanted to hide the ugly radiator and wi-fi leads that were here, so I decided to design a unit, with room to hold all our shoes. I drew out my initial design on paper and after Augustin made the cabinet, I taped on the wooden shapes I’d made. I played around with the pattern before we committed to gluing them onto the front. I painted the unit in Valspar’s Cocoa Dust, and then styled the space with an oversized mirror, wall sconces and a stylish rug, all of which has transformed the dull space into a beautiful entrance.’

‘As a long-term renter, I knew what improvements I could make without spending a fortune’

‘The bedroom had been freshly painted when we moved in, but I wanted to accentuate the calm space, as this room is my escape from our busy lives. We bought the ottoman bed years ago and it’s great for storage. We made the headboard ourselves by stapling an IKEA throw over the old fabric. I’m not keen on the grey carpet, so to hide it I bought a cheap cream carpet remnant and had it edged; it covers the grey, looks expensive, and I can take it with me when I leave.’

Master bedroom

‘I bought the lamps from Wayfair years ago and they were originally glass. I wanted to change them but Augustin likes that they are touch lamps, so I painted them using baking soda mixed with paint, a popular Instagram hack that allows you to paint on glass’

Bathroom‘Augustin cleverly made the slide with a lip so that it just hooks over the side of the bunks, making it easy to move out of the room if necessary. The rug is from B&Q’ ‘I’ve used re-fillable pump containers from Amazon for bathroom products. It’s easy to top them up and helps add a touch of style to the room’

Always ask your landlord before doing any jobs that can’t be returned to the original state. In my opinion they often agree, because they also want their home to look good. If they say no, do some research, as there are so many temporary ideas available for renters nowadays that there is generally a solution for everything.

WHAT I LEARNED...

‘We’re lucky that the bathroom is classic white, as it’s easy to live with. I changed the knobs on the cabinet, and I also added renter-friendly hooks that peel off when you heat them with a hairdryer. There wasn’t originally space for a mirror, and it took time to come up with a solution because we weren’t allowed to put holes in the tiles. In the end, I decided to use the window ledge and glued a piece of wood to the back of the mirror, so it just sits on the ledge.’

‘When we first moved in to this house, we all slept together in the living room as we didn’t have any beds for the kids. So, Augustin decided to save some money and make the beds himself. We really wanted them to be fun, so I suggested a house bunk bed, and both of the children said they’d also love it to have a slide attached to the bed. It was such a fun project, though I had to do quite a bit of research to get a workable design. The slide is made from a piece of MDF that I painted with five layers of gloss varnish to make sure it worked properly. Everyone who comes round to the house has a go on it!’

Being on a budget is great for creativity. I’ve had to think outside the box to get the look I want, but being patient means I haven’t had to compromise.

See yourhomestyle.ukfor more great real homes

It’s worth making small investments in a rental property, such as sanding a floor or painting tiles. It’s your home after all, and you want it to look good and be a place that you want to spend time in.

Inspiring homes September 2022 43

Kids, bedroom

‘The bookshelves cost £1 from Facebook Marketplace. I painted them with leftovers, making this the cheapest piece of furniture we own'

44 yourhomestyle.uk Feature TribeHannah ARTFULLY CURATED Give your space the look of a high-end gallery, like Denise, with sculptural accessories lovewe hop the look... Style idea Use a muted colour palette to let the beauty of texturethroughshine 1 Churchgate solid wood apple ornament, £7.50, Dunelm 2 Pleated paper table lamp, £24.99, H&M Home 3 Dried flowers in white vase, £13, Matalan 4 Classic figure sculpture, £26, Next 5 Abigail Ahern Fago arm statue, £35, Freemans 6 Wooden chain ornament in Natural, £12, Habitat 7 Beija White pictures, £52.99 for set of two, Kave Home 8 Enstaka scented candle in Bonfire, £12, IKEA 9 Naia cement candle holder, £29.95, SKLUM 10 Unscented knot candle in Light Grey, £1.50, Primark 1 2 4 5 6 7 8 93 10

Whatever the Size! Maintenance free structures designed to suit your space requirements and lifestyle <8!ħ'2ধ32;3&';!-£-9'=-&'2; 231!ħ'8,3>£!8+'3891!££;,'683/'$; www.griffinglasshouses.comorcalluson01962772512 Perfect for your garden durable and so comfortable too, a Moduleo® floor is the perfect fit for family life. Discover more moduleo.co.ukat FLOORING TO MAKE IT FEEL LIKE HOME

Make the VASE

Make TribeHannah Photo WatsonJaneKatie Top tip

look... VINTAGE

You will need ł an old vase ł cotton wool ł nail varnish remover ł baking powder

1If your vase is very shiny, start off by sanding it. Be careful to avoid the dust and remember to wear a mask and a pair of goggles. Remove the dust from the surface using a damp cloth before you move on.

ł water-based paint in terracotta and off-white shades ł brushes ł plastic takeaway container ł sandpaper

2 Give your vase a really good clean with washing-up liquid and warm water. Once it’s dry, rub a cotton pad soaked in a little nail varnish over the whole surface. This will remove any grease or residue and prepare the vase for painting.

3 Pour a small amount of terracotta paint into the takeaway container, then add a teaspoon of baking powder. Mix it together and you’ll see it start to fluff up. Paint a little of this mixture onto the vase to check the effect. If you’d like it to be more textured, add more baking powder.

4 Give the vase a first coat of the terracotta paint, then wait for it to be touch dry before adding another layer if needed. Put the lid onto the plastic container between coats to prevent the paint drying out. Once your vase is completely dry, it’s time to create the effect.

5 Pour some white paint into another takeaway container and lightly dab a wide brush into it. You only want a tiny amount of paint on the bristles as this will enhance the texture of the terracotta layer. Apply the white paint in broad, sweeping motions and build up a look you love.

You can use any water-based paint including tester pots

Give a tired knick-knack a new lease of life with a distressed paint effect to create a gorgeous vessel with tonnes of character, just like Denise has

46 yourhomestyle.uk

Advertisement feature

Hemp curtains are a smart solution when it comes to temperature regulation, as hemp has naturally thermodynamic properties that keeps your room cool when it’s hot, and warm during colder months. This clever material is environmentally friendly, soft and tactile, making it a beautiful and practical option all year round. Other hi-tech solutions at Hillarys include solar-reflective pleated blinds, designed specifically for glass extensions and conservatories, alongside roof blinds that come with a motorised option, so you really can make the most of these extra spaces in your home.

HELP IS AT HAND

September 2022 47 Feature NichollsKatie

Too bright or too dark? Too hot or too cold? It’s easy to feel like Goldilocks when you’re trying to find a window dressing that’s just right.

Whatever your window dressing needs, Hillarys has a huge range of stylish made-to-measure options that will provide you with a smart solution to suit every room. With over 50 years of experience, Hillarys offers an in-home service and its teams of local advisors can provide tailored advice, as well as free measuring and fitting, so you’re guaranteed to get both the aesthetic and the practical fix that you’re looking for. Find more ideas at hillarys.co.uk/inspiration/ Tropical Garden Green Roller blind, from £73 (including measuring and fitting), Hillarys

Layering blinds is another great idea from Hillarys. Use a Roller blind as a base to help control and diffuse light levels during the day (this will also help to protect your furnishings against sun damage), then pair with a Roman blind with a blackout lining for a good night’s sleep.

Rest assured, Hillarys has a stylish solution to suit every room…

Voiles meanwhile are a gentle way to diffuse the light whilst keeping plenty of fresh brightness within a space, so you can still enjoy the sun without it becoming a nuisance.

BACK IN CONTROL During the warmer months our homes can be flooded with sunlight creating too much heat, while in winter heat loss is an expensive issue, so finding the right window dressing is key to achieving the balance between style and comfort. A thermal lining is a smart, year-round solution as it helps to protect against overheating in the summer and heat loss in the winter without it affecting your aesthetic.

EMBRACE THE NEW Shutters are a hot interiors trend right now. Superstylish and chic with a timeless look, shutters are also naturally insulating with flexibility to control light and maintain an ambient temperature. On warmer days, you can keep your windows open and tilt the louvres to let air circulate whilst filtering the sunlight and maintaining privacy – a perfect summer solution that can help to control noise too.

THE PERFECT FIT

OUR STORY

After graduating from university, we wanted to go back to our roots in South East London and get a place together. We had no deposit or furniture, so we moved in with Fleur’s parents, opened a joint account, and saved until we were in a position to look for a flat. This place was newly converted, and the kitchen and bathroom were clean and worked well, which any renter will tell you is top of the wishlist. Also, the neutral décor meant we could concentrate on putting our own personality on the place. Fleur’s yellow wingback chair set the tone for the transformation. Rather than paint the walls we chose colourful furniture and accessories and the first piece we bought together was a teal velvet sofa to take centre stage in the living room. We love mid-century furniture, so we invested in classic vintage pieces, but as storage is at a premium, every buy had to be multifunctional, even down to the dining table in the living room that doubles as a desk, but folds away to be almost unnoticeable when not in use. Lockdown gave us time to get creative, and we used our mutual love of yellow and pink to add some fun colour-blocking to the bedroom. Although we’re still discovering the flat’s full potential, we’re so happy that we’ve finally created a happy home that reflects our love of beautiful interiors.

We,ve filled our home with

Vibrant hues, space-saving solutions and classic vintage furniture make up Leila Davis and Fleur Finch’s unique rented flat

‘It was important for us to pair our colours well,’ says Leila, ‘so we used a colour wheel to find contrasting shades that also complement each other, and we are really pleased with how striking the teal and orange look together.’ The mirror is from Dunelm and the orange footstool is from B&M

COLOURSJOYFUL

TO OUR we sometimes have ideas, our

Inspiring homes

HOW WE MADE IT OUR OWN While Fleur introduced her love of colour and vintage furniture to the space, Leila concentrated on making the space work with clever small-space hacks and creative storage solutions.

HOMEWelcome ‘Although

different

tasteseachcomplementother’

stylingandFeature

WHERE WE LIVE Our home is a rented one-bedroom Victorian flat conversion in South East London. We moved here in July 2019, and we share our interiors journey on Instagram @casa_de_modelei.

WHAT WE WANTED TO CHANGE

MosesLisa Photos WatsonJaneKate

OUR FAVOURITE PART For Leila, it’s got to be the striking colour they put together in the living room. Fleur loves the elegant dressing table in the bedroom as it’s a reminder of a fun lockdown project that the couple did together.

A BIT ABOUT US We are Leila Davis, 26 (pictured left), a pole performer, instructor and manager of a pole dancing studio, and Fleur Finch (right), 25, a community engagement officer for a national LGBTQ charity.

After spending a year saving, it was important for us to finally create a home that would reflect both of our personalities. Luckily, this flat was a newly converted blank canvas, so we didn’t have to fight against previous owners’ décor or taste before adding our own style.

50 yourhomestyle.uk Choose fold-away furniture, such as wall-mounted tables, drop-leaf desks and nesting sets that can be stowed away with minimum effort. Go for multitasking furniture, including shoe benches, high sleeper beds with desks underneath and ottoman coffee tables.

Living room Style idea

A pot rack hung from a high ceiling is perfect for keeping pans out of the way, and store any cooking equipment you don’t use much on top of a kitchen cabinet to free up cupboard space. A small step stool will make access easy and can double as occasional extra seating.

Get smart with the space you have HOW TO...

Plump for furniture with legs; not only will this allow you to store things underneath, but it will also give the illusion of space. Use crates or boxes to store spare clothes on top of wardrobes and stylish baskets to house blankets and throws in un-used corners.

Go for wall-mounted lights to free up space on a bedside table; choose rise-and-fall lighting above the dining table to remove the need for table lamps, and go for Anglepoise-style lamps that can double as task or ambient lighting.

GOLDENp56HOUR

Use drawer dividers to organise underwear, socks or even make-up, and make the most of unused surfaces with simple but clever devices, such as an over-the-door storage rack.

‘We’d rather save and invest in a few quality pieces that add a unique touch to our home than rush and buy cheap.’

Fleur was thrilled when she found a beautiful teak coffee table. Although it wasn’t their cheapest buy, it’s solid teak, rather than the usual veneer, so if necessary it can be sanded back and re-oiled, making it a long-term investment. Plus, it’s got a handy shelf underneath where they keep books.

This gallery wall is important to Leila and Fleur as every image is a memory that showcases special times and good friends. Most of the frames are from Poundland, while the Strandmon chair is from IKEA‘Bold pops of colour are key to our look, but we also use plants to add shape and wood for texture, while keeping clutter to a minimum so we can showcase our favourite finds,’ says Leila.

Use tester pots to picturebog-standardupdateframes

C reatestorageeasy

The couple have used statement furniture, vibrant colours and clever hacks to make their rented flat feel like home. ‘We’ve created a cohesive space that reflects both our personalities,’ says Fleur

Inspiring homes September 2022 51

‘We splashed out on the George Clarke sofa, from Sofology, as an investment piece, but we are equally happy to accessorise with bargain cushions from Matalan and George Home,’ says Fleur

‘This book shelf was originally black but it didn’t suit the space so we spray-painted the metalwork white,’ says Fleur, who found the plant stand in a charity shop and painted it pink with leftovers. The rug is from MADE.com and the pink and gold plant pot is from Habitat

‘We initially brought in furniture and hung gallery displays to add easy colour that we could change at a whim’

‘I grew up in a tiny house, so my mum came up with clever storage ideas, which I’ve inherited,’ says Leila.

52 yourhomestyle.uk

Get Leila and Fleur’s vibrant home style with these buys Steal our style

Desenio,Bobby

‘This glass rack is a great space saver and it’s nice to show some pieces off’

AmalfiMatalanposter cushion, Ragged Rose

‘The green pan is from Aldi – we love to browse the middle isle there to grab a bargain. And it’s also where we’ve found a lot of our DIY tools,’ explains Fleur

‘The separate kitchen is what sold the flat to us,’ explains Fleur, ‘as most one-bedroom flats usually have a kitchen sidebar along a wall in the living room. The pale blue tiles and polished concrete-effect surfaces were another draw for us, plus the high ceilings and ample work surface make it the perfect space for cooking together. Storage is always a premium in small city flats, so we added extra shelving on the unused wall. As we love to inject a touch of luxe around the place, Leila sourced the gold-coloured Art Deco-style brackets and gold stemware rack, which freed up much-needed cupboard space for kitchenware that wasn’t so good looking. She also came up with clever ideas to organise the cupboards, such as shelf risers, drawer dividers and plate racks.’ Kitchen

Yellow plant pot,

Dining area

The couple have laid the table, which they bought on Facebook Marketplace, with their favourite pieces from Poole Pottery. The rug is from La Redoute and the folding Terje chairs are from IKEA

Because the flat is small, it needs to work hard on an everyday level to achieve everything the couple need from each room. Although they don’t have a large dining area, by planning the space carefully, and choosing multitasking furniture, the couple have created a mixed use zone. ‘Our vintage dropleaf table can be easily tucked away, yet we’ve had eight people around it for dinner,’ says Leila, ‘and we regularly use it to work from home. We simply move the rug and coffee table into the bedroom, open up both leaves on the table and there’s a dedicated dining room or office space.’

‘We ourbelievereallyplantsaregoodforwell-beingandmentalhealth’

54 yourhomestyle.uk

‘We didn’t want a divan bed because the space underneath is a prime spot for storing clothes and bedding,’ says Leila. ‘We chose this IKEA Nesttun frame because it’s fairly neutral so it will suit any kind of décor and styling we choose in the future’ ‘We found the G Plan dressing table and chair in the street; they were in a pretty bad way, but the shapes were so lovely that we couldn’t walk by and leave them. A bit of TLC and a lick of paint has tofromtransformedcompletelythem,forunder£10,’explainsLeila.‘WeboughtthewickerflowershelvesCrystalPalaceAntiquesandtheyarejustacutewayshowoffsomeofLeila’sperformanceshoes’saysFleur

‘Although we adore the paint design on the wall,’ Leila explains, ‘we started it during lockdown but caught Covid, and then a chunk of plaster fell off. In the end, Fleur had to use a cake slice to fill it as all the shops were shut, so it was quite a stressful project!’

‘Organising plenty of storage in the bedroom was essential as all our clothes were initially in black bags,’ says Fleur, ‘so Leila calculated exactly how much rail and drawer space we needed and then designed the wardrobe using IKEA’s online 3D planner.’ The couple love giving preloved furniture a new lease of life and used £3 tester pots to upcycle the dressing table, chair and wall mirror.

LEAF make idea Paint simple shapes in bright colours for an easy DIY feature wall

PRINTp58CUSHION

Bedroom

Style

‘The wardrobe is part of the Elvarli range at IKEA. It arrived in 35 boxes and took us three days to assemble, even with the help of friends, but it was worth it because it holds so much,’ says Leila

Inspiring homes September 2022 55

WHAT I LEARNED...

‘The bathroom was renovated just before we moved in,’ explains Fleur, ‘so everything in the room was brand new, which was a real bonus for us. The first thing we usually look out for in a rental is a decent bathroom with good water pressure. But because it’s tiled from floor to ceiling, it’s meant that there’s not much we can do to add character. We couldn’t hang any pictures or prints because we can’t put nails into the tiles, but the décor is completely neutral, so we simply use towels, bath mats and accessories, in our signature pink and yellow, to add colour and personality to the small space. Artificial plants are also an easy way to add colour and texture and renter-friendly stick-on hooks are a great device that are easy to remove when we leave.’

Bathroom

The mirrored cabinet is perfect for storing the couple’s bath products, but also allows light to bounce around the windowless room, helping the space feel light and bright

It’s okay to let your home slowly evolve with you. When we first moved in to this property, the flat looked very different, but we were on a budget and our furniture reflected that. As we’ve grown into the space, however, we’ve been able to invest in more quality items that we hope will be forever pieces. We agree with the adage, ‘Less is more’. We accept that we live in a small space, so although we would say that we are on the spectrum of maximalism, we also have a strict rule that if we want to replace a piece of furniture, then the old one is sold first to help pay for the new piece and to make more room to accommodate it. See yourhomestyle.uk for more great real homes ‘Our landlord is our biggest fan and he’s always keen to see what our projectlatestis’

56 yourhomestyle.uk Feature TribeHannah GOLDEN HOUR Strike a cheerful note, like Leila and Fleur, with warming, sunny hues lovewe 1 Double planter side table in Mustard, £28, Habitat 2 Calina Amber glass vase, £25, Oliver Bonas 3 Arvid wool rug in Orange, £299, Cult Furniture 4 Burnt Orange velvet quilted throw, £29.99, Homescapes 5 Riveria arch tray, £29.99, softstore.co 6 Round metal candle lantern, £17.99, tealight holder, £8.99, H&M Home 7 Sun wool and velvet cushion, £36, Quince & Cook 8 Earth Rainbow rug with tassels, £14.50, Sass & Belle 9 Henry Holland Spill The Beans Not The Coffee Amber glass mugs, £25 for two, Freemans Style idea Shades of terracotta, mustard and pink will give you a glow up1 2 4 5 6 7 8 9 3 hop the look...

ENTERTO

One lucky HomeStyle reader will win both the Abbey 3-seater sofa, worth £1,299, and snuggle chair, worth £1,399, in a colour of your choice! As it’s available in 11 shades, you’ll be able to match your seating to your overall interior design style. The 3-seater sofa is as comfy as it is stylish, providing ample space to lounge on and spend quality time with loved ones. The snuggle chair offers slightly more room than your standard design, offering an inviting space to curl up in with a cuppa and a good book. The 3-seater sofa and snuggle chair come with a 20-year frame guarantee, meaning they are built to stand the test of time and be stylish features in your living room for many years. To find out more about this sofa and other ScS products, visit scs.co.uk.

you

The Abbey sofa collection from ScS is a modern twist on the iconic Chesterfield design complete with classic features, such as buttoned fabric, roll-top arms, and an array of luxurious fabrics that will suit both period and modern homes.

WIN! WINNERLUCKY1 TERMS AND CONDITIONS Prize draw closes on

A sofa and snuggle chair from ScS, worth £2,698 2nd October at 23.59pm and must be 18 or over to enter. This prize draw is open to residents of the UK and Channel Islands only. The prize winner will be chosen at random. Delivery included. Find full terms and conditions under the ScS prize draw at yourhomestyle.uk/win

Closing

September 2022 57 Prize draw

seating worth

Stylish £2,698! It’s so easy! Go to yourhomestyle.uk click on the ‘Win’ tab, find the draw you want to enter and fill in your details. date 2nd2022October

4 Take a backing piece and turn over one long edge by 1cm and press. Repeat the fold to hide the raw edge, pin and then stitch along to hem. Repeat with the other backing piece. Lay out your painted front, right-side up. Lay your two backing pieces on top, right-side down, overlapping the seamed edges in the centre and lining up the raw edges on all sides. Pin the pieces together and stitch all the way around using a 1cm seam allowance

ł

ł Liquitex

ł

ł thread Make the look... PAINTED

3 Once you are happy with the look of your paintwork, start a series of leaves in the centre of the large square panel of fabric – use the main image as a guide for leaf shape, size and placement. Next, paint the stem down the centre using a smaller thin paintbrush – again, try to paint this as one long stroke if possible. Allow to dry fully.

This ‘envelope’ cushion cover has two smaller backing pieces to create a central opening in which to insert the cushion pad

ł

1 Cut out your fabric into one front panel measuring 44 x 44cm, and two backing panels measuring 30 x 44cm. Lay down a sheet of stiff cardboard to prevent your fabric from adhering to your work surface. Combine four parts acrylic medium to one part acrylic paint and stir until combined. Using a fabric medium helps to prevent colours from bleeding into the fabric .

You will need 0.5m quilting weight cotton fabric acrylic paint Professional Fabric Medium brushes cup and wooden stirrer stiff cardboard cushion pad: 40 x 40cm sewing pins sewing machine LEAF CUSHION

cover,

ł

5 Snip the excess fabric from the corners, turn through and then insert the pad to finish. This cover is washable by hand.

58 yourhomestyle.uk Make NugentHeather Photo WatsonJaneKate

ł

If you don’t have green fingers but love foliage, make this fantastic cushion just like Leila and Fleur to enjoy a fuss-free, low maintenance plant Helpful hint

ł

ł

ł

2 Take a spare piece of your cushion fabric and use a large round brush to test out the paint. Practise working each leaf as one stroke – press lightly for a narrow line and harder for a thicker line.

shower

See the makemyblinds.co.ukcollectionwholeat

One lucky winner will be able to choose from a huge range of blinds and curtains, from popular wooden designs to stylish Roman models, to practical roller and perfect-fit blinds for tricky windows and doors. The brand also offers electric blinds for smart home lovers, and with its fabulous new made-to-measure curtain collection Make My Blinds has window dressings for every taste, room and functionality imaginable.

Prize draw September 2022 59

It’s so easy! Head to yourhomestyle.uk, click on the ‘Win’ tab, find the draw you want to enter and fill in your details. Closing date 2nd October 2022

Enter online now for your chance to win £500 worth of beautiful blinds and curtains!

worth over £300!WIN!WIN! TO ENTER

Available in gloss white (£319.99) and gloss black (£328.99) the Amore DuElec™ has a slender riser rail that co-ordinates seamlessly with modern fixtures. It also offers an energy-efficient way to heat and use water for a cleaner conscience when showering. By heating instantly on demand, it avoids unnecessary wastage without compromising on performance.

*The winner will be sent an online voucher to be redeemed online, with free delivery included. **Installation not included. electric from Triton,

To find out more about Triton’s range of showers visit tritonshowers.co.uk

The stylish Amore DuElec™– the latest addition to Triton’s extensive range – combines contemporary looks with intuitive technology, and we’re offering HomeStyle readers the chance to win one of these chic and money-saving showers!**

To celebrate the upcoming launch of its new curtain range, we’ve teamed up with one of our favourite online window blind retailers, Make My Blinds, to offer HomeStyle readers a chance to win £500 worth of made-tomeasure blinds and curtains!*

The prize winners will be chosen at random. Find full terms and conditions under the desired prize draw page at yourhomestyle.uk/win.

TERMS AND CONDITIONS

Prize draw closes on 2nd October at 23.59pm and you must be 18 or over to enter. These prize draws are open to residents of the UK and Channel Islands only.

With a fixed, overhead rainfall drencher and handheld five-spray pattern shower head, it’s easy to customise your showering experience with the Amore DuElec™ by diverting water between the two luxurious options – or by using both together for an extra invigorating blast. Touch-activated controls, paired with an OLED display, make it easy to select your chosen power and temperature settings.

WINNERLUCKY1 WINNERSLUCKY2 AMAZING PRIZES UP FOR GRABS! Stylish window dressings from Make My Blinds, worth £500! A stylish new

SUBSCRIBING IS EASY: Send this coupon to: FREEPOST OUR MEDIA (please write in capitals) HomeStyle subscription order form: Yes! I would like to subscribe to HomeStyle magazine Payment options: UK Direct Debit – £28.99 every 13 issues + Sara Miller travel wallet and free delivery Your details Name Email**.................................................................................................................PostcodeAddressMobile..........................................................................................................................telephonenumber**........................................................................................................................................................................................................................................................................................................................................................ Please send HomeStyle as a gift to the person below Name ...............................................................................................................PostcodeAddressTelephone..........................................................................................................................number............................................................................................................................................................................................................................................. Instruction to your Bank or Building Society to pay by Direct Debit Please fill in the form and send to: FREEPOST IMMEDIATE MEDIA Name and full postal address of your Bank or Building Society Originators Identification Number 4 4 3 7 7 3 Instruction to your Bank or Building Society: Please pay APS RE Our Media Ltd Debits from the account detailed in this instruction subject to the safeguards assured by the Direct Debit Guarantee. I understand that this instruction may remain with APS RE Our Media Ltd and, if so, details will be passed electronically to my Bank / Building Society. To: The Manager Bank/Building Society Address Postcode Name(s) of Account Holder(s) Branch Sort Bank/BuildingCodeSociety Account Number Reference Number (for office use only) DateSignature(s)Banks and Building Societies may not accept Direct Debit Instructions for some types of account **DATA PROTECTION Keep in HomeStyletouchmagazine would love to email you with updates, special offers and promotions. Please tick here if you would like to receive these (You can unsubscribe at any time.) We’d also love to tell you about other offers and promotions from our publisher, Our Media Limited. If you’d rather not be contacted this way please tick here: Post Phone Your data will be held by Immediate Media Company Limited (a parent company of Our Media Limited). For information about how we protect your personal data, please read our privacy policy, it can be viewed online at www.immediate.co.uk/privacy-policy Subscription order form PROMO CODE: HSP81 For a year’s subscription [13 issues] UK cheque/credit card – £33 – saving 15% and Sara Miller travel wallet and free Europedelivery–€51 for 13 issues ROW – $68 for 13 issues US / Canada – $57 for 13 issues I enclose a cheque/postal order for £ ......................................................................................... made payable to Our Media Ltd. Please charge my Visa/Mastercard £ ............................................................................................ Name on card................................................................................................................... Card no ....................................................................................................................... Expiry CreditSignatureSecuritydate...................................................................................................................code(last3digitsonreverse)...........................................................................................................................................................................................................cardtransactionsarechargedin£sterlingandconvertedatcurrentrates. OTHER PAYMENTS TERMS AND CONDITIONS UK calls will cost the same as other standard fixed line numbers (starting 01 or 02) and are included as part of any inclusive or free minutes allowances (if offered by your phone tariff). Outside of free call packages call charges from mobile phones will cost between 3p and 55p per minute. Lines are open Mon to Fri 8am – 6pm and Sat 9am – 1pm. OFFER ENDS 1st September 2022 *25% saving + Sara Miller travel wallet is only available to UK residents paying by Direct Debit. Stock is subject to availability and HomeStyle reserves the right to substitute the gift for another item of similar value. The travel wallet will be sent separately within 28 days of payment. Your subscription will start with the next available issue. We’re here to help you create your dream home on a budget Save 25% on the shop price –paying only £28.99 every 13 issues by Direct Debit* Receive a Sara Miller travel wallet – worth £32! Never miss an issue of your favourite magazine filled with the best home inspiration SUBSCRIBER BENEFITS 

SARA TRAVELMILLERWALLETSubscribetoHHomeStylemagazinetodayandreceivea Stunning real homes & makeovers filled with ideas to inspire you! Affordable updates for every room SIMPLE WAYS TO SUBSCRIBE TODAY ONLINE AT www.buysubscriptions.com/HSP81 CALL ON 0330 135 8961 and quote HSP81 worthGift£32! introductorySPECIALoffer!

I’d describe our home as a vintage tick list, with a mix of rustic, cottage, French and Victorian features. Our living room sways more towards an elegant vintage theme, with warming peach tones and French antique-inspired furniture. Our cabinet and mantle are full of vintage finds, each with a story and sentiment behind them. My style, as well as my love of finding treasures for our home, has definitely been passed down to me by my gran. It’s something I have done since I was young!

I wanted my living room space to be warm and inviting; a place for me to relax and rest. I love the hygge vibe and boho décor plays a big part in my home too. I love natural wood textures, like rattan and cane, and pastel shades. I’ve just painted the walls with Pink Ground by Farrow & Ball and it’s made this corner cosy in the evenings and fresh during the day!

@myvintagethriftedhome

#myHShome Use the #myHShome hashtag on Instagram for your chance to appear on this very page! Show us your style! Upload your home shot to Instagram using #myHShome Congratulations to everyone featured in this month’s #myHShome – you’ve won a £25 voucher to spend online at funky-chunky-furniture.co.uk! Use our hashtag on Instagram to show us your fave room for your chance to win a prize next month. THROUGH THE AGES HEART OF THE HOME WINDOW WONDER SNUG AS A BUG Sponsored by... WIN A FUNKYVOUCHER!CHUNKYFURNITURECO

@lovescakeygoodness

62 yourhomestyle.uk

@bayardhouse_ We’ve been renovating our Edwardian home since 2019. We’ve done a lot of the work ourselves so it’s been a steep learning curve but we’ve still really enjoyed it. Our bathroom isn’t huge but it’s full of lovely original features, such as this beautiful diamond window. In fact, I fell in love with the house as soon as I saw it! We added a scaffold board shelf to display some of my accessories and upcycled the vanity unit with Hornblower paint by Frenchic.

@rachs_home_n_life

Creating a calm and inviting space was the priority when renovating our family home, and the kitchen was no exception. Using different textures and timeless styles are always key design moves for me. You can’t really go wrong with a Shaker-style kitchen and a traditional stone floor! I think combining new pieces with old finds has really helped to make the kitchen feel as comfortable and relaxing as any other area in our home, and that’s really important to me.

Style edit Feature TribeHannah 66 64 68 64 THE COLLECTOR Bell jars at the ready! This studious look is a treasure trove of natural wonders with a rich, cave-like colour scheme 66 HINT OF A TINT Snuggle up with a gently coloured look that’s full of soft texture and modern Scandi details 68 SPICED WINE Indulge in this fruity shade and its rich and luscious berry-tones topped with soothing teal touches DECORATOR’S MOODBOARDS This month we’re warming ourselves on the hottest Autumn/Winter 2022 interior trends

COLOUR PALETTE Studio G Fern Glade fabric in linen, £13.75 per m, Britannia Rose Upgrade this look with studious details, like bell jars and books Darwin sofa, £1,299; Warwick footstool, £429; NHM display cabinet, £199; NHM wooden tray, £15; NHM Meadow Black wallpaper, £12 per roll; Clara Green cushion, £14; Boston rug, from £35, all Dunelm Tales of Mythology wallpaper, £195 for three rolls; Arabian Vases framed prints, £162 each; Artisan floor lamp, £239, Mind the Gap Contour Into the deep Navy & White Oceanic textured wallpaper, £20, RaschB&Q Library Books wallpaper, £10.99 per roll, World of Wallpaper Dulux walls & ceilings silk emulsion paint in Emerald Glade, £20 per 2.5L, B&Q

September 2022 65 Style edit

Galerie Botanical wallpaper in 7343, £34.95 per roll, John Lewis & Partners Clarke & Clarke Papilio fabric in Mineral Linen, £56 per m, Your Stylish Home Organic Textures Jewel

Unleash your inner nerd with a bookish look inspired by TikTok’s dark academia trend

Tamar vinyl flooring in Seville Beige, £18.99 per sq m, Tapi Tiger duvet set, from £11; bedspread, £45;leopard duvet set, from £23; velvet cushions,£17 each; butterfly cushion, £12; frames, £4;planter, £22; palm tree, £36, all Matalan Walls & Ceilings silk emulsion paint in After Hours, £15 per 2.5L, Wilko AS Creation Jette flowers wallpaper in White, £18.99 per roll, World of Wallpaper

Butterflies Grey wallpaper, £37 per roll, Homebase GoodHome Helston naturaldark oak effect laminateflooring, £13 per sq m, B&Q Semaphore Mayflower tile, £39 per sq m, Claybrook

THE

HOW TO WORK THIS LOOK

OAchieve texture by adding patterns and prints that look like they’ve been pulled straight out of a school reference book. Think orderly lines of butterflies and bugs, detailed botanical illustrations and playful animals. Foliage is a key element to this look, so if you don’t have green fingers, include it in your wallpaper or fabric.

COLLECTOR

O Deep greens and blues evoke a calming atmosphere that’s ideal for concentrating on cosy autumn activities, whether that’s settling down with a copy of HomeStyle or enjoying your favourite Scandi drama. Don’t be afraid to delve into dark shades and offset the moody tones with warm highlights in ochre and mustard. The light from candles and warm white bulbs cast a comforting glow against dark walls and will help create snug vibes on winter evenings.

OA sweep of parquet-effect flooring will upgrade the scholastic vibe. For top marks, finish off with piles of vintage books.

O When we think of ‘cosy colours’, white isn’t usually in the running, but it’s time to reconsider this pale shade. With clever use of texture and light hues, you can take a plain white room from bare to beautiful.

HOW TO WORK THIS LOOK

66 yourhomestyle.uk

O Choose a base of off-white shades that have warm undertones. When making your selections, compare each one to brilliant white to help you see the delicate hints of colour more clearly. The whites in our moodboard have a touch of red in them, so we’ve paired them with soft greens for a subtle sense of contrast. If you prefer creamier shades, try a tinge of pale blue instead.

O Soft textiles are key to establishing an inviting atmosphere, regardless of the colour you’re working with. Pile up velvets, textured linen and faux fur for rich depth, irresistible warmth and the ultimate cosy vibe.

Flat matt paint in Felt Cute, £46 per 2.5L, Coat Paints Hebden curved sofa, from £1,495, Rose & Grey Natural Desert Cream cork flooring, £69.99 per sq m, Carpetright Classic wood panel wallpaper in white, £20 per roll, I Love Wallpaper Velour fabric by Prestigious Textiles, £38.50 per m, Jane Clayton Holden wood slat wallpaperNatural, £10.99 per roll,World of Wallpaper Soraya traditional circle rug in Silver, from £69, Dunelm

September 2022 67 Style edit HINT OF A TINT A touch of colour and plenty of texture are all you need to create a serene style COLOUR PALETTE Belmont hexagon wall and floor tiles in White with Green, £38.31 per sq m, Victorian Plumbing Ercol Teramo double bed frame, £1,079; Ercol Romana lamp table, £799; Furniture Village Wall paint in Cotswold Green, £55.95 per 2.5L, Annie Sloan Blush faux fur rug, £18, George Home Textured twill furnishingfabric in Ash Rose, £25per m, John Lewis & Partners Winter whites with warm undertones are as cosy as darker hues Galerie Loft plaster effect wallpaper in Terracotta, £38.95 per roll, Décor Supplies Carrara Bianca Esagono sheet vinyl flooring, £12.99 per sq m, Best 4 Flooring Heritage star tiles in White, £32.70 per sq m, Porcelain Superstore

68 yourhomestyle.uk

O Autumn is the season to make the most of berry tones, and they’ll keep you feeling snug all through the colder months. Tuscan reds and juicy purples are set to be bigger than ever this year, paired with light but sultry plaster pink for a well-rounded look.

O Modern minimalism focusses on small details and warm colours for an effect that is comforting as well as spacious. Keep clutter hidden away and use pattern sparingly to achieve maximum impact. Look out for wrinkled linens, naturally textured stone and faintly distressed prints to add a tactile element.

Concentrate on rich colour that welcomes in and warms the cooler seasons Holden Medina Red and Navy wallpaper, £13.50 per roll, Wilko Vantaa Herringbone glue down luxury vinyl tile, £24.50 per sq m, Topps Tiles Valspar Premium walls & ceilings matt emulsion in Sunny Bordeaux, £32 per 2.5L, B&Q Zeena Classico Red Brown vinyl, £34.99 per sq m, Carpetright Dollymixx Plum Blush terrazzo effect tiles, £39.95 per sq m, Walls & Floors Arc fabric 8682/223 byPrestigious Textiles, £29.04 per m,Your Stylish Home Matt paint in Fresh Peach, £42 per 2L, YesColours

O Choose richly hued woods for flooring and furniture. You can soften them with fuzzy cream rugs and rumpled linen tablecloths if you’re concerned about the effect appearing too strong. Cut through the intensity of this dark look with refreshing blue-grey details, this will help to balance out the scheme and prevent it feeling too heavy.

HOW TO WORK THIS LOOK

September 2022 69 Style edit SPICED WINE Relax with a full-bodied look that gives a cosy twist to pared-back minimalism COLOUR PALETTE Nordic Wood Dark Brown wood effect wall and floor tiles, £20.99 per sq m, Tile Mountain Urban Beige ceramic wall & floor tiles, £15 per sq m, Wickes Linen blend curtains in pinstriped,TurquoiseLight£39.99,H&MHome Hikari fabric in Slate, £41 per m, Scion Cushioned vinyl flooring in Gustavian 05, £12.99 per sq m, Best 4 Flooring Crafted by Crown metallic paint in Millionaire, £20 per 1.5L; Crown walls& ceilings Emulsion Ruby Chocolate,£18 per 2.5L; Crafted by Crown mattpaint in One of a Kind, £32 per 2.5L, Homebaseall Osaka dining table, 3 chairs and dining bench set, £1,395, Furniture Village Aina fabric in Grey, £8 per m, IKEA

70 yourhomestyle.uk TWO NEW LOOKS One problem room

My daughter Tara is now six-and-a-half and I’d love her bedroom to represent her tastes and personality more, while still looking like a stylish part of home. The room is quite small so ideas on how to make the most of the space would be great. She loves colouring in and she’s getting more homework at school, so it’d be ideal if she had a little desk area. pastels, pretty prints black and orange MEET THE STYLIST Abbi Henderson is a journalist, stylist, and co-founder of the UK Interior Awards. She writes about interiors, health and travel for top publications the UK and Canada. See more at abbihenderson.com. bedroom

in

Likes:

our

Dislikes:

Look One WOODLANDWONDER Feature HendersonAbbi Every month we ask two interior stylists to solve a reader’s real-room design dilemma, each creating a moodboard. This month they take on Tara’sKayciebedroomsingle bed frame, £95, Argos Lison Spotted pillowcase, £9, La Redoute Cade desk lamp, £25, NextBeguiling Gold butterfly mirror, £99, Joe Browns Kalina wallpaper in Fjord, £40 per roll, John Lewis & Partners Piaf rattan wall shelf, £55, Oliver Bonas Thrift Fairy art print, from £35, King & McGaw Jute scallop border rug, £65, Habitat

Tara,s

September 2022 71 Abbi’s style tips ł Invest in under-bed baskets and fit shelves to maximise storage. Consider painting one wall, Layer light sources, including Style advice WHY IT WORKS The mother-nature-meets-mystical theme helps to encourage imaginative play, while the pink and blue colour palette provides a soothing, calming atmosphere. The focus on natural textures and furnishings makes it an easy-to-style scheme using either high-street bargains or second-hand gems. Use three colours in these proportions around the room Colour palette 1 Pink 02 matt paint, £42 per 2.5L, Lick 2 Green 13 matt paint, £42 per 2.5L, Lick 3 Space Blue matt emulsion, £17 per 2.5L, Dunelm Strawberry Field Summer wallpaper, £38 per sq m, Rebel Walls Archie pine cabin bed, £211.25; Jimi three-drawer chest, £178.75; Louise cotton duvet cover, from £36, La Redoute NEEDSTYLEADVIC E? If you’d like our stylists’ help with a problem room, send a photo of your room to homestyle@ourmedia.co.uk for your chance to appear in our feature. Adil vintage-style desk, £215, La Redoute Low rattan Yarom stool, £79.95, Sklum Dae underbed storage trunks, £62 for two, MADE 12 3 Cleo bamboo pendant lampshade, £39.50, Oliver Bonas

72 yourhomestyle.uk WHY IT WORKS A sea-inspired colour scheme of greens and blues is perfect for bringing an ocean vibe to Tara’s bedroom, while a mix of whites and pinks will balance the look. Fun accessories, such as the mermaid bedding, turtle light and garland are sure to be a hit with little ones, while more subtle features, like the scallop shade and canvas wall art will stand the test of time. Feature AttawaySuzie MEET THE STYLIST Suzie Attaway is an interior stylist from London. She loves creating room schemes bursting with colour, and is also a keen upcycler and crafter. See more from Suzie at, attawayhomestylist.com.suzie Tara,s bedroom Look Two MERMAIDLITTLE Mermaid scallop ceiling shade, £30, John Lewis & Partners Snurk mermaid duvet set, £50, Amara Teal Green cord storage baskets, £20 for two, Argos Ohpopsi Beneath the Waves wallpaper, £39 a roll, Wallpaper Direct Vox Concept cabinet, £157.50, Cuckooland Mermaid fringe garland, £19.50, Meri Meri Turtle cushion, £8, Matalan Mermaid blanket, from £16, Next Shell Sky Blue velvet bed, £435, Next

ł Save space with multifunctional furniture. This bed with a desk will free up floor space while bringing an all-important fun factor!

Use three colours in these proportions around the room

ł Let your child help decorate the room with sea-inspired decal stickers to create a fun feature wall.

ł Update old furniture with chalk paint for a distressed look, which is perfect for achieving an ‘underthe-sea’ vibe.

123

Blue Mermaids wallpaper, from £30 per sq m, Wallsauce What did Tara decide?

Watercolour Whale canvas, £80, Abstract House mermaidKnitteddoll, £45, Meri Meri Turtle USB light, Lights4fun£24.99,

‘Look two; Little Mermaid,’ says Tara, ‘I’ve always wanted a bed like that, with a desk underneath – I could get a wheelie chair to go with it! I also love the Shell velvet bed. The mermaid wallpaper is so nice and I really want that mermaid tail blanket. The colours are so pretty.’

1 Marine Splash Easycare matt emulsion, £40.54 per 2.5L, Dulux 2 Wanderlust chalky finish wall paint, £33.08 per 2.5L, Rust-Oleum 3 Fresh Pink emulsion, £21 per 1L, YesColours Colour palette

Nico high sleeper bed and desk, £325, Habitat Mermaid book ends, £18, Argos

Suzie’s style tips

September 2022 73 Style advice

anUnderhour! Speedy solutions that can be achieved in less than 60 minutes

Rearranging the knick knacks, photos and books on your shelves will makeover the feel of a room in a flash. Start by taking everything off the shelves and giving them a good dust, then give the shelf a wipe down. Pack away anything you haven’t noticed yourself looking at for a while. This will streamline the number of items on display so that they all have a chance to be enjoyed. You can circulate these items and bring out the pieces you’ve packed away when you need a refresh in a few months’ time.

Tick tock

Time for a change? It can be hard to find a spare window but we’ve found ways to transform your interiors in three time slots: under an hour, in a day, and over a weekend. Ready? Let’sBaldwingo… desk lamp, £55; Soren desk, £699; Pols Potten hourglass, £42.50; Roberts Revival radio, from £169; Tom Dixon air candle, from £105; stripe vase with handles, £28; Baxter swirl wallpaper, £30 per roll, all John Lewis & Partners

74 yourhomestyle.uk

On a level

1

Clear the decks

If ugly sockets and switches are spoiling the look of your kitchen, propping up a few large items, such as stylish breadboards will keep them hidden away. Layering up boards will create a textured effect that will look intentional, rather than a lone board that might feel out of place. Pair them with a utensil jar or a pretty bottle of olive oil to complete the transformation. If breadboards aren’t your thing, try herb plants in pots, they’ll cover a larger area as they grow and you’ll forget those eyesores were ever there!

4

No matter how hard you try to keep things neat, everyday items will always find their way out of cupboards and start cluttering up work surfaces. Save time by containing all those items you like to have close at hand on a stylish tray. They’ll be easy to access, and faster to tidy up, which means your worktops will stay clear for longer. It’s a great trick on your dressing table too, opt for easy-to-clean materials, such as glass, plastic or lacquered wood so that you can quickly wipe away spills or stray powder and keep things clean.

Add a sense of drama with a statement lampshade. These large features help to ground a room and pull furniture together. They’re the icing on the cake of your schemes and make the overall effect more ’complete’. Remember that pendant lampshades will appear smaller when they are hung in the room, so measure up to get a clear idea of the size of shade that would suit your room best, or choose something that feels slightly too large when it’s in your hands in the shop.

September 2022 75 Style advice Feature TribeHannah

THE FANTASTICLIGHT

Non-slip tray with handles, £39.99, Zara

Torared lampshade, £15; Evedal floor lamp, £215; Möckelby table, £699; Persisk Mix rug, £1,200; Bergmund chair with cover, £10, all IKEA

Hide and seek2

Wooden marble accent serving board, £12.50; acacia wood chopping board, £11; mono stackable cake tins, £12; Blue ceramic utensil pot, £8.50, small canister with cork lid (used as a plant pot), £6.50, Matalan

5

Painted arches can turn overlooked spaces into stylish design features and adding an extra curve in a darker shade also creates a sense of depth. This faux alcove effect is perfect either side of a chimney breast, on the landing or behind a sideboard to frame favourite display objects. Head to yourhomestyle.uk and search for ‘How to create painted wall arches’ for our guide. Once your primary arch is finished and dried, paint in the extra detail. Draw an arch that’s the same width, but around 20cm shorter and to the left of the original. Paint the gap between the arches in a darker colour and... ta da! An on-trend architectural curve. creative and you’llbe amazed at how much you can doin a day

Ercol Ancona sideboard, £1,279; Orbital table lamp, £179, Furniture Village 24orhours.less Get

Paint a picture

Get creative

6

Pick up a preloved piece of furniture and transform it into something that really feels like yours. Be brave and paint it in a colour that will turn a piece into a focal point for the space. Try this dramatic peacock shade from Dunelm, or go for a softer effect with pale pink or lilac – it will still be a showstopper. Pop on new handles for a luxe feel – the heavier the better – and keep the old ones for a future project. You can also line the bottoms of each drawer with unused sections of wallpaper as it’s a great way to make the most of leftover ends of rolls or large-scale samples.

Turn a neglected wall into a flexible gallery space by spending the day putting up narrow picture ledge shelves. Hang them at around eye level so that you can easily change the display. Switch it up in seasonal style according to the time of year. Portia wallpaper, £42; Oakridge by Laura Ashley medium sofa in Dusky Seaspray, £1,225; Balmoral side table, £295; Maya mirror, £280, all Next Picture ledge shelves, from £10 each, Next Dunelm Peacock eggshell emulsion paint, £16 per 1L; drawer handles, from £6; Moroccan mirror, £45; Hallie dining chair, £129; ridged glass vase, £12; Moroccan lantern, £45; Bahvra rug, £39; Moroccan tray, £28; glass desk storage, £18; ceramic plant pot, £4, all Dunelm While you might struggle to wallpaper a whole room in a day, papering one wall is a fast and effective way to add colour and pattern to areas you’d like to highlight. Try it on the wall behind your headboard or sofa, or alongside a dining table. Walls with doors and windows can be a little tricky, but you’ll need less paper to cover a larger area. You can also have fun with pattern matching your blinds or curtains to the new walls. If you’ve got some extra time and leftover paper, think about ways to use it up, like popping it into picture frames, or using it to wrap storage boxes, or see Number 8 for more ideas on using up old paper.

PICTUREPERFECT

September 2022 77 Style advice

7

Paper craft

8

in

Create a feature Adding texture to walls creates a modern look that always appears high-end. You’ll need to attach small strips of wood or MDF to a wall, then paint the slats and wall in the same stylish shade. If you’re using MDF the strips should be sealed before you attach them to the wall, while pine or wood may need to be treated with a knot solution to stop excess oils spoiling the final finish. If you’d like to create a continuous effect by placing lots of slats closely together, use the edge of a spare as a ruler to help you mark out the gaps between the slats. This will be faster and more accurate than trying to do it by eye. Attach the slats using a liquid nails-type glue and tap in a few veneer pins or brad nails for extra strength and a long-lasting look.

Crafted Crown matt paint Collage, £32 per 2.5L, Wickes

by

Over weekenda Roll up your sleevesand dedicate 48 hours to a transformativetask

78 yourhomestyle.uk 9

11 10

Focus on the footsie

September 2022 79 Style advice

WELCOME HOME

Begin by opening all the boxes and mix up the planks you’ve bought. There can sometimes be subtle variations in colour between boxes and this will help to avoid an obvious change in your finished floor. It’s also a great opportunity to arrange your planks so that you don’t lay identical designs next to one another, which can spoil the effect. It’s tempting to start by laying your first line against the wall, but you can’t rely on walls to be straight. Begin your first line of planks a little way away from the wall, then work towards it for a neater look.

Sometimes the answer to a new look is right under your feet. Laminate plank flooring can be installed over a weekend, especially with a pair of helping hands. Whichever flooring you choose will come with its own set of instructions, but there are tips worth keeping in mind before you start.

Exterior eggshell in Hudson, £36 per 1L, Graham & Brown Rust-Oleum matt finish furniture paint in Graphite, £18.99 per 750ml; Rust-Oleum chalky floor paint in Graphite, £38.99 per 2.5L, The Range Capture Collection flooring in Painted Oak White, £37.99 per sq m, Quick-Step

Make a grand entrance by spending your weekend renovating your staircase. If you’re planning to use a specialist floor paint, like Rust-Oleum, you won’t need to sand everything down completely. Give the whole staircase a rub with fine grain sandpaper to give a nice ‘tooth’ for the paint to stick to and fill in any holes or dents. You can paint every other step so that you’ll still be able to get upstairs when nature calls, or when it’s time to go to bed. Leave it to dry overnight and tackle the alternate steps the next day. Wear fluffy socks to avoid scuffs and marks.

12

On the up

Revamping the front door improves kerb appeal and puts a smile on your face when you return after a hard day. Use an exterior eggshell, or specialist uPVC paint for secure adhesion, protection from the weather and long-lasting good looks. Begin at the edges of the door so that they have the longest time to dry, they’re likely to stick and spoil if the door is shut before the paint has had a chance to harden, even if it appears to be dry. Then move on to the moulding around any panels or glass, then to the panels themselves. When complete, work on the horizontal rails and finish with the vertical rails. Working in this order will help to avoid ‘tide lines’ in the paintwork. Take your time between coats and make sure each one is fully dry before you start the next. Complete the new look with a stylish knocker.

Milton Oak desk, £179.99, Furniture And Choice

The little-used area under the stairs is often an ideal spot for a mini home office. Paint the walls with bold and invigorating sunshine shades and ensure that you use good lighting to keep the space bright and inviting – a place where you would like to spend time. A wall-mounted memo board is ideal for keeping to-do lists and notes close to hand while maintaining a clutter-free desk. A comfortable chair is essential too.

BELOW STAIRS

Whether you’re hybrid working or need a place to do household paperwork, create the perfect home office space with these stylish solutions

BIA Pro Electric sit stand desk, from £899; Varier Variable Plus chair, from £599; Varier Variable Balans kneeler, from £349, all Back in Action

SOLVERSPROBLEM

Lifespace fitted office furniture in Midsomer and Textura Sand Oak finishes, from £500, Crown Imperial

Sit in style Back problems caused by sitting at our desks for too long are on the increase. By investing in a good ergonomically designed chair or kneeler you can keep backache at bay. Combine this with a rise and fall desk, which allows to you adjust the height and even use it as a standing desk, to help encourage you to change your working position.

BEHIND CLOSED DOORS

Feature De’AthAnna-Lisa

From pop-up coffee-tables to slimline ladders and clever corner fillers we’ve got small spaces covered Ladder desk, VonHaus£59.99, Secolo table in Grey & Brass, £399,DwellAero industrial corner desk in Brass, £299, Swoon Editions

A LADDER TO SUCCESS

If you’re lucky enough to have a dedicated room for your home office, keep it looking serene by using a combination of open shelving and closed cupboards. If budget allows, fitted office cabinets will make the maximum use of your space. This will allow you to keep the most often-used items close to hand, while less attractive objects can be hidden. When planning an office layout, try and position your desk area in front of a window to make the most daylight.

TOP TIP Room design apps help visualiseyouaspace Oak leaning ladder desk, £279; folding chair, £70; oak leaning narrow shelves, £159; oak leaning shelves, £179, all Futon Company

Creating a smart home-working solution needn’t mean compromising on looks. Ladder desks are not only practical, due to the shelving options that come inherent with the design, but they look super-stylish too, and they are easily personalised with plants, family photographs and small, fun office ornaments to keep the space looking studious, yet cheery.

Say goodbye to boring black office chairs and pimp your desk with one of these beauties

In a large open-plan room, it can help to create a dedicated area for your home office. One of the easiest ways to do this is by using wallpaper. Choose a design that either soothes or inspires you and use it just up to picture-rail height to allow the rest of the room’s décor to flow around it. Alternatively, you could use paint to create a similar effect. Keep the lines crisp with masking tape, and experiment by using painted triangles, rectangles or circles to zone your working corner.

Blend in If you only have space for a home office area in your living room, help it to blend seamlessly with the rest of the room by using furniture with the same aesthetic. Choose a desk and chair that use similar materials and colours as your living room scheme and look for designs that feature slimline or hairpin legs to encourage your eye to flow uninterrupted around the room.

IN THE ZONE

TAKE A SEAT

82 yourhomestyle.uk Rayner dining chair in Mustard, £69, Cult Furniture Cooper wall light fitting, £128; 14cm wizard pendant shade in Ruby silk with velvet tape, £32, both

RestorePookyMidnight wallpaper, £65 per roll; Resistance Durable matt emulsion paint in Breather, £46 per 2.5L, both Graham & Brown

Tucked away Alcoves are ideal spaces in which to create a bijou WFH area. They lend themselves perfectly to rows of floating shelves, offering you plenty of storage space for books, files and a few inspiring decorative accessories – the brighter the better to help inspire a positive mindset. Try to keep the projection of your desk to the same depth as the alcove if you can to prevent it jutting out into the room too much. An yourpreciousareatoactwall-mountedadjustablelampwillasperfecttasklightingilluminateyourworkingwithouttakinguplimitedspaceondesk.

Tvissa office chair in White, £50, B&Q Wren office chair in Vintage Tan faux leather, £199, Cult Furniture swivelEldberget/Malskär chair in Yellow and White, £39, IKEA TOP TIP Bring a work space to life withpaperspretty

Style advice

Mix it up

When you’re sitting at your desk, there’s nothing more distracting than unwanted glare on your computer screen, especially in a south-facing room that gets direct sunlight for most of the day. As well as considering your office furniture, it’s really important to choose the right window treatment to allow you to work comfortably.

ADVICEEXPERT

Manhattan home office with Manhattan bedroom in Dove with Lilah Satin Brass handles, from £2,000, The Home Collection, Sharps TOP TIP Use task lighting to help zone your office space

If you need to put your home office in your bedroom, try to not let it dominate the space. Fitted wardrobes and a desk area that incorporates matching cabinetry will help the office to blend seamlessly with the rest of the space. Add softening touches to office furniture, such as a plush velvet office chair, a cosy rug or dimmable lighting. You could also use a decorative folding screen to hide the office too.

Take time to position your chair correctly. Your feet should be flat on the ground and your knees bent, but with a slope from your hips to your knees. Relax when sitting into your chair, making sure you have your bottom against the seat back with your shoulder blades touching the backrest of the chair. Remove any obstacles from under your desk. Get up!

THROW SOME SHADE

Ellwood wood Venetian blinds in Pearl White with Clay tape, from £102, Hillarys

Bed and boardroom

Essential adjustments

Catherine Quinn, President of the British Chiropractic Association, shares her tips on how to WFH

Incorporating movement into your day is so important, but start small – take a 15-20 minute walk on your lunch break. It’s all about manageable, bitesize chunks!

Try to mix up your position and consider a laptop stand that will allow you to work standing up. It’s fine to get creative – especially if you’re still working from home. Just make sure your screen is at eye level. Find the light Try to ensure you get enough daylight, particularly during the winter. Vitamin D is an essential part of maintaining well-being. Getting enough sunlight can help improve your sleep and mental health.

Wood Venetians make it simple to control light levels throughout the day, while voiles create privacy, as well as reducing screen glare, as they allow light to gently filter through.

Feature PoadThomas

We’ve explored how to create a beautiful home with environmental buys that mean you can enjoy guilt-free style

Perfectly pure prints

Devote as much of your time researching the materials and manufacturing processes as your pattern when choosing wallpaper. Printed in the UK on FSC-certified paper, Lust Home’s eye-catching, stylish prints offer a long-lasting talking point in your home. Pre-loved gem Printed onto fabric that’s been made from 100 per cent recycled plastic, this abstract floral cushion will sing against a rattan chair or plush sofa.

SHOPPERHAPPY

PURCHASEFORLIFE

It’s easy to turn the weekly food-shop frown upside down with this cheerful reusable bag that’s been sewn from repurposed nylon. Smothered in smiley faces, this bag is capable of holding up to 22kg of produce so it’s as strong as it is joyful!

‘Buy well and buy once’ will ensure your larger furniture items stand the test of time. This fabric is made from recycled plastic and a durable water repellent that’s free from harmful chemicals, plus the neutral shade is a versatile base for colourful cushions or throws to switch up the look over the years.

84 yourhomestyle.uk THE ROOM

Creating beautiful interiors shouldn’t cost the Earth as there are plenty of ways to decorate your spaces sustainably.

Samba cushion, from £12, furn Baggu Forest Happy reusable bag, £12, Keep + Kind toplasticFromfabric Pandora wallpaper in Fuschia, Jade and Lime, £45 per roll, Lust Home

The Big Chill three-seater sofa in Oatmeal, £1,339, Snug

KEEPSAKE Brighten a reading corner with this tasselled throw crafted from recycled cotton – it’s available in a range of other shades to match your colour scheme.

September 2022 85 Expert advice

Swap bottles of cleaners for plastic-free sachets that you dilute in a spray bottle for a greener clean in your home.

Water cure Stay hydrated while preventing bottles of filtered water going to landfill with this jug that filters tap water for a fresher taste. It’s dishwasher-safe, slots into a fridge door for chilled water on tap and reduces limescale in your appliances to make them last longer.

Autoseal Chill bottle in Rose Quartz, Contigo£27.76, Kitchen degreaser, £1.50, Ocean Saver Walton & Co throw in Terracotta, £17, Trouva

Enjoycoffee with a clear conscience

Chooseyourshade

Style water filter jug, £31, Brita

EcoPress aluminium capsule pod recycler, £9.99, Dualit

Matt emulsion paint in Passionate Yellow, Passionate Pink and Passionate Teal, all £21 per 1L, YesColours

GREENSHEEN

Lots of bottle Make spilt drinks ruining your rucksack a thing of the past with this leakproof reusable bottle that keeps water, squash or cold-brew tea refreshingly chilled for up to 28 hours.

PODS TO LOVE Soothe your conscience as you sip your freshly pressed cappuccino with the EcoPress, which cleans and prepares your aluminium pods to be recycled at the kerbside. Compatible with most aluminium pods, it can hold up to 10 pods’ worth of coffee grounds and it’s dishwasher-safe, too.

Paint the future Reduce waste and save cash by buying the exact amount of paint you need with YesColours’ mood-boosting range of shades, which come in 1L pouches that you can recycle once emptied.

PURE ABLUTIONS

Vibia Campana flower bridges in Pink, £14.69 each, elho

Ginkgo Floral shower curtain, £15, John Lewis & Partners

Nothingfeelsbetterthanorganic cotton

Refresh your shower routine with a curtain in a serene pattern. This option is made from recycled polyester –pull the curtain straight after use to prevent mould growing in the folds for a longer lifespan.

Kiss & make up Available in three sizes (from 9.5 x 18 x 25cm – H x W x L) and a wide range of colours, these stacking crates are made with 60 per cent recycled plastic from the cosmetics industry. A fitting way to make-up.store

Tufted Leaf bedding in Olive, from £50, Dunelm Weston large storage boxes in Rose and Dusty Mint, £27 each, Liewood

A madecurtainfloralfromrecycledmaterials

86 yourhomestyle.uk Sleep in peace Dial up the texture in your bedroom with fringed bedding stitched from 100 per organic cotton, which is free from pesticides that can harm wildlife.

September 2022 87 Expert advice

Lots of companies are making ‘green’ claims but how authentic are they? Knowing whether your purchases are sustainable can be tricky, so follow these tips to buying eco-friendly treasures and avoiding green-washing fakes.

Display dried blooms or refresh visitors in style with recycled glassware. The greenish hue and bubbles captured in the surface will add colour and a sense of movement to your tablescape.

What’s it made from? Check the materials used to make the item. Recycled or repurposed materials are often best, as are climate-positive items that reduce the amount of carbon in the atmosphere as they’re produced.

Time to shape up

Consider what will become of the item once you’re finished with it. Research what happens to products in their afterlife once they’ve been discarded: can they be repurposed, recycled or disposed in the food waste? Ask for this information if you’re unsure,’ adds Petko.

Check the credentials.stockist’sCo-founder of low to zero carbon store, The Home of Sustainable Things, Petko Tashev, says: ‘Seek retailers you can trust with finding and stocking sustainable items; they’re the most likely to scrutinise new products and suppliers, plus they will give you reliable information.’

BACKNATURETO

TOP JOB

Keep this eco mantra and our helpful hacks in mind when you’re scrolling or shopping for your next style update

Make do and mend. A recent study for Antiques are Green found that the environmental impact of an antique piece is six times lower than that of new furniture. Repair, varnish or repaint an existing item or Facebook Marketplace find to give it a fresh lease of life. Do you need it? Home furnishings play their part in using up precious resources and impulse buys can clutter a well-planned scheme. Consider what your space is lacking and see if it can be fixed with an item from elsewhere in your home for a free makeover.

Wood paint in Peregrine Blue, Mudgley Mustard and Mercury Grey, all £20 per 750ml, Thorndown

Happy colour Transform your kitchen units, bathroom cabinets or skirting boards with a lick of paint for a whole new look. Thorndown Paints’ water-based formula contains no harmful compounds and there’s a wide array of shades to give your furniture or upcycled projects a colourful updo.

Place brightly coloured pots with herbs on a balcony or fence. Crafted from recycled plastic using wind energy, you can recycle these pots too, completing the circle.

Good wood Packed with strong sisal bristles, this bamboo brush makes light work of cleaning pots and pans. Once finished with, it will naturally biodegrade.

PaintsCeramic push top jar in Dusty Pink, £13, Kilner Bamboobrushwashing-up , £8, Seep Ridley PVB twist carpet in Parchment, £27.99 per sq m, Carpetright Recycled glass vases and jugs, from £7.50, Sass & Belle

Make cereals and pasta last longer with glass and ceramic jars. A push-top lid prevents air ruining food. Sterilise glass jars for a similar effect that’s free.

Balance practicality and style with this rug’s dense pile that’s comfortable underfoot and easy to clean. The backing is made from repurposed plastic destined for landfill, so you can make a positive step in the eco direction as you kit out your bedroom, hallway or living room floor. A step ahead

Feature De'athAnna-Lisa

02 STACK SMART

Be strategic with your dishwasher and fill it up as much as possible to ensure you only use it when it is totally full. Utilise the space as efficiently as you can – pack cups, glasses and cooking utensils on the top shelf, leaving space below for plates to be neatly stacked in a row, along with bowls and casserole dishes. By stacking smartly, you’ll need to use the dishwasher less and thus reduce your energy bills.

SAY WATT?

Turn off upstairs lights from downstairs (and vice versa) with smart-bulb tech. It lets you take control when you’re out too!

03 TOP OF THE CLASS

OHMAXX smart plug, £24.99 for a pack of three, Amazon

Vampire devices, such as TVs, games consoles, computers and microwaves, left on standby cost households an average of £147 a year, even when they’re not being used. Switching them off at the wall to save money makes sense but that isn’t always practical if sockets are hidden behind desks, beneath TV units or covered up by white goods. Consider fitting smart plugs that allow you to simply turn your sockets on or off from your mobile phone.

One of the most simple yet effective things you can do to cut your electricity bill is to keep an eye on the energy label on your appliances. A newly revamped (2021) rating system indicates an A to G scale with the letter A as the highest class and G as the lowest. Pre-2021, this was a more confusing A+, A++ etc rating but this simplified version makes it easier for you to save energy by choosing a high-efficiency appliance.

88 yourhomestyle.uk

ENERGY SAVING TIPS

Although an A-class home appliance can be a financial investment initially, it will help you to lower your bills and bring huge savings in the long run.

TOP TIP

While we can’t control global economics, we can help to ease the pain of winter fuel bills a little by learning how to get smart and stop using unnecessary levels of electricity. Scan our 10 savvy solutions on how to save money by making a few small changes…

01 FIX THE LEAK

06 GO AU NATUREL

By taking part in an energy audit, you can find out exactly where you’re using the most power and how you can cut this down. It will help you get a better handle on your spending. Many energy companies offer audits to help you pinpoint exactly where you can save power and how you can do this.

NEXT MONTH: HOW TO CUT YOUR HE ATING US A GE

Using 85 per cent less energy than regular bulbs, by replacing your standard bulbs with LEDs you could shave money off your electricity bill. LEDs also last longer – used for six hours a day, they can run for almost 12 years – so you’ll not only save on your energy costs, but you won’t need to replace them so often.

It’s tempting to turn your lights on and close the curtains early in the evening, but by keeping them open until sunset you can maximise the natural heat and light from the sun and save up to around 60 per cent on your lighting, compared to constantly having lights on.

10 WASH WITH CARE

STAY IN MOTION

07 COLD AS ICE

When it comes to washing your clothes, longer cycles, such as a 3.5-hour ‘eco’ wash vs a ‘quick wash’, use less energy and water and take better care of your clothes. By lowering the temperature to 30ºC instead of 40ºC you can save up to 60 per cent of your energy consumption on washing. To reduce costs even further, use a machine with energy-saving credentials, such as the AEG models with ProSense technology. Each load is weighed to provide a tailored cycle.

04 LIGHT UP Modern LED lightbulbs are the most eco-friendly option you can buy.

Consider fitting easy-to-install motion sensors, so that your lights only come on when you enter a room and turn off when you leave. They’re ideal for hallways or kitchens, and if you have children who are too small to reach the light switch, or if you only want a landing light to turn on if they wake up overnight.

09

05 GET ORGANISED Every minute that your lights are on it costs you money. Consider using smart bulbs that can be scheduled to turn on and off at set times. Smart scheduling means that your lights are on only when you need them to be and not a moment longer, saving you money.

less

Take part in an energy audit to find out where you’re using the most power Smart meansthinkingsavingmoney

08 BE IN THE KNOW

9000 Series washing machine, £999.99, AEG TP-Link Tapo smart bulb, £8.98, Amazon

September 2022 89

There are several ways to make your fridge work harder for its money. By keeping the coils clean at the back on the fridge you will make your device more energy effective. When the fridge is full it also costs less to cool it. You don’t have to pack it with food – a jug of water will work so you get a cool drink and save on running water from the tap too.

Methodical stacking equals washes

Reader offer

Kukoon Rugs is one of the UK’s leading rug brands, stocking over 1,000 affordable rugs in a range of designs, styles and sizes. Delivery is free for all UK & Ireland customers and there is a courtesy 90-day return policy on all of its rugs. Check out the full range of indoor and outdoor rugs at kukoonrugs.com.

with any other offers

Every product in the Kukoon Rugs outdoor collection is stain-resistant, mould and mildew resistant, UV-resistant and weatherproof. They are easy to clean and great indoors too – in kitchens, playrooms, and other areas prone to mess.

Kukoon Rugs offers an array of colourful and bold designs, from tropical and geometric, to Aztec and Scandi, and all are available in a huge range of sizes and shapes, including rectangular and round rugs, as well as runners.

90 yourhomestyle.uk

o celebrate its gorgeous outdoor rug collection, Kukoon Rugs is giving HomeStyle readers a whopping 25% off all products on its website, including both indoor and outdoor rugs! Give your outside area a stylish upgrade this season with an outdoor rug and inject instant style, comfort, and colour to any al fresco space. Or, with autumn just around the corner, treat yourself to an indoor rug to create a new cosy area.

Offer expires 31stAugust 2022 cannot be used in conjunction

It’s super easy! Simply usethe code hom e styl e 25at the checkout to get 25% offall rugs at kukoonrugs.com.

25%S AVE RE A DER OFFER AT KUKOON RUGS

T

REDEEMTO EXCLUSIVE 25% KUKOONOFFRUGS *Offer valid, while stocks last, and

Tuck into comforting feasts and one-pot wonders Refresh for autumn! Cosy schemes for every room Add instant wow with pocket-friendly must-haves COMING NEXT MONTH PLUS, DON’T MISS… The latest kitchen trends Mini space? Maximum impact! How to make the most of small rooms Get a luxe bathroom for less – or splash out! Tips and tricks to cut your heating bill, brilliant prizes & so much more! Get your copy! OCTOBER ISSUE on sale 1st September Real homes and makeovers bursting with amazing ideas!

It’s so easy! Head to yourhomestyle.uk, click on the ‘Win’ tab, find the draw you want to enter and fill in your details. Closing date 2nd2022October

Check out the whole furniture range and more baby essentials at icklebubba.com

Prize draw closes on 2nd October 2022 at 23.59pm and you must be 18 or over to enter. This prize draw is open to residents of the UK mainland only. Installation not included. The prize winner will be chosen at random. Find full terms and conditions under the Ickle Bubba prize draw at yourhomestyle.uk/win

Brand new for Autumn/Winter 2022, Ickle Bubba’s Tenby furniture collection features a sleek Scandi style that brings a deluxe design to modern nurseries. We’ve teamed up with Ickle Bubba to offer lucky HomeStylers the chance to win the full bedroom package, including a convertible cot-to-toddler bed with handy under-drawer and fibre mattress (£399); a chest of drawers with removable changing top (£299.99), and a matching wardrobe (£399.99). This two-tone collection lasts the distance, growing with baby right through to toddlerhood and beyond. The winner also has the choice of Scandi white (pictured) or the Mono Trend edition colourway. Whether you opt for the modern monochrome style or stand-out Scandi white with pine, the soft white base of the Tenby collection is enriched with rounded corners and accent detailing, to bring a two-tone look to your little one’s room. Enter now for your chance to create the perfect nursery! Available to buy as single pieces or as part of super-affordable bundles.

TO ENTER

A stylish three-piece nursery set from Ickle Bubba

WINNERLUCKY1

TERMS AND CONDITIONS

WIN! Total prize value £1,098.99!

Towels are the perfect way to add flexible colour and pattern to bathrooms. They’re a budget and renter-friendly option when you want a refresh. The brand-new towel collection from Mini Moderns is inspired by the Sixties Californian music scene and will create a contemporary look with a vintage feel. The range includes six designs, with three corresponding bathmats that you can mix and match. minimoderns.com

The blacknew

HOME SLICE

Hitting the high notes

Elevate boujiesnacksafter-dinneryourwiththischeeseknifeset,italsomakesagreatweddinggift!

If (like us) you dream of a perfectly organised pantry, Not A Boring Box is here to help those dreams come true. It stocks an inspiring range of storage options, from glass jars to plastic boxes and steel baskets. Each one with the potential streamline the look of your kitchen, as well as simplifying your daily cooking routine.

Giant glass storage jars with acacia lids, from £14 each, Not A Boring Box Pet Sounds towels, from £17 each, Mini Moderns

Triton Amala Black electric shower, £250, B&Q

September 2022 93 WH AT’S NEW KITCHENS BATHROOMS& Put some fresh ideas on the table with this month’s stylish updates

Botanics cake tins, £30 for set of two, Typhoon Wire shape cheese knives set, £27.50, Oliver Bonas FLORAL FANCIES perfection

Pantry

Feature TribeHannah lovewe

Give your shower a high-end makeover with this gorgeous new design from Triton. The Amala electric shower’s sleek black casing is accented with brushed brass detailing for a luxe effect. It comes with a matching minimalist riser so that you can create a premium look in a flash, without the fuss of searching for matching accessories. Keep bakes at their best with these sweet nesting cake tins. The floral design makes them perfect for picnics

94 yourhomestyle.uk

‘I found the dining chairs on eBay at £80 for the set and the John Lewis & Partners dining table was only £100 in the sale’

The tiny kitchen was separate from the dining room with cupboards on opposite sides. Everything had nicotine stains, and there was a horrible Seventies carpet in the dining room.

MY FAVOURITE PART

My room...

HOW I MADE IT WORK We blocked the door up from the hall and knocked down the supporting wall into the dining room. Then I went to town with colour selecting teal kitchen units, a bold geometric floor and pink accent walls.

Our

About me

spacesmall

The custom vinyl floor tiles from Atrafloor (since closed), was Helen’s biggest splurge. ‘The flooring cost around £800 but it’s been down for five years, and you can wipe it clean, which is great with young kids,’ she says.

MY PROBLEM KITCHEN-DINER

The gallery wall as it’s very personal to our family and it’s always changing. Before I’m Helen Jay, a marketing manager. I live with my husband, Alex, who works in finance, and our children, Sebastian, six, and Nancy, two. Our home is a three-bedroom 1930s semi-detached house in Manchester. I record our renovation journey on Instagram @thehousewiththepinkwall.

POPSCOLOURWITH

Faced with a tiny room, Helen Jay has created a bright and cheerful open-plan kitchen-diner on a minuscule budget

September 2022 95 £3,100TOTAL Feature WilsonKaren stylingandPhotos FiszerKasia Style idea Black frames give the gallery wall a unified feel

A COHESIVE GALLERY THEME

96 yourhomestyle.uk Style advice

Picking prints that have a similar content or colourway will help to create continuity. ‘Quite a few of the prints are related to New York as we went there for our honeymoon and fifth wedding anniversary,’ says Helen. ‘We also love going to photobooths and framing the black and white strips. This area changes all the time when I get bored, so some of the frames probably have about three different prints inside them. The embroidered hoop is the latest addition.’

This compact sideboard also doubles up as a pull-out desk so Helen can work from home two days a week. ‘I’ve seen similar ones for £500, but this was only £30 on Facebook Marketplace,’ she says. Inexpensive plywood shelves treated with varnish link the space to the kitchen. ‘Alex tries to put football trophies here, but they just get moved,’ she laughs. For an extra easy pop of colour, Helen has finished this corner with a display of favourite books.

‘You don’t need to spend a lot of money to make a kitchen expensive’look

A white ceramic sink and tap blends into the worktop, which helps keep things pared-back in a small space. ‘We just wanted a single mixer tap rather than separate hot and cold taps,’ explains Helen. ‘It helps keep things as unfussy as possible.’ The flat white wall tiles are another wise choice for simplicity, while the black grout adds a cool, modern feel. Helen keeps colourful tableware on corner shelves – a clever way to make the most out of empty wall space.

Three simple tricks to try in your ownCREATEhome

FURNITUREMULTIFUNCTIONALCHOOSE

KEEP IT COOL

As Helen and Alex wanted to keep the kitchen from feeling hemmed in, the couple decided against wall cupboards. ‘Later on, we added plywood shelves,’ says Helen. ‘Although they can gather dust, they work for us and I like the open feel, plus it’s nice to have stylish kitchen accessories out on display’

For two years the dining room walls and floorboards were white before we added some colour. Due to a deep access space under the house, a lot of sand and dust would come up through the floorboards, so we opted for vinyl flooring with a bold print. This led to the pink feature wall in the dining room. Eventually, we’d like to build a rear extension to create a bigger kitchen-diner, but we’ve made the most of the space for now. I love how bright and cheerful it feels. When you’re at home a lot, it’s just what you need.

For a similar kitchen, try the Altino Petrol Blue kitchen, from £43.86 per door, DIY Kitchens ł For a similar sink, try the Havsen sink, £175; for a similar worktop, try the Säljan White laminate worktop, £60; Magasin bread bin, £15; Hol storage table, £60, all IKEA ł Matt White flat wall tiles, £21.33 per sq m, Al Murad ł Brooklyn industrial ceiling pendant bar, £99, Litecraft ł Optimist chopping boards, £6.50; Optimist salt and pepper mill set, £18; Global stoneware pasta bowls, £16 for four; for a similar bookshelf, try the Nomad ladder shelf, £195, all Habitat ł For a similar vase, try the ceramic zebra head vase, £12, Lisa Angel ł For a similar floor, try the designer-effect nonslip vinyl flooring, £9.99 per sq m, Vinyl Flooring UK ł For similar chairs, try the Eva yellow dining chair, £32.99, ManoMano ł For a similar table, try the Elba dining table, £219.95, Sklum ł For a similar table lamp, try the Albert Mustard table lamp, £50, MADE ł Pizza A4 print, £30, Telegramme Paper Co ł Cherry Pop print, £14.09, Naomi Wilkinson on Etsy ł Embroidery hoop kit, £16.95, Cotton Clara ł Ghostbusters A4 print, £8, Reconsidered Retro ł New York City print, £20, Jacqueline Colley on Etsy. Turn to p128 for stockist details

‘The teal doors make the kitchen look more expensive than the £1,300 it actually cost,’ she says I was on maternity leave when we bought this place, so we had no money at first. After staying with my parents for eight weeks, we lived upstairs for a year until we were both working full-time and we could start updating the house. My mum brought us meals on wheels, and we had a kettle and microwave in our son’s bedroom. After knocking the wall down and installing a steel beam, the door from the hallway was blocked up along with a frosted glass internal window into the dining room. We spotted the teal kitchen in IKEA, which was perfect for our new L-shaped layout. There wasn’t room for all the appliances though, so our washing machine is under the stairs and the fridge-freezer is in the dining area.

With lots of colour in the dining room and on the kitchen units, Helen kept the walls and floors simple with flat white wall tiles and hexagon mosaic floor tiles.

My shopping list

MY EXPERIENCE

I’m lucky that my husband, Alex, is a qualified plasterer, his brother is a plumber and he’s friends with a builder and an electrician. This meant that there was a lot of job skill swaps going on, which saved us money. Alex and his stepdad also fitted the kitchen, did the tiling and removed the old back boiler.

ł

98 yourhomestyle.uk Feature BurnsCatriona Mix and match different prints and colours for a fun-filled kitchen-diner, just like Helen’s GET THE LOOK Pop pattern& ‘A bright and cheery kitchen is just what you need when you’re at home a lot’ Helen ANBRIGHTENEMPTYCORNER Leopard vase, £30, The BlossomsHappy JonesVividPinkwallclock,£1599, John Lewis & PartnersPizza poster, from £14.95, Juniqe Plant hanger, £1.70, Flying CopenhagenTiger Leopard print teapot, £39.95, EleanorRiceBowmertwisted candle, £2.50 each, Fig1 Shelter mug, £4.50, Matalan Argon tableware plates, £23 for six, Wayfair Ceramic tiger vase, £15, Dunelm

September 2022 99 Feature BurnsCatriona Tulip dining table, £200; Optimist Speckle dinner set, £40; Talia chairs, £200 for two; Optimist stacking tumblers, £18 for four; Optimist salt and pepper mill set, £16; Optimist glass watering can, £12; Two-tone mugs, £17 for four; Optimist carafe, £18, all Habitat 3 OF A KIND... CHAIRS Eva dining chair, ManoMano£32.99, ANYDAY Whitby dining chairs, £89 for two, John Lewis & PartnersLaradining chair, £90.30, Dunelm AVAILABLEINTHREECOLOURS Bring different styles, colours and prints together for a look that’s full of character Cheer up chores and bring easy style to your space with on-trend tea towels Industrial ceiling pendant, £39, La Redoute Global cushionsseat , £21 for two, Habitat Ochre casserole dish, £49.50, M&S Tribal Fusion tea towels, £14.99, Very Latte bowls, Anthropologie£30, Get the look

100 yourhomestyle.uk

MY PROBLEM LIVING ROOM

About

HOW I MADE IT WORK I played around with the layout to create separate zones: a cosy snug area, a relaxing living space and a sunny dining room. I decorated one wall with a vibrant mural and filled the rest of the room with lots of plants, a bright sofa and colourful accessories.

MY FAVOURITE PART All of my plants. They really thrive in this bright and sunny space. Before I’m Sarah Evans, 43, a yoga instructor and breast cancer charity CoppaFeel! advocate (coppafeel.org). I live in a three-bedroom new-build with my Welsh terrier, Freda, in Brighton. me My room... idea A willoversizedstatementrughelptozonemulti-purposespaces

Myroomlivingis

The open-plan living room was such an unusual shape, I struggled it didn’t reflect my love of bold colour and statement patterns.

MYPLACEHAPPY

Decorated with souvenirs from travels abroad and treasured gifts, Sarah Evans’ space is filled with special memories

Style

Sarah has set up her dining area under the roof light to create a sunny spot to entertain in. In the living space, velvet sofas add a burst of colour.

September 2022 101 £2,835TOTAL

stylingandFeature BradyMaxine Photos HolmesBee

The 1950s floor lamp was found in a flea market in Bridport, Dorset

Above the fireplace hangs a piece of artwork picked up from a CoppaFeel! charity art auction. Paint your fireplace a dark navy shade to create a striking backdrop for your prints. Sarah picked up the painted ceramic hand from a yoga retreat in Spain

MAKE PET-FRIENDLYIT

Busy homes with pets and young children need furnishings that are upholstered in hard-wearing materials, so they stand the test of time. For Sarah’s living room, she hunted down a sofa that had wipe-clean covers so they wouldn’t get ruined by Freda’s mucky paws. This sofa from Snug not only looks fantastic but it’s very durable, too. If your current sofa is looking tatty, consider getting covers made and go for a removable, machinewashable option to make your life a little bit easier.

TREASURESPERSONAL Give a piece of furniture character by styling it up with accessories that have a story. Sarah’s favourite pieces include ceramic jugs from her travels in Spain and Africa, an antique radio and a framed four-leaf clover, found on her grandad’s allotment. The vintage cabinet ties in with the storied feel. ‘My snug area is very narrow so I needed a slimline piece that would slot into place,’ explains Sarah. ‘I found this 1970s sideboard that’s been upcycled with hairpin legs on Etsy.’

HANG A MURAL

Create a quick and easy feature wall with a statement mural. Unlike a wallpaper, which is a repeated pattern, a mural is a made-to-measure print that fills your wall. Sarah chose the Botanique Jungle design from Graham & Brown as it includes all of the colours in her living room, helping to tie the scheme together. ‘The first thing visitors see when they walk in is the showstopping mural. It makes a great first impression,’ says Sarah. ‘The tropical print echoes all the plants in the room, which gives my home a jungle-inspired feel.’

Three simple tricks to try in your own home

Style advice

102 yourhomestyle.uk

‘I

andmybysurroundedbethingsthatremindmeoflife;placesI’vebeentothepeopleI’vemet’

Add personality to all-white walls with plants and bring natural texture and colour to a space. These macramé hanging planters, which Sarah made using a crafting kit, are a great way of filling empty-looking corners

When I moved into my house in March 2022, this living room was very plain and boring. It was lacking in colour and personality, and I didn’t know how to decorate the tricky Y-shaped layout. At the time, I was receiving treatment for breast cancer, so I couldn’t take on a big decorating project. Instead, I looked for ways that would create maximum impact but with minimum effort. The starting point for the décor was the mustard and emerald velvet sofas and then I found yellow velvet dining chairs in Next that matched perfectly. All the other accessories, like the artwork and rugs, are bits and pieces that I have collected over the years. I love to be surrounded by the things that remind me of my life; places I’ve been to and the people I’ve met. When I first moved in here, my friends and family all chipped in to help me. They unpacked boxes of accessories that had been stored in my parents’ garage for months. In one day, they hung up artwork, plants and built furniture, turning this bland room into a space that reflects my home style. Now my room is finished, this space makes me feel so relaxed. It’s the perfect place for me to rest and recover after treatment. Everything has a story to tell, and spending time in here brings back so many happy memories.

MY EXPERIENCE

łWall painted in Pop Blue, £40 per 2.5L, Zhoosh Paints ł The Rebel three-seater sofa in Forest Green, £799, Snug ł For a similar cabinet, try the Cornelia display cabinet, £330, Habitat ł Botanique Jungle Dawn mural, £35 per sq m, Graham & Brown ł For a similar rug, try Jiraya fringed Berber-style rug, £285, La Redoute ł Foiled Palm Trees cushion, £3; Diamond tufted cushion, £8.40, both Matalan ł Macramé Peach Blush throw, £32; Adha cushion in Ochre, £12, both Dunelm ł Stella dining chairs, £240 for two; Lloyd six-seater dining table, £650, both Next ł Mustard knitted pouffe, £29.99, Homescapes ł For a similar poster, try Frida’s Hand poster, £6.95, Juniqe łFor a similar lampshade, try the Empire Gathered lampshade, £99, Pooky ł For a similar rug, try the Moroccan rug, £290, Benisouk łFor a similar ornament, try the Phrenology hand ornament, £16, JOY. Turn to p128 for stockist details

My shopping list love to

Feature BurnsCatriona Bring warmth and character to your space, like Sarah, with these travel-inspired buys GET THE LOOK Globalluxe ‘I love being surrounded by things that remind me of places I’ve been’ Sarah Woven reed basket, £18, Bohemia Design Moroccan wall mirror, Dunelm£45, Kilim beanbag pouffe, £99.99 each, Homescapes Ivyline Antique brass shelf, £50, Fy! Cane side table, £36, Matalan Tropical Parrot wallpaper, £43 per roll, Lime Lace Gold wire side tables, £89.99 for two, Homescapes Wooden elephant ornament, Primark£4, Go online to shop with brands who work with global artisans for a truly eclectic and original look Take inspo from Sarah and go for a statement feature wall. A tropical print on a dark backdrop brings glam-meets-cosy vibes

Mind Over Matter poster; In Bed poster; Graphic Shapes No4 poster; Abstract Art No1 poster, from £9.95, all Poster Store Include postcards, photos and special mementos in your display for a gallery wall with a difference 3 OF A KIND... CUSHIONS COLOUREASYADD geometricAzteca rug, housecosy£109,GuatemalanBrocadepillow, £26, Karakorum Miami cushion, £27, Fy! Pebble print cushion, £9, Matalan Ortigia mosaic tray, £45, Woods Fine LinensZoritaoccasionalYellow chair, £115, B&Q Natalia table lamp, Dunelm£22, metalHammered table lamp, £98, Oliver Bonas Get the look

About me

By using a computer-generated design to visualise the space, Amy Davies Pereira got the bathroom that she always wanted

Where do I start! The room was old-fashioned, dull and, to be honest, almost unsafe with its dated pipework. The room just felt unloved and wasn’t a space that you could relax in after a busy day. The tiles were bland and boring, and the shower had seen better days.

Gone is the boring white and black bathroom with its dated mosaic tiles, and in its place is new sanitaryware, a vibrant cool colour scheme and a mix of textured and patterned tiles

MY PROBLEM BATHROOM

MY FAVOURITE PART I absolutely love the green wall tiles. I adore the fact that each one is a slightly different shade and the beautiful sheen they have when they catch the light at different times during the day. It’s so wonderful that I can have a restful bath or take a nice power shower in luxury. Before I’m Amy Davies Pereira, 48, and I’m an interiors blogger @littlehouseinlondon. My home is a three-bed Victorian mid-terrace in East London. I live with my husband, Alex, and children, Roman, 18, and Ava, 15, plus our cavapoo, Bea.

HOW I MADE IT WORK

MY SANCTUARYDREAM

106 yourhomestyle.uk

My room... ‘I’m over the moon with how amazing bathroomthehasturnedout–Iloveit!’

We stripped the whole room back and had everything re-plastered and replaced, including the original pipework. I got a CAD design from Natalie Nicholson Designs to help understand what was achievable in a relatively small space. Then it was a case of being brave and committing to the bold wall tiles and colour scheme.

Technology helpedme achieve

September 2022 107 £4,652TOTAL stylingandFeature BishopZoe Photos OrmeLizzie Style idea Mix and matchindividualtowelspatternedforanfeel

108 yourhomestyle.uk

ADD PATTERN

‘As soon as I saw the pink vanity unit, I fell in love with it and knew that it would be my basis for the scheme,’ says Amy who painted the walls in a muted pink to tie in with the statement piece. ‘The large sink has a traditional yet modern feel and the cupboard underneath is great for keeping toiletries.’ For extra storage, Amy had cupboardscustom-madedesignedto go either side of the sink. ‘I painted the doors the same green colour as the skirting boards and finished off the look with shell handles that complement the other chrome details.’

‘Because the green wall tiles are quite striking, I didn’t want anything too overpowering for the floor. Even though these star tiles, from CTD Tiles, are quite busy, the subtle grey colour softens them, and they really complement the space.

‘I’m always excited for the end of the day when I can relax in my gorgeous bath’

Style advice

To tie the whole look together, I painted the skirting boards in the shade Pleat by Little Greene, which I think really lifts the floor, too. A leafy houseplant, bath mat and accessories in natural materials, like this wooden stool and woven basket, add texture and interest to the space.’

‘I really liked the idea of having shelving in the bath and shower area for all my lovely toiletries. While traditional, these lovely chrome corner shelves were the perfect size and really matched the style of the shower,’ says Amy. When drilling into tiles, cover any surfaces that could get damaged. Once you decide where on the tile you want to drill, cover with masking tape and mark the spot with a pen. Make sure you’re using the correct drill bit (this will depend on the type of tile) and be sure to use waterproof sealant around any holes and gaps.

‘I can spend hours in the tub now,’ says Amy. ‘This bargain bath rack is from Amazon and it’s got plenty of room for my bath salts and a cheeky glass of wine’

STYLISH SHELVING

Three simple tricks to try in your own home

HAVE A START POINT

MY EXPERIENCE

When we moved into this place, we slowly worked our way through the rooms, decorating them one by one. The bathroom was really crying out for some love. I wanted this space to make a real impact, yet still be in keeping with the Victorian style of the house. Because the room is quite small, I asked a computer-aided designer (CAD) to help with the layout. A roll-top bath was top of my wishlist. Getting the CAD plan helped us see how the tub would look in the room and what space we’d have left. We asked our builder to work out what plumbing needed to be replaced or moved and having the visuals to hand made this so much easier. When we removed the original tiles, the plaster all fell off the wall and exposed the brickwork, so we needed to find a plasterer, which consequently delayed all the other tradespeople. Putting in a heated towel rail was a must-have for me, and the best place was above the toilet, where the piping could be replaced and hidden in the walls. One of my favourite features is the luxury shower from Burlington Bathrooms. It’s made such a difference to our day-to-day routine. Looking back, I think that with an old house like this it was over ambitious to imagine that the project would take a couple of weeks. In the end, it took about two months as I had a huge snag list to work through. Now that it’s all finished, I’m absolutely over the moon with how amazing the bathroom has turned out – I love it! I’m always so excited for the end of the day when I can relax in my gorgeous roll-top bath.

‘I wanted something a bit different for the taps, so I went for this unusual design from Burlington Bathrooms which matches the other taps in the room. I really love this classic design – it’s so timeless’ ł Dyroy White and Green wall tiles, £59.99 per sq m; Cuban Silver Star floor tiles, £59.99 per sq m, all CTD Tiles ł Walls painted in Dorchester Pink – Mid matt emulsion; skirting board and cupboards painted in Pleat, both £26 per 1L, Little Greene ł Riviera Pink vanity unit, £1,088; Kensington mixer tap, from £362; Hampton 150cm right-handed showering bath with luxury feet, £1,108; bath screen, £479; Avon thermostatic shower, £1,044; arched mirror, £269, all Burlington Bathrooms ł Riviera bathmat, £52, Anthropologie ł Shell handles, £6.49 each, Brass Bee ł Bath rack, £9.99, Amazon ł Bottle Green Ultimate towels, from £1.20; Water Hyacinth basket with pom poms, £30, both Dunelm ł Bustta baskets, £45 for two, La Redoute ł Kuva hand towel in Soft Teal, £14, John Lewis & Partners ł True White wooden blind, from £9.90, Blinds By Post ł Refillable bathroom bottles, from £8.49, Tilly and Sage. Turn to p128 for stockist details

My shopping list

Feature BurnsCatriona Create a place for everything and keep your bathroom GET THE LOOK storageSavvy ‘Having clever storage makes my bathroom feel so muchAmycalmer’ STORAGECLASSICSTAPLE Embrace the vintage look with a wrought-iron shelf. Styled with candles and your fave products, it makes a perfect pamper station clutter free and stylish, just like Amy Engraved wooden bath caddy, £45, Sunday’s Daughter Black & White Stripe laundry bag, £16, Andrassy Living Cirko mirror, £110, Umbra Stackers make-up caddy, £55, John Lewis & Partners Three-tier wall shelf, £49.60, Dibor Mustard Made wire baskets, £39, Rose & Grey Two-tier showercaddy , £20, Argos Fauna toilet roll holder, £30, Freemans Wall-mounted towel holder, £13, Habitat

CLEVERSPACESAVER September 2022 111 Mustard Made Shorty Short locker in Berry £139, Rose & Grey 3 OF A KIND... BASKETS Choose furniture with legs to free up space. There’s plenty of room for a storage basket under this locker Canvas buckets, £8.45, Tabitha Eve Rhodes striped storage basket, £10, B&M Cotton storage basket, MatteH&M£19.99,HomePinkdispenser, £5; tumbler, £3, George Over-the-doorHome storage rack, £24, Dunelm Wenko Norway bath stool, £69.95, Victorian Plumbing Stripes and Flowers washbag, £16.50, Oliver Bonas Liewood Weston storage crates, £14 for set of Anthropologietwo, Daisy make-up brush holder, £16, Urban Outfitters Get the look

112 yourhomestyle.uk BRIGHT BUREAU BEFORE Holden Décor Teal Bird Trail wallpaper, £15 per roll, B&Q. All other items, stylist’s own

4 Using a small artist’s paintbrush, carefully apply two coats of gold paint along the edges of the pigeon holes and shelves inside the desk to highlight them.

September 2022 113 Upcycling challenge 21 3 4 5 6 shotsstepandprojectFeature, De’AthAnna-Lisa photoMain BellSussie If you need a desk to work from at home but you’re short on space (turn to page 80 for our feature on WFH) a vintage writing bureau is ideal. They’re cheap and easy to find in junk shops or on online auction sites, great for storage and they fold neatly away when not in use. Once found, give your desk a mood-boosting colour drench effect to make your working day feel more cheerful. YOU WILL NEED z an old writing bureau z screwdriver z sanding block z paintbrush z Valspar furniture paint in Aloe Vera, £22 for 750ml, B&Q z Valspar furniture paint in Grand Estate, £22 for 750ml, B&Q z Royal Metallics in Gold, £1.98 for 125ml, Protek woodstain z artist’s paintbrush z tape measure z pencil z craft knife z straightedge ruler z cutting mat z wallpaper off-cut z spray adhesive z decorative washi/masking tape

5 On the drop leaf of the desk, measure a rectangle 4cm smaller on each side than the size of the drop leaf. Lightly draw the outline of the rectangle in pencil centrally on the surface of the drop leaf. Using a craft knife, a metal ruler and a cutting mat, cut a piece of wallpaper to the same size as the rectangle and use spray adhesive to glue it firmly to the surface of the drop leaf. Gently glide your hands over the surface of the wallpaper to remove any air bubbles and ensure a smooth, flat finish.

3 Give the interior of the desk, including the internal drawer fronts, two coats of ochre furniture paint, allowing the first coat to dry thoroughly before applying the second.

1

Begin by carefully removing the handles of the desk using a screwdriver. Be sure to store all the fittings safely so you don’t lose any pieces, as you’ll need them later. Use a sanding block to give the surface a light key to help the paint adhere better. Once you’ve finished sanding, wipe the surface with a damp cloth to remove dust and dirt. Allow to dry.

6 Cut four lengths of washi tape slightly longer than each side of the wallpaper rectangle. Carefully stick them along each side of the wallpaper, slightly overlapping the edges. Run your finger along the tape to ensure it is firmly adhered to the desk. Use a craft knife to make a 45-degree cut in the overlap of washi tape at each corner. Gently peel away the excess tape to create a neat corner. Press each corner down firmly to ensure it is well adhered to the surface.

2 Give the exterior of the desk, including the external drawer fronts, two coats of green furniture paint, allowing the first coat to dry thoroughly before applying the second. Once the paint is dry, replace the handles on the desk.

dilemmas 114 yourhomestyle.uk EXPERTS

Ask the

A Claire Manton, Creative Director and Founder at Claire’s Crafthouse, comments… Woodworm is relatively easy to spot, but ascertaining if it’s active or historic is difficult. Look for telltale signs, such as clusters of small bore holes. If an infestation is active, you may well see what looks like fine powdery sawdust beneath the piece, or even dead or active beetles. It’s more difficult to spot this debris if a piece has recently been moved or cleaned. It’s worth looking inside pieces and removing drawers to inspect the carcass interior for evidence. Experts can spot previously treated woodworm, but should you inadvertently buy a piece that you later realise is affected it’s always best to treat it straight away for peace of mind. Keep it away from other wood until you have finished working on it. Sand off any varnish or other finishes on the furniture so that raw wood is exposed, ready for treatment. Leaving any finishes on could render these solutions ineffective. Finally, brush or spray an anti-woodworm solution onto the raw wood of your furniture, paying attention to internal areas of the carcass and drawers, as well as the external parts.

Harry Williamson, Liverpool

Jackie Shoard, London

Q

Q I am trying to live greener and I often see furniture items I like on local freecycle sites and in second-hand shops. However, I am concerned about woodworm and other pests. How can I check before purchase – or treat afterwards – to ensure anything I bring into the home is clean, safe and not going to cause problems?

Converting an attic room into an additional bedroom or office area is a practical way to maximise on space. Because most attics have sloping ceilings we suggest fitted wardrobes with angled sides. The higher point of the wardrobe can be used for full-length storage; as the depth decreases you can fit shelves, cupboards and drawers. Fitted wardrobes offer a streamlined look and they are also an entirely practical storage option that can be customised to individual needs and design preferences. Full-height wardrobes facilitate double hanging, while alcove space can also be utilised with additional fitted furniture as well as made to measure pieces for optimal storage options.

Q We’d love some really good storage in our attic bedroom – what are the options with fitted wardrobes and are they really the best use of space?

Ajua Abioye, Carlisle

Our panel of those in the know

A Steve Healy, National Business Development Manager at Mereway and Trend Bedrooms, advises…

Feature GilbertHayley

LayRed flooring in York Stone, £47.99 per sq m, Moduleo Claire’s Crafthouse sells eco-friendly furniture paints, as well as offering bespoke furniture restyling

We want to replace our open-plan kitchen flooring. We have tiles at the moment – do we need to remove these if we want to lay LVT? Any advice on sub floor and underlay would be great too.

Elise fitted bedroom furniture in Charcoal, from £4,000, Trend Interiors

First, ensure that the height of your LVT is not going to be too high when placed over existing tiles, as this can mean you’re unable to open doors and cabinets. Moduleo has lots of options with the stick-down and free-floating systems, some of which may suit you. Our newest is the luxury option, Moduleo LayRed. This is our engineered vinyl flooring designed with integrated underlay, which has the capability to be laid over existing flooring and is perfect for uneven floors.

A Matthew Brook, National Sales Manager for Moduleo says… Luxury vinyl flooring can be laid over existing tiles, but not on every occasion as it really does depend on the existing flooring that is already down. There are underlay options for using with stick-down LVT and there are also click systems that will allow you to install over existing flooring. However there are a few things to consider...

Abigail Bentley, Cardiff A Phil Etherden, Managing Director at The Albion Bath Company, says… With a smaller space, the trick is to maximise the visible floor area, so use a free-standing bath on feet or a plinth. Don’t be tempted into cramming large items into a small room. The effect will be to lose all aesthetic value while making the room look cluttered.

Tubby Torre plinth bath, from £2,541, The Albion Bath Company

Futura 5 woodburning stove, from £1,295, Stovax If you have a DIY dilemma or home question,improvementemailusat homestyle@ourmedia.co.uk or write to Ask the Experts, HomeStyle, Our Media Ltd, Eagle House, Bristol, BS1 4ST.

Q I’d love a wood burning stove this winter but I don’t have a chimney. Is it still possible and if not, what are my options for a similar effect?

WENEEDYOURQUESTIONS!

Q My bathroom is quite small, is it possible to have a roll-top bath and what about the tap in terms of plumbing?

Megan Pedreira, Kent A Michael Coke, Biomass Products Development Manager at Stovax, has this advice… If you don’t have a chimney, you may be able to install a pre-fabricated one that works in the same way as a normal chimney would. There are options for you to have one that either runs internally or externally to your property, and allows you to enjoy a stove or fire in your home. Your retailer will be able to advise which type is best for your installation. This will allow you to have a woodburning stove, such as Stovax Futura 5, despite not having a chimney.

A gas stove may be an option as many models are available as balanced flue versions, which do not need a chimney, but rather a twin-wall pipe to vent directly through an outside wall. Air for combustion is drawn in through the outer pipe while the inner pipe removes the combustion gases to the exterior of the property.

When choosing the bath, it is important to consider whether you want a traditional or contemporary feel; bathtubs are available in many styles with roll-top or flat top, single or double ended, along with many possible feet or plinth choices. There is also the option to have a freestanding bath that is designed to fit flush against a wall or even to use as a shower bath. At Albion, we wanted to get the fun factor of a free-standing tub into a small bathroom so the Tubby roll-top was born. With its generous depth, you can get fully submerged but at only 1,200mm long, it can grace a small space that may otherwise be redundant. It can be used with taps that are either wall-mounted or on top of our sturdy standpipes. There is also a great range of over-bath shower systems for a luxury look that is still practical for busy family life.

Expert advice

If solid fuel or gas appliances are not an option, an electric product is suitable for homes without a chimney; simply plugging into a standard mains socket can offer a stunning flame effect, with or without the heat for year-round ambience.

INTRODUCTORYSPECIAL OFFER OFFER ENDS 31st December 2022 *3 issues for £5 offer only is only available to UK residents paying by Direct Debit. After your first 3 issues your subscription will continue at £10.75 every 6 issues. If you cancel within 2 weeks of receiving your 2nd issue you will pay no more than £5. Your subscription will start with the next available issue. † UK calls will cost the same as other standard fixed line numbers (starting 01 or 02) and are included as part of any inclusive or free minutes allowances (if offered by your phone tariff). Outside of free call packages call charges from mobile phones will cost between 3p and 55p per minute. Lines are open Mon to Fri 8am – 6pm and Sat 9am – 1pm. HUNDREDS OF GREAT-VALUE IDEAS FOR EVERY ROOM Simple ways to order Visit www.buysubscriptions.com/YHH22 Or call 03301 358962† and quote: YHH22 FIRST 3 ISSUES FOR ONLY £5* WHEN YOU SUBSCRIBE TO YOUR HOME MAGAZINE Be inspired by real reader homes and makeovers 0J      Ǎ     (        TRY HOMESTYLE’S AMAZING SISTER MAGAZINE TODAY!

sized pots. Each

Ruby

in oven.the

film,

H x 50cm W),BritishPurlfrostdesigner

While waiting for your tap to run hot, save on water wastage and keep the cold water in a jug to use later wateringforplants

have

re-jute runner rug,

and

Finmat saucepan with lid £45,

pad that

IKEA These neat reusable,, plastic-free bags are perfect if you love loose leaf tea! £10.99 for liveinthelight.co.uktwo,, . A NOTHER BREW? OHESUOHLDESSENTIALS bowlsPet 1 Reactive glaze pet bowl, £8.50, Oliver Bonas 2 Pet food bowl on wooden stand, £11, Matalan 3 Eleanor Bowmer pet bowls, set of two, £26, Five and Dime 1 2 3 Rose-tinted glasses Add privacy and impact to your windows and doors with Purlfrost’s wide range of glass film patterns. Choose from period styles or more contemporary designs to suit your home. Check out our 10 step guide online to find out all the best sustainable options for restoring your home! Search ‘eco‘ renovation guide ’’ yourhomestyle.ukat. PL A NNING A RENOVA TION? Marley’s Monsters reusable tea bags, set of two, £10.99, Live in the Light

The clever folks at Ruggable created system,, a non-slip makes machine this stain-resistant made from soft black £159, Ruggable Art Deco glass £13.75 (25cm

all hob types, including

pan

recycled plastic bottles. KEEP IT CLEAN Checkerboard

Saucy style

,

and

Ilse Crawford has teamed up with IKEA to release a range of stylish practical copper-finish a saucepan, sauté and two comes with a lid has a stainless steel and base, can be safely used on induction, as well as

a two-piece

September 2022 117 Helpful hints Our pick of the latest products, hacks and hints to make your home life simpler and more sustainable… AKTIEDUTTON, QUEE N OF HACKS

stained

cover and

washing your rug a doddle. We love

and

interior

pans. The collection includes

runner,,

1 Stainless steel lunch box, £27.95, Black+Blum

This boho plant pot is made from recyclable kraft paper that can be composted at the end of its life. It’s washable too! Check out more of our favourite biodegradable plant pots at yyourhomestyle.

3 OF THE BEST Bento boxes

COMPOSTABLE POT

2 Studio Ghibli Kiki’s Delivery Service bento box, £15.99, Zakzakka 3 Butterfly garden bento box, £12, Paperchase 3 laundryLuxe Wilton London’s detergent is one of the best-smelling products we’ve ever had the pleasure to sniff! The brand uses eco-friendly essential oils that make your clothes, bedding and your whole home smell heavenly. We particularly love the Jasmine scent. Prices from £6-£8.95, wiltonlondon.co.uk diffusingatStrugglingtounwindnight?Trylavender or bergamot oil – both are known to help soothe tension and stress

2

BRAEMAR Black eco-friendly kraft paper plant pot cover, 30cm, £16, Basil and Fleur on Etsy ENERGYSAVER

We love an all-in-one product,, especially when it takes the faff out of a cleaning job! This steam cleaner from Lynsey Crombie’’s new collab with Swan is just that. It comes with five attachments to target different zones and we found it particularly good at deep cleaning the oven and uprooting grime and limescale from taps.

Iced coffee lovers, take note! Breville has released a new compact coffee machine with a special ‘over ice’ function that makes iced coffees easier to achieve at home. The model is capsule free and features a reusable filter for zero waste too. The oncostscoffeeIced+Hotmaker£64.99Amazon.

118 yourhomestyle.uk

MEAN, CLEAN, STEAM MACHINE Lynsey TVs Queen of Clean handheld steam cleaner, £59.99, Swan

BOILING POINT Philips’’ Eco Conscious kettle is made from 100 per cent recycled bio-based plastic and it has a handy,, onecup marker,, which helps reduce water waste. £49.99,, Currys Hot & cold

MONTHNEXT Smart

Feature HibberdLisa EDITOR’SCHOICE

We love: The option to infuse clothes with your favourite scent.

Suitcase saviour

We love: The dual steam modes: Eco to save water and Turbo for more stubborn creases. Full steam ahead Steam Genie handheld garment steamer, £39.99, Russell Hobbs Ideal for upholstery or delicate fabrics, the 1650W Steam Genie heats up in 45 seconds and offers 11 minutes of continuous steam. The upholstery attachment will refresh and clean larger items, such as bedding and curtains, while the delicate attachment will take care of fabrics, including silk and lace.

A great alternative to an old-fashioned travel iron, this neat 1500W steamer is surprisingly powerful and is the ideal crease-busting companion both at home and while travelling. It’s lightweight and easy to use, with a detachable 260ml water tank holding enough for up to 14 minutes of continuous steam. We love: the adaptor that allows you to use a regular water bottle as the water tank. securityhome

Pure Tex DT9530 handheld garment steamer, around £109.99, Tefal With a fast heat-up time of under 30 seconds, Tefal’s 4-in-1 1700W steamer not only removes creases but sanitises, de-lints and adds fragrance too. The magnetic, quick-change pads make swapping between modes easy, meaning that your garments will be clean and fresh in next to no time.

Letting off steam Rose Gold 1000W garment steamer, £29.99, Tower At under £30, this nifty gadget is a fantastic budget buy that’s suitable for clothing, curtains and more. It heats up in just 35 seconds and has a 200ml water tank providing up to five minutes of continuous steam. Use the brush head that’s included for even more efficient steaming. We love: the long 2.5m power cord for added flexibility.

Fridja F10 Raf handheld travel clothes steamer, £79.99, Lakeland

We love: At under £40 this is a smart option if you’re on a tight budget.

September 2022 119 Home tech

5 OF THE BEST STEAMERS

Flawless in a flash Morphy Richards Express Steam 361000 handheld garment steamer, £59, AO.com Give your clothes the TLC they deserve with this lightweight 1750W model that boasts a 270ml water tank and a heatup time of 35 seconds. It comes with a lint brush to separate fibres while you’re steaming; it will pick up hair as well so you can ensure your outfit is flawless for those special nights out.

Portable and easy to use, a handheld steamer is the gadget you didn’t realise you needed! There are lots of options on the market, some offer extra benefits, such as de-linting and scenting options, while others are ideal to take on holiday with you. Once you’ve tried one of our top five handheld steamers, you’ll wonder how you ever lived without one.

Coming up roses

Fridge Raiders has launched two meat-free flavours called Tasty Bites to join its stable of chicken-based snacks. Swapping out chicken for fava bean, Fridge Raiders says the two new products, Slow Roasted and Katsu, are the tastiest, ‘non-chicken snack in the world’. High in protein and fibre and designed for a slow energy release, pop them in the fridge for snacky moments. Sainsbury’s, Tesco and Morrisons; RRP £1 (45g) and RRP £1.30 (65g).

The products, books,

NichollsKatie

P ER FOODISTA

‘Autumn is always an exciting time for foodies as the ideasintroducesharvestnewflavoursandforheartiermeals’

KATIENICHOLLS, SU

DASH OF GREEN

Feature

A little bite

As part of our mission to find ways to make the most of every meal, we asked Luisa Coates of thermometers brand, Thermapen, for advice on how to correctly cool and reheat leftovers so that we can all get involved in batch cooking safely. ‘Cooling leftovers should be done within three-to-four hours,’ says Luisa. ‘Remove food from hot dishes and put it into containers. Cover and let it cool down to room temperature (20°C) and store leftovers in your fridge for no more than two days. Reheated food should be warmed until it reaches and maintains 70°C or above for two minutes,’ Luisa advises. ‘The food should be piping hot throughout. Use a Thermapen thermometer to accurately check the internal temperature of your leftovers.’

CORNERFOODIE ideas and people that are shaking up the scene this month

CHEFTHRIFTY

120 yourhomestyle.uk

Add a little zing to your drinks with the new Lime & Mint flavour from Bottlegreen. Perfect to pep up still or sparkling water, or as a fruity addition to a mojito – simply shake together with rum and raspberries, top with soda and pour over ice. The new Lime & Mint flavour joins the established Bottlegreen stable of Elderflower, Ginger & Lemongrass and Pomegranate & Elderflower. Available from major supermarkets, RRP £3.75

food

Ramen producer Kabuto has gone 100 per cent vegetarian, taking out the chunks of chicken and beef, using animal-free flavourings instead. The Asian-inspired pots, that contain only natural ingredients, come in 100 per cent recyclable packaging and are perfect for those looking for a quick lunch solution (£1.65 from all major retailers). kabutonoodles.com Oodles for noodles

If you’re a fan of small plates and vegetarian food, then former Great British Bake Off contestant, Urvashi Roe, has released a book you’ll love. Titled Biting Biting: Snacking Gujarati-style, the book is a collection of delicious Gujarati-inspired snacks. Featuring recipes that can be made from cupboard essentials, the book celebrates food to welcome friends and family, such as spicy stir-fried cashews, onion fritters and rice flour dumplings.

Every month we turn the spotlight on one of our favourite foodies Food writer, presenter and innovator of the pop-up food scene, Gizzi is a whirlwind of culinary inspiration, having written several books including Slow, Restore and Healthy Appetite. Gizzi loves a collab and recently hosted a cooking class, ‘Plantstronomy’, with whereLeithsbrand,meat-alternativeEatplantedatCookerySchool,Gizzicutherteeth as a young, aspiring chef. During the event, Gizzi created plantbased versions of dishes, such as Thai mock crispy duck and watermelon salad. Whether it’s collabs, books, demos or hosting her podcast @sexliesdmslides, keep your eyes on Gizzi’s next move.

DARK ’N’ DREAMY Take it easy with Feel great with Healthy

For the first time in 10 years Maltesers has had a makeover with a new dark chocolate option. There are three bags to enjoy: treat (£1.19), regular-size (66p) and super-size (£2.79). The new choccy balls have 30 per cent less sugar than regular Maltesers with 65 per cent cocoa content. Available from retailers nationwide.

ERSKINEGIZZI

SlowSustainwithRestore

TURN THE PAGE FOR DELICIOUS MIDWEEK ME A L IDE A S A ND RECIPES

sensationalSnack

GizziOurAppetitefavebooks!

Spiceoflife Drink me Chai has relaunched with a new barista recipe and recyclable metal tin. Enjoy Spiced, Vanilla and Vegan. RRP £2.80 from all supermarkets.major

Vegan homemade brownie delivery company Cake or Death has had a subscription upgrade that allows you to choose which flavours go in the box. Sign up for a Build A Box subscription and you can change flavours while saving 15 per cent compared to one-off purchases. There’s plenty of choice with combos, such as Sea Salt and Peanut Chocolate cookie, as well as classic flavourings, including Biscoff, Oreo, Nutella-style hazelnut and Candied Orange. Prices start at £15; cakeordeath.co.uk

BOOKNEW

September 2022 121 Food news

TAKE YOUR PICK

Biting Biting: Snacking Gujarati-style (Kitchen Press, £17.60) is released on 1st September.

Monday LEFTOVER LAMB PASTA BAKE PREPARATION TIME 10 minutes COOKING TIME 40 minutes SERVES 4 INGREDIENTS

4 Fry the bacon over a medium-high heat with a drizzle of oil in a large frying pan (preferably non-stick) until really crispy. Remove with a slotted spoon and drain on kitchen paper.

COOK’S TIP

Tuesday PARSNIP, BRUSSELS SPROUT AND BACON POTATO CAKES

COOKING TIME 1 hour

ł 1 chicken or vegetable stock cube, made up to 600ml ł 300g rigatoni pasta ł 300g leftover cooked lamb, diced or shredded ł 100g Cheddar, grated ł 100g mozzarella, sliced 1METHOD

6. Toss the parsnips with salt, pepper and 1 tbsp of the oil. Spread over an oven tray and roast for about 10 minutes until they are beginning to caramelise. Remove, allow to cool then roughly chop.

ł

2 While the parsnips are roasting, boil the potatoes in salted water until soft, about 20 minutes. Drain well and mash while warm. Keep your mash as dry as possible so that the cakes hold together; if it seems wet, stir it over a low heat for a few minutes.

3 Cook the sprouts in salted boiling water for about 5 minutes. Drain and cut into quarters.

5 Keep the oil left in the pan to fry the cakes. Mix the veg with the bacon and season. Dust your hands with flour and mould into burger-sized patties. Add the remaining oil to the frying pan, place over a medium heat and fry the cakes in batches until golden brown. Keep the cakes warm in an oven heated to around 160°C/140°C/Gas Mark 3 while you finish making your batch, to prevent the cakes from going cold. T

1 tbsp vegetable oil ł 1 onion, finely diced ł 2 carrots, peeled and finely diced ł 1 celery stick, finely diced ł 1 garlic clove, crushed ł 1 tbsp tomato purée ł 10g fresh thyme, leaved picked ł ½ tsp Worcestershire sauce

SERVES 2 INGREDIENTS

3 Transfer to the oven and cook for 10-15 minutes until the pasta is fully cooked and the cheese is golden and bubbling. Scatter with more thyme leaves to serve.

ł

1METHOD

Waste not, want not with these five delicious

Depending on the cut, lamb can be expensive to buy but it’s also very versatile as a leftovers and works well in stews, curry, tagine or in wraps with houmous and salad. It also deepens in flavour to create delicious next-day dishes.

2 Add the tomato purée, most of the thyme leaves and the Worcestershire sauce to the veg, stir, then pour in the stock and bring to a simmer, uncovered. Tip the pasta into the sauce and simmer over a medium heat, stirring frequently, for 8-10 minutes until most of the liquid has been absorbed and the pasta is just starting to turn tender. Stir in the lamb and scatter over the cheese.

ł 300–400g potatoes, peeled and cut into even-sized pieces ł 200g Brussels sprouts, outer leaves removed ł 8 rashers smoked streaky bacon, finely sliced ł polenta flour (or plain flour), for dusting ł 4 eggs (optional)

Heat the oven to 200°C/180°C Fan/Gas Mark 6. Heat the oil in a wide, hob-safe ovenproof frying pan or casserole dish. Add the onion, carrot and celery and fry for 10-15 minutes until soft. Stir in the garlic and fry for 1 minute more.

Preheat the oven to 200°C/180°C Fan/Gas Mark

PREPARATION TIME 10 minutes

MEALSMIDWEEK COOKCREATIVE M

200g parsnips – leftover boiled, steamed or roasted ł salt and pepper ł 3 tbsp olive oil

riverford.co.cakespotatobaconandsproutBrusselsParsnip,eggrecipes.co.uk;EggsLionBritishfrittatacurry-nightLeftoveruk;OmelettewithcheesychipsBritishLionEggseggsrecipes.co.uk;Tuscan-stylevegetablesoupandleftoverlambpastabakerealfoodtesco.com

COOK’S TIP If preferred, you can cook this frittata in the oven preheated to 200°C/180°C Fan/Gas Mark 6. Once you’ve fried your onion and re-heated the curry, pour the mixture into an oven-proof dish that’s been lined with grease-proof paper. Place it in the oven for 20-30 minutes. dishes, all rustled up from leftovers and neglected veg in the fridge

5

7

Loosen the edge of the omelette with the spatula and fold a third into the middle.

Sprinkle with the remaining cheese and serve with salad if desired. COOK’S TIP This is a great way to make the most of that half bag of chips from the night before but you can also use leftover roast potatoes or roasted vegetables in this recipe. The next-day flavour will flood out! If using vegetables that haven’t already been cooked in oil then add a little extra during step 1. minutes

Friday LEFTOVER CURRY-NIGHT FRIT TATA

1METHOD Heat the oil in a 22cm non-stick frying pan on a medium heat, add the onion and fry for 2 minutes, stirring occasionally until soft.

4 Put the pan under a hot grill and cook for 1-2 minutes until the top of the omelette is set and golden. Shake the pan to loosen the frittata and slide it onto a plate.

3 Pour the whisked eggs over the chips in the pan and cook on a medium heat for 2 minutes. As the eggs set, use a spatula to loosen the edges.

5 Cut into six wedges and serve with leftover naan bread and chutneys

September 2022 123 Food planning

2 tsp vegetable oil ł 1 red onion, chopped ł 1 red chilli, deseeded and sliced ł 250g leftover vegetable curry (such as sag aloo or Bombay potatoes) ł a little chopped fresh coriander (optional) ł 4 large British Lion eggs ł a pinch of salt ł ground black pepper ł leftover naan bread and chutneys to serve

COOKING TIME 10 minutes SERVES 2

ł

COOK’S TIP If you want to batch cook and freeze the soup, after making, leave it to cool at room temperature. Freeze (without garnishes or toppings) in a rigid container, leaving a bit of space for expansion, for up to 3 months. Reheat either from frozen or defrost in the fridge overnight. Once piping hot, add toppings or garnishes and serve.

3 Crack your eggs into a jug and add seasoning. Pour into the pan and stir well, then cook for 3 minutes, shaking the pan occasionally until the base is set and golden.

Feature NichollsKatie Recipes

4 When the base is golden, but the top still slightly runny, scatter over the tomato (if using) and half the cheese.

2 Stir in the chilli and leftover curry and shake the pan to make an even layer. Cook for 4 minutes, stirring and shaking to turn the curry until it is piping hot. Add the coriander for the final minute of cooking.

2 Crack your eggs into a jug and beat with 2 tsp water and seasoning.

ł

ł 100g leftover chips, roughly chopped ł 1 tsp vegetable oil ł 2 large British Lion eggs ł pinch of salt ł ground black pepper ł 1 tomato, chopped (optional) ł 25g cheddar cheese, grated ł salad to serve 1METHOD Heat a 22cm non-stick frying pan over medium heat, add your leftover chips and fry for 4 minutes or so, stirring occasionally until the chips are crisp and hot. Add a little oil to the pan if your chips seem dry, then shake the chips into an even layer.

INGREDIENTS

PREPARATION TIME 10 minutes COOKING TIME 10 minutes SERVES 2-3 INGREDIENTS

SERVES 4 INGREDIENTS

Thursday TUSCAN-STYLE VEGETABLE SOUP PREPARATION TIME 10 minutes COOKING TIME 35

Wednesday OMELETTE WITH CHEESY CHIPS PREPARATION TIME 5 minutes

2 garlic cloves, finely chopped ł 1 celery stick, chopped ł 1 carrot, chopped ł 1 parsnip, chopped ł 1 onion, chopped ł 1 leek, white and pale green parts only, sliced and rinsed ł 2 tbsp olive oil ł 400g tin cannellini beans, drained ł 50g long grain rice ł 1.2 litres vegetable stock ł 150g kale or cavolo nero, shredded ł 3 tbsp green pesto ł 25g Parmesan, finely grated 1METHOD In a large saucepan, cook the garlic, celery, carrot, parsnip, onion and leeks gently in the olive oil for 10 minutes. Keep the heat low and stir often until soft, but not browned. Stir in the drained cannellini beans and rice, followed by the vegetable stock. Bring to the boil and simmer for about 20 minutes. 2 Crush some beans with the back of a spoon to further thicken the soup. Stir in the shredded cavolo nero or kale and simmer for a final 5 minutes, adding a little water if it becomes too thick. Stir in half the pesto and half the cheese, dividing the soup between bowls and finish with another serving of any remaining pesto and cheese on top of each bowlful.

6 Tilt the pan towards the folded edge and slide the omelette onto the plate folding the rest of the omelette over as you go.

WTF

124 yourhomestyle.uk STREETFROMEATSTHE Sticky, messy and totally tasty! Let’s get stuck into the exciting flavours of street food THIS PROTEINGRAB-AND-YUMMYGOTREATISALSOAHIT

1 tsp sumac (citrus-flavoured Middle Eastern spice) ł 1 tsp dried oregano ł sea salt and black pepper

trang nuong PREPARATION TIME 20 minutes COOKING

Healthy Vegan Street Food by Jackie Kearney will be published on 11th October (Ryland Peters & Small, £20). Photography by Claire Winfield © Ryland Peters & Small gyros

For the dressing ł 75g baby plum tomatoes ł ½ cucumber ł 1 handful of fresh mint ł 80g almond yogurt For the wraps ł 8 tbsp buckwheat flour ł sea salt

ł

To serve ł 20g mixed salad leaves ł lemon wedge ł mint leaves METHOD

SERVES

2 large white potatoes ł ½ tbsp oil ł 1 tsp oregano ł sea salt and black pepper

5 Repeat with each rice paper sheet then eat immediately and enjoy!

5 Put the pork into a bowl. Mix with the zest, sumac, oregano, sea salt and black pepper. Return the pan to a medium-high heat with 1 tsp oil. Fry the pork for 3-4 minutes, until cooked. 6 Serve with the mint yogurt spread on top. Load them up with the fries, tomatoes, salad leaves, cucumber, pickled onion and pork. Garnish with a lemon wedge and mint leaves. VG

TRANSLATESVIETNAMESETHISDISHAS‘RICEPAPERPIZZA’ 4321

Banh TIME minutes 4 INGREDIENTS

ł

September 2022 125 Street food Feature NichollsKatie Recipes mindfulchef.comgyrosPork

3 Turn the heat down to medium/low if browning too quickly, and cook for another few minutes until the toppings are melting and the underside is starting to brown. Scatter with chillies and crispy shallots, if using. Drizzle the mayo and chilli sauce across the top in a large zig-zag pattern, so there is an even distribution of sauce.

Pork

PREPARATION TIME 40 minutes COOKING TIME 30 minutes SERVES 2 INGREDIENTS

For the chips

Preheat the oven to 220°C/200°C Fan/Gas Mark 7. Leaving the skin on, cut the potatoes into fries. Place onto a lined baking tray and drizzle with ½ tbsp oil; season with oregano, sea salt and black pepper. Bake for 25-30 minutes, until golden. Finely slice the half onion. Zest the lemon and quarter. Put the onion into a small bowl with the juice from half the lemon and a pinch of sea salt. Stir well, then set aside. Halve the tomatoes. Thinly slice the half cucumber. Remove the mint leaves from their stalks and finely chop (leave some leaves for garnish). Mix the chopped mint and yogurt together in another small bowl. Season with sea salt and black pepper. To make the wraps, place the flour into a mixing bowl and season with sea salt. Slowly add 200ml water, until you have a smooth batter. Heat a medium frying pan with 1 tsp oil on a medium heat. Pour in half the batter and swirl around. Cook for 3 minutes on each side, until turning golden brown. Set aside. Repeat with the remaining batter.

For the zest ł ½ red onion ł 1 lemon ł sea salt

Place a large frying pan over a high heat. In a small bowl, whisk the gram flour, ground turmeric and black salt with 6 tablespoons water until a smooth batter forms.

4 Carefully fold the rice paper in half. It will crack a little – but try to do it in one gentle but swift action, folding like a quesadilla. Toast gently for another 20–30 seconds, turning once.

For the filling ł 300g free-range pork strips

ł

ł

2 Lay one rice paper sheet onto the hot pan, and toast for 30 seconds. Turn down the heat to medium and smear the rice paper with a tablespoon of the gram flour batter, making sure it forms a thin layer that almost reaches the edges but doesn’t spill over. Sprinkle the top with the spring onion greens, then add small blobs of vegan cream cheese and scatter the vegan ham (if using) across the ‘pizza’.

200ml water ł 1 tsp oil

3 scant (just short of) tbsp gram flour (chickpea flour) ł 1 scant tsp ground turmeric ł ¼ tsp black salt ł 4 rice paper sheets ł 3 spring onions, green part only, thinly sliced ł 3-4 heaped tablespoons vegan cream cheese, such as Bute Island Scheese ł 4 slices Vietnamese vegan ‘chicken ham’, sliced into small strips, or use any vegan ham or bacon (optional) ł 2 small red chillies, finely chopped ł 2 tablespoons crispy shallots ł 2 tbsp vegan mayo, to serve ł 2 tbsp sriracha, or any chilli sauce, to serve 1METHOD

15

4 Add to a large bowl with the onions, watercress and herbs, mix well before adding the feta.

4 medium courgettes, grated ł ½ tsp salt ł 6 spring onions, finely sliced ł 20g watercress, finely chopped ł 2 tbsp mint leaves, chopped ł 2 tbsp parsley, chopped ł 2 tbsp dill, chopped ł 150g feta, crumbled ł 2 large eggs, room temperature, beaten ł 200g plain flour ł 2 tsp baking powder ł 60-80ml olive oil for frying Dill yogurt dip ł 200g full-fat Greek yogurt ł 2 tbsp lemon juice ł 1 clove garlic, minced ł 20g dill, finely chopped ł ½ tsp salt 1METHOD Mix all the dip ingredients and put in the fridge.

5 Add the eggs and fold the mixture together, trying to maintain a little integrity in the feta pieces. Finally sift over the flour and baking powder and mix until fully blended.

ł

ł ¼ small red cabbage ł 1 lemon ł salt ł freshly ground black pepper ł 1 cucumber ł 2 brioche burger buns ł 226g pack Garden Gourmet Sensational burger ł 2 tbsp reducedfat red pepper houmous ł 50g lamb’s lettuce or any normal green lettuce ł 50g carrot, peeled and finely shredded ł 1 tbsp vegan garlic or spicy mayonnaise

Watercress, courgette and spring onion fritters with a dill yogurt dip

2 Add courgette to a colander, sprinkle with ½ tsp salt and set aside in a sink for 30 minutes.

7 Serve hot with the dip. MAKE FORANDBATCHESINKEEPLUNCHESORTASTYSNACKS

V

COOKING TIME 15 minutes

SERVES 2 INGREDIENTS

2 Using a peeler, peel slices of cucumber into thin ribbons and season with lemon juice, salt and pepper.

SERVES 4

PREPARATION TIME 20 minutes, plus 30 minutes soaking time

3 Gather the courgette in your hands and squeeze out all the excess moisture; you are aiming to get as much out as possible.

COOK’S TIP If you like a little spice in your burger, add a finely chopped green-finger chilli into the red cabbage salad.

126 yourhomestyle.uk

3 Toast the bun halves in a dry frying pan and set aside. Cook the burgers in a frying pan for approximately 10 minutes.

COOKING TIME 10 minutes

INGREDIENTS

Fully burgerloaded PREPARATION TIME 15 minutes

5 Place the burgers on top of the lettuce with carrot, vegan mayonnaise and the cucumber ribbons. Place the bun lid on top.

6 Heat the oil in a heavy-based pan until hot. Add tablespoons of the mix and cook for 2 minutes each side. Remove and drain on kitchen paper.

V

1METHOD Shred the red cabbage and season with lemon juice and black pepper.

4 Spread the bun bases with a little of the red pepper houmous. Cover with the lamb’s lettuce and red cabbage.

September 2022 127 Street food Chocolate brioche doughnuts with bay caramel custard and nib sugar PREPARATION TIME 1 hour 10 minutes COOKING TIME 10 minutes SERVES 12 For the chocolate brioche ł 220g strong white bread flour ł 30g cocoa powder ł 30g caster sugar ł 7g fast-action dried yeast ł ¼ tsp fine sea salt ł 3 large eggs, lightly beaten ł 125g unsalted butter, softened a little, small pieces ł flavourless vegetable oil ł 1.5 litres vegetable oil, such as sunflower or rapeseed for deep-frying For the bay caramel ł 3 medium dried bay leaves ł 70g caster sugar ł 2 tbsp water ł 50ml double cream ł 35g unsalted butter, chopped ł generous pinch of sea salt For the custard ł 80ml whole milk ł 45ml double cream ł 2 egg yolks, lightly beaten ł 25g caster sugar ł 15g cornflour For the nib sugar ł 10g cacao nibs ł 65g caster sugar ł 1 heaped tsp ground cinnamon ł pinch of fine sea salt 1METHOD

Simmer until the mixture turns a deep amber colour. Remove from the heat and stir in the cream and then stir in the butter and salt. Set aside.

6 To make the bay caramel custard; place the bay leaves and a few spoonfuls of the sugar in a spice or coffee grinder and blitz to a powder. Mix with the rest of the sugar. Place the sugar and water in a small pan, stir to combine and set over a medium heat. Bring to a simmer, swirling the pan now and then (don’t stir) until the sugar has dissolved.

Transfer to the baking sheet and repeat leaving a 3cm space between each ball. Cover with oiled cling film and set aside for about 1 hour, or until increased in size by 50 per cent.

10 Remove with a slotted spoon to a wire rack. While they are warm, cut a slit in the side and pipe in a generous amount of the caramel custard, then roll in the nib sugar. Best served warm! The by Sue (Quadrille,Quinn YukiPhotography:£10)Sugiura

To make brioche, place flour, cocoa, sugar, yeast and salt in a stand mixer and stir to combine. Add the eggs. Using the dough hook attachment, mix on low speed for 5 minutes, stopping to scrape down the bowl, until all the flour is incorporated. Increase the speed to medium and mix for 10 minutes.

Recipes watercress.co.ukdipyogurtdillwithfrittersonionspringandcourgetteWatercress,gardengourmet.co.uk;burgerloadedFully

8 To make nib sugar, finely grind cacao nibs to a powder. Combine with the sugar, cinnamon and salt and place in a shallow bowl. 9 To fry, place enough oil in a large heavy pan to come 5cm up the sides and heat to 170–180°C.

Gently flatten on your work surface, bring the edges together into the middle. Turn the dough over so that the join is at the bottom. Cup your hand over the dough and, using firm pressure, roll on the work surface to make a smooth tight ball.

3 Tip the dough out onto a work surface and press out to form a rectangle about 1cm thick. Fold one-third of the dough over onto itself, then do the same with the other side. Repeat with the top and the bottom. Place the dough, seam-side down, in a large oiled bowl, cover with oiled cling film and set aside somewhere warm until doubled in size.

CookbookChocolateLittle

2 Reduce the speed to low and add the butter slowly. When the butter is all used up, increase the speed to medium and mix for a further 10 minutes, or until the dough is shiny and elastic.

4 Line a large baking sheet with baking paper. When the dough has risen, press your hand into it to release some air and break into 12 pieces.

7 For the custard, place the milk and cream in a small pan. Bring almost to the boil, then remove from the heat. In a bowl, stir egg yolks, sugar, cornflour and just enough of the hot milk mixture together to make a loose paste. Gradually stir in the rest of the milk, then transfer back into the pan. Cook over a gentle heat, stirring constantly, until thickened. Don’t let it boil. Remove from the heat and stir in the caramel, then return the pan to a gentle heat, stirring, until thick. Don’t let the mixture get too hot or it will separate; use a balloon whisk if needed. Transfer to a disposable piping bag, fasten and leave to cool completely.

Have a wire rack lined with paper towels ready. Lower 2 or 3 doughnuts at a time into the hot oil. Fry for about 1 minute on each side until puffed up and golden. Adjust the temperature as needed to ensure the oil doesn’t get too hot or cool.

5

128 yourhomestyle.uk Where to buy everything featured in this magazine SHOPPING GUIDE A Abstract House abstracthouse.com AEG aeg.co.uk Aldi aldi.co.uk Al Murad al-murad.co.uk Amazon amazon.co.uk And So To Shop andsotoshop.com Annabel James annabeljames.co.uk Annie Sloan anniesloan.com Anthropologie anthropologie.com AO.com ao.com A Place For Everything aplaceforeverything.co.uk Argos argos.co.uk ASOS asos.com B Back in Action backinaction.co.uk B&M bmstores.co.uk B&Q diy.com Beaumonde beaumonde.co.uk Benisouk benisouk.co.uk Benuta benuta.co.uk Best4Flooring best4flooring.co.uk Blinds By Post blindsbypost.co.uk Block Design blockdesign.co.uk Brass Bee brassbee.co.uk Brita brita.co.uk Britannia Rose britanniarose.com Burlington Bathrooms burlingtonbathrooms.com C Caesarstone caesarstone.co.uk Camaro polyfloor.com Carpetright carpetright.co.uk Cath Kidston cathkidston.com Claybrook claybrookstudio.co.uk COAT Paints coatpaints.com Contigo gocontigo.com Coopers of Stortford coopersofstortford.co.uk Cotton Clara cottonclara.com Crown Imperial crown-imperial.co.uk Crown Paints crownpaints.co.uk CTD Tiles ctdtiles.co.uk Cuckooland cuckooland.com Cult Furniture cultfurniture.com D där lighting darlighting.co.uk David Austin davidaustinroses.co.uk Debenhams.com debenhams.com Décor Supplies decorsupplies.co.uk deVOL Kitchens devolkitchens.co.uk DFS dfs.co.uk DIY Kitchens diy-kitchens.com DorcasCreates dorcascreates.com Drayton draytoncontrols.co.uk Dreams dreams.co.uk Dualit dualit.com Dulux dulux.co.uk Dunelm dunelm.com Dwell dwell.co.uk E East End Press eastendpress.com eBay ebay.com elho elho.com Emma Bridgewater emmabridgewater.co.uk Etsy etsy.com F Facebook Marketplace facebook.com Farrow & Ball farrow-ball.com Fenwick fenwick.co.uk Fig1 fig1.co.uk Flying Tiger Copenhagen flyingtiger.com Freemans freemans.com Furniture and Choice furniturechoice.co.uk Furniture Village furniturevillage.co.uk Fy! iamfy.co G George Home direct.asda.com Graham & Brown grahambrown.com H Habitat habitat.co.uk H&M Home 2hm.com Hillarys hillarys.co.uk Homebase homebase.co.uk Homescapes homescapesonline.com Homesense homesense.com houseof.com houseof.com House of Botanica houseofbotanica.com Hudson Reed hudsonreed.co.uk I Iconic Lights iconiclights.co.uk IKEA ikea.com ILIV i-liv.co.uk I Love Wallpaper ilovewallpaper.co.uk J Jacqueline Colley uk/shopJacquelineColleyetsy.com/ Jane Clayton janeclayton.co.uk Joe Browns joebrowns.co.uk John Lewis & Partners johnlewis.com JOY joythestore.com Junique juniqe.co.uk K Katie Alice katie-alice.co.uk Kave Home kavehome.com Keep + Kind keepandkind.com Kilner kilnerjar.co.uk L Lakeland lakeland.co.uk Lampsy lampsy.com 9 74

Stockists La Redoute laredoute.co.uk LIEWOOD liewood.com linenbundle linenbundle.com Lisa Angel lisaangel.co.uk Litecraft litecraft.co.uk Little Greene littlegreene.com Live In The Light liveinthelight.co.uk Lola Design Ltd loladesignltd.com Lust Home lusthome.com M Madder Cutch & Co maddercutchandco.com MADE made.com M&Co mandco.com M&S marksandspencer.com Mano Mano manomano.co.uk Matalan matalan.co.uk Mols & Mae molsandmae.co.uk Morleys morleyschicken.com Mosaic del Sur cement-tiles.com My Furniture my-furniture.com N Naomi Wilkinson shop/NaomiWilkinsonetsy.com/uk/ Nest nest.co.uk Next Home next.co.uk nkuku nkuku.com O Obaby obaby.co.uk Ocean Saver ocean-saver.com Oliver Bonas oliverbonas.com Omlet omlet.co.uk Oklahoma okla.co.uk P Perrin & Rowe just-perrin.co.uk Pinfold Creations shop/PinfoldCreationsetsy.com/uk/ Porcelain Superstore porcelainsuperstore.co.uk Pooky pooky.com Posterlounge posterlounge.co.uk Poundland poundland.co.uk Primark primark.com Protek protekwoodstain.co.uk Purlfrost purlfrost.com Q Quick Step quick-step.co.uk R Red Candy redcandy.co.uk Rhoom rhoom.com Rifle Paper Co riflepaperco.com Robert Dyas robertdyas.co.uk Rockett St George rockettstgeorge.co.uk Ruggable ruggable.co.uk S Sainsbury’s Home sainsburys.co.uk Sass & Belle sassandbelle.co.uk Scion Living scionliving.com Seep theseepcompany.com Sharps sharps.co.uk SKLUM sklum.com Smeg smeguk.com Snoopers Paradise snoopersparadise.co.uk Snug snugsofa.com Sofology sofology.co.uk softstore.co softstore.co Strawberry Fields Fabrics strawberryfieldsfabrics.co.uk Sunday’s Daughter sundaysdaughter.com Swan shop.swan-brand.co.uk Swoon Editions swooneditions.com T Tapi tapi.co.uk Tefal tefal.co.uk Telegramme telegramme.co.uk The Dormy House thedormyhouse.com The Furniture Market thefurnituremarket.co.uk The Radiator Company theradiatorcompany.co.uk The Range therange.co.uk Thorndown Paints thorndown.co.uk TKMaxx tkmaxx.com Tile Mountain tilemountain.co.uk Tilly and Sage tillyandsage.co.uk Topps Tiles toppstiles.co.uk Tower towerhousewares.co.uk Trouva trouva.com Typhoon Housewares typhoonhousewares.com V Valspar valsparpaint.co.uk Velux velux.co.uk Very very.co.uk Victorian Plumbing victorianplumbing.co.uk Vinyl Flooring UK vinylflooringuk.co.uk Von Haus vonhaus.com W Wallpaper Direct wallpaperdirect.com Wallpapershop.co.uk wallpapershop.co.uk Walls & Floors wallsandfloors.co.uk Wayfair wayfair.co.uk Wickes wickes.co.uk Wilko wilko.com Wilton London wiltonlondon.co.uk World of Wallpaper worldofwallpaper.com Y YesColours yescolours.com Your Stylish Home yourstylishhome.co.uk 104 98 84 16

A picture of pink bougainvillea against a yellow background. I painted it on a trip to the Bahamas, so it reminds me of calm, sunny times and a feeling that anything is possible.

Home is... My sanctuary. Any home styling secrets to share? Don’t over clutter and go slow. It’s so exciting when you start with somewhere new, but it’s useful to live in the space for a bit first; see where the light is, where you spend most of your time and how you use a space. You’ve had a lot of exciting partnerships. Which one has been your favourite? Our latest spotcushions;I’mnewturtleswillBluecollaborationconservationwiththecharity,MarineFoundation.WeberelocatingbabyseathroughsalesofourIslandParadisecollection.obsessedwiththeturtleIcan’twaittofindafortheminourhome!

What’s a typical working day?

Feature BurnsCatriona

130 yourhomestyle.uk IN CONVERSATION WITH ScarlettElizabethPetrides

At around 6.30am, I wake up with my little girl, Meiri. I head to the office at 9am to check emails before catching up with the product team on how any new designs are developing and to review campaigns – right now, it’s Christmas. At 1pm, I stop for lunch and take our dog, Lamu, for a walk. The rest of the afternoon is spent replying to emails, moodboarding and painting. In the evening, once Meiri is in bed, my husband, Alex, and I will have dinner and catch up on a TV series. How did you get into homeware design? I completed an art foundation course at Central Saint Martins before going on to design homeware and prints for retailers, including Debenhams and John Lewis & Partners. In 2015, I founded Elizabeth Scarlett, translating my paintings onto fabrics. I learned about the sales side of things at each stage of the journey, refining my style along the way. What inspires you? Nature and wildlife – I’m always looking for simple beauty in the everyday. I also love to travel and I’m never without my sketchbook. When I’m relaxed and life is a little quieter, I find it’s the best time to see the magic! What would you save in a house fire?

How do you want your designs to make people feel? I want to bring joyfulness, colour and detail into our customers’ homes. Hopefully, people feel like they’ve discovered something that’s a bit of them!

What’s your proudest career moment? Seeing our products on This Morning with Holly Willoughby. I couldn’t believe that the business had come so far! What’s next? We’ve got some stunning pyjamas coming; I can’t wait to grab a pair for myself. Shop Elizabeth Scarlett at @elizabethscarlett.elizabethscarlett.com;

Founder of her own homeware brand, Elizabeth Scarlett Petrides joins us for a chat

Inspired by nature, Elizabeth’s hand-drawn designs are embroidered onto beautiful fabrics

Elizabeth has used her artistic talent to create a luxury brand Turtle conservation cushion, £50, Elizabeth Scarlett Tiger cushion, £50, ElizabethScarlett Elizabeth says she set up her own brand to ‘bring more joy into the world’ Elephant conservation collec tion everyday pouch, £28, Elizabeth Scarlett

BEST SELLER! GREAT VALUE! TOP QUALITY! HOMESTYLE READERS DISCOUNT CODE FOR 50% OFF GARDEN FURNITURE! FREE, FAST DELIVERY WITHIN 3 WORKING DAYS

This sleek modular looking lounge can be arranged in several different ways. Consisting of one left hand and one right hand sofa, two ottomans and a compact coffee table, a simple rearrangement of the pieces enables you to turn it into 2 chaise longues, 2 day beds or keep all 4 pieces separate for a more sociable outdoor lounge space. Also available in Grey and includes a 12 month warranty. Normally £1199 Now £599.50* when you quote your 50% off plus FREE Fast Delivery code HSAUG22 at checkout.

LAST!STOCKSWHILE SCAN OR VISIT OUTANDOUT.COM TO VIEW OUR FULL RANGE. GET 50% OFF PLUS FREE DELIVERY ON ALL PRODUCTS WHEN YOU ENTER CODE HSAUG22 AT CHECKOUT. *While stocks last. Prices correct at time of going to press.

This sleek contemporary lounge set is perfect for a lazy evening in the garden. It can seat up to 5 comfortably and comes with a square coffee table in shades of a sophisticated graphite. This set is virtually maintenance-free and comes with thick foam cushions which have easily removable covers for washing to maintain that pristine look. This set comes with a 1 year constructional warranty. Normally £1199 Now £599.50* when you quote your 50% off plus FREE Fast Delivery code HSAUG22 at checkout.

Palma - Corner Rattan Garden Lounge Set

This stylish lounge set, which seats up to 9, is the perfect setting for alfresco dining. Constructed using durable polyrattan, making it practical and hardwearing. Consisting of a deluxe 7 seater sofa, square stool, rectangular stool and a generously sized coffee table with a glass table top. The luxurious thick cushions come in a chic Grey and have removable covers for washing. Normally £1399 Now £699.50* when you quote your 50% off plus FREE Fast Delivery code HSAUG22 at checkout.

Santorini - Lounge Set with Side Cushions

HavanaLoungeCornerSet

Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.