''
' SURIIII/ING r PART l: THE SIARS 0FABUSE
" :1: .; -. .' : ,' :
,''''-.
: .i, SEE 3 SeuingtlrcAilruxin Canps sirrc 1979
y'/metonline.mscd.edu . Vol.ZJ No.10
Women's winning streak continues as regular-seasonnears end.
k- fallirs forAuraria A lone sfudent wolksomong 6e ' golden redsond mutedyellows on Oct. 21. The temperob doys ond friendlyhighs hove mode Foll eosyon Aurorio students.Despite on eorly snow, highshove consistently been in the 60s ond 70s. Similor weotherpotterns ore expecledto lost through October.
ts
Photo by \!illiam Nloore. moonvill@mscd.edu
refurns lofte Student sfreels ofPolesfine
ploylist will Holloween your spooked leove eors
OCTOBI'R 27.2$5 . THE METROPOLITAN
PA(IF,? r NF,\tr,i S
SURIIIIIAL TIP GOLLEGE
THEBENEFITS OF TEXTBOOKS. USED THECOATTAILS THEWISDOM OFRIDING WHO'VE COMEBEFORE. OFTHOSE
Allow us to make a casefor used textbooks.They offer you the highlighted and undedined wisdom (assumingthey actually passedthe class)of those who've come before. From pithy insights to racy-doodles,it's a little added value for your education dollar. Here s another usefirl dp to help you savea little in school:FreeChechingfrcm \Tashington Murual. Theret no minimum balancerequired to avoid a monthly servicechargeand it's free to sign up for a Visa'Check Card. Plus there'sfree online bill pay availableat wamu.com. Along with the books of a Deant-L,ister,FreeChechingfrom'W'ashingtonMutual is all you really need to skim through school in scyle.For more information, visit your local \(ashington Mutual FinancialCenter or call 1-800-788-7000.
16th StreetMall FinancialCenter- 1600 California St., Denver,CO 80202 (303) 534-6948 DepositsareFDIC lnsured
wamu.G0m
"
NEWS r PAGE3
THE METROPOLITAN. OCTOBF.R27.2005
MtrTRO&MORE
CfawonWoullard o News Editor o cwoullar@rnscd.edu.303.556.3423
Survivirg t/te ScarsofAbuse - Part one of a t/tree-pa,rtseries
Abusersdisguised oslovers By Birgit Nloran moranb@mscd.edu Passion and conhol can make for lethal bedfellows. "Dating was just like a honeymoon pe riod; then all of sudder5 I had to put on the brakes," said Tina, 37. These days, Tina" with a thick, glrarly scar nrnning down her neck, singsin a band, holds a good job and speaks out about domestic violence. "I talked it out with a counselor and I had to listen to mpelf." She peirticipated in three bad relationships before she changed. But she made iL "I dorit have the tolerance for anyone Iike that now," she said. "I am an African Arnerican female with possibilities and po tential," she said. She has two sons, a management positio& her own place and says she's ffnally enjoying her life. One of her abusers started out as Mr. Wonderfirl, but became increasingly conaoling, asking questions like, 'Where you goin'?" or, "How long will it take you?" which seemed irmocent enough. "Bul then he'd challenge me when I was a litde late," Tina said. "From there itjust got worse and worse." Tina described how "natural" it was to be abused in aII ways becauseofher lifelong exposure to it She wibressed her mother's abuse by boyfiiends. And some of those boyfriends sexually abused Tina from about the age of ffve. "Noq I think about what that was like and it makes me really sick," she sai4 "It's like geting off an intense roller coaster.' More than physical According to cormselors, too many young people have no idea their relation-
le (ontrolling ondviolenl behovior: o Disallorving or discouraging rime with friends 6r familr: o Frequent phone cails or pages . Jealous-vand possessireness o Threats to lrurt themselves or someone else. r Criticism and belittlement. o Breaking things or damaging surroundings. o Cruelt!: to children or animals. r I . nr aar r t edt ouching or kissing. r Disallowing birth control. . Shoving. punclring. slapping. pinching. kicking. hair - pulI ing or strangllng rrrl
n
ll
I
wneleuflmsconilnonetp:
Photos by r&'illiam Moore/moonvill@mscd.edu. Illustration bv lUatthewJonastjonasm@rnscd-edu
ship is heading down the pa.drof abuse.The fubrre victim is often the recioient of admiration, charm and attention anid may feel flattered. "Intimaie partter violence is so much more than just physical," said lGistina Matkins. director of communitv relations and education for SafeHouseDenver, "It can be emotional, ffnancial, verbal and psychological." Intimafe partrer violence sometimes start in high school. According to the National Center for Victims of Crime, young women, ages 16 to 2+, have the highest rales of intimale parbrer violence. And, statistically, many will remain in abusive relafionships. Mosdy becausethey're just not awaxe that wha.dshappening isn't healdry. Matkins regularly speals at high schools
and colleges about domestic violence. Ai ter each classroom session,several strdens contact her about abuse in their lives. Occasionally, she'll hear from a young man who's surprised.to hear that what he'd been doing was aousrve. "People don't get inio this by choice," Matkins said, "If sornedring doesn't feel comfortable about a relationship, contact a counselor or a hotline." About one in three college shrdenb are, or have beeq a.ffectedby intimale pafiner violmce, and more than half of college males admit to having sexually assaulted someone, according to the NCVC. But the ffgure is low because over half of abusive relationships aren't reported.
SeeABUSE on 7
r Nletro Counseling Center:
) 556-3132 1303 . WCFOCcrisisline: 688-8484 1303) r SafeHouse Denver:
(303)318-9989 i FamilyThee:Wbmen in Crisis: 303\ 420.6752 o National Domestic liolence
Hot-
llne:1-800-799-7233 oVOA Brandon Center:
(303)620-91m
o Gatewav Battered Wbmen's Shel-
ter:(303)343-1851
lf youoretheobuser: Seek counseline. . Call (fAbusive \{en SeekANIEND n L]r1t\ u (,\lDu CaIIANIEND ua-tl ing New-Directions):
(303) 832-6363
leoder deod ot3l Studenl tovoleonbylows SGA By.Nlatt Quane mqinne@mscd.edu The Mebo Student Govemment Assembly decided to vote on ib poliry manual on Oct 26, conb:ary to its earlier plans to wait until the senate is fflled by the qpecial election taking place this week. "The senate felt that would be the best course of action," said SGA Speaker of the SenateJesseSamor4 . Waiting for a fully-elected senate, as oI> posed to the partially-appointed senate currendy making decisiors, would have given a large task to the new senaton. "We have already spent time and effort on these, and if we don't sign off on them, we are abdicating our duties !o the incoming senate,"said Kurt White, an appointed smator who is also running to be elected for his position in the special election. The idea of the tumaround carne as a rerult of senators secondguessing their own decisions.
In the OcL 20 issue of The Metropolilaz, a story on the front page was printed, in which SGA Speaker of the SenateJes se Samora was left unidentfied. The de cision to leave Samora zuronyrnoui was due to confirsion as !o whether naming him as a writFin candidatâ‚Ź would dis qualif hirn fiom the election. As zuc[ the election rules state hx TheMetr$oln laa would not have been in the wrong by publishing Samora's name. "The reasoning (for the original decision) was that a lot of the senatorswere appointed and that it should be elected senalors who passthe bylaws," White said. But the SGA's decision to speed up the passing of the bylaws came as a defense of the senate'sown validity, "If we start making (the original) ratjG nale, we could underrnine all our other deci sions," White said.
SeeSCA on 5
B1' Clalton \Moullard c+voullar@mscd. edu
Former Metro shrdent bustee and campus leader Stephen Hay died this weekend. He was found dead in his Thornton home early Saturday moming, according to Student Govemment Assemblv interim hesident Dennis Bergquist Hay was 31. Hay served as student trustee on Metro's Board of Tnrstees during the last academic year. In September, Hay joined Meko's Alumni Association Board of Directors. He also founded the Meho Student Leadenhip Foundation, an organiation formed earlier this vear. whose intention is to be involved in fund-mising, scholarships and financial support for Meho students. He was also a leader in sb.rdentorgarrizations like CASS (Connecting Alunni, Students and Spirit) and Meto's Earth Sciences Club, of which he was vice presidenL Hay graduated in May witr a bachelols degree in environmental science. During his senior year, Hay worked as
an intem for the Na[ona] Conference of State Legislanres focused on environmental policy. Hay was also servlng as a board member of the Colorado Student kadenhip Formdation and a member of Stephen lloy the University Park Elernentary ParentTeacher Association. Hay was the hlher of two song Taylor, 4 and Stevie. 7. Public rnernorial services for Stephen Hay will be held at I p.rn., OcL 28 at St. Cajetan's Center on carnPrts Red The Metopolitan next zoeek to lear frotn fatnily, friands atd. on thzir mcmories otd
PAGE 4 . NEWS
OCTOBER 27.2005r TIIIi MF.'|.BO
. _: ===. = ..... .
Brancl, Out 2otV,"ou /o* l/*ot^" //ol/t Your Big Dqy is on
November17th!
WHYAREYOU WAITING?
Tosupportyou on yourQUITdatean E d u c a t i o nE a lv e nw t i l l b e h e l di n t h e MulticulturL ao l unse
At DenverSchoolof Nursingwe olhr the highestquolity StoteBoordof Nursing ond ColorodoCommission ApprovedNursingProgroms with on HigherEducoiion littleor no woit. We ofbr:
rAssociotes DegreeRN oLPNto RNAssociotes Degree oUpperDivisionBSN/RN
(303) 2e2-0015 www. d enYer sch o o Iof n u r si ng. o r g Locoledone block from Coors Fieldot l40l l9th StreetDenver.CO 80202
Seed to help prepare for change WeekFourtowarda 40 DayCountdown to YourQuit Date l9
tUaXe a longlist of thingsyou cando insteadot smoking.Keepit nearyouaJter yourqui t date.
l8
patternof behavior Becominga non'smoker involves changinga well.established yourselfto makenew that hasbeenintegratedinto yourlifestyle.Encourage heal thyhabi ts.
l7
PracticeactivebehaviorsMakean activityplanthat will workintoyourschedule beforethe qui tdat e
l6
focu. on the present.Makeyourchoicesoneurgeat a time. Prettysoonyouwill fi ndthat i t hasb eensever al hour ssinceyou'veevent houghtaboutsm oking.
l5
nepeatthe sequence: Ur ge. . . st op. . . consider . . . choose. Then , . act don't . . . t hinkabout helpsyou developa dil{erent smokinguntilyoufeelthe nexturge. Thisexercise re sponse andconsci ous t o t he desir et o sm oke,Dot hisever yt im eso t hisbecom es a habi t
l4
Payattentionto yourthoughtsaboutyourselfand yourchangesof succeeding in quitting.Noticeweathertheyare mostlynegativeor mostlypositive.Whenyou havea negative thought,practicecomingup with a newand morepositivewayto seethe si tuati o n.
13 Orint S cupsof wateror herbaltea everyday.Keepit up whenyou becomea formersmoker.Thishelpsflushthe nicotineout of yoursystem.
Visit wwwmscd,edu/student/resouces/health/advocates Interactivesmokins cessationresourcessoongoredby the Auraria Health Advocates
'
P.M. srso-z:so
r CHTTDREN AGESo-12 (NAUST BECHAPERONED) STAYWARAITON HruIOWEEN AND ENIOYT.OTS
OF FREECANDY!
RICKORTREAT ATTHE REGE
l
NEWS . PAGE5
THE METROPOLITANr OCTOBER27.2005
Africun culture celebruted Memberof Lion Soullohs,Koihryn Honis,ploysin St.
By Liz Carrasco carrascl@mscd.edu Moroccan dishesspiced with cardamom, potato salad and com. bread, live Reggae music and story telling were just a sample of the richness in the African-American Sfirdies Departrnent Celebralion this past Monday. All students were invited to come, celebrale and be part of an arnazing $ouping of speakers,entertainrnent and food that hint at the world of not only African-Americans, but Africa as well. Dr. Ronald SteDhens,chair and professor of A.frican American Studles, explained that one of the departrnent's future goa.lswas in the proposed changing of the name to African and Afiican-American Surdiesprogram. The inclusion of "African" is in honor and recognition of not only the more than 20,000 African immigrants in Colorado alone, but also the rich heritage that is the center of the spirit of African-American studies. Metro's departnent is onlv one of two in Colorado d rt"ay the blacft expedence, according to Stephens. 'Ib name would apdy reflect its responsibility for the broader community ... it will broaden our appeal to people with interests in not onlv Africa but African-American Surdies as well.' Dr. Lucas Shamala, assistant associate professor, Martin Luther King Scholar and coordinator of the day's festivifies,paid homage to Dr. Stephens' leadership by presenting him with a small wooden cawed sword that was also a pen. The sword and pen are symbolic of the strugles that have been fought in the pasl not only in this cor:nby, but in Africa as well. "We are blessedhere at Metro," Shamala said. "We have a wonderfirl leader. hadership is about service,about moving people
SeeA4.S on 9
METRO MINT]TE,S gront Metro oworded STEPS
Under the direction of Rosemarie DePoy Walker, assistantprofessor of chemisbv. Mebo has been awarded its third Strides on MondoyOct. Toward Encouraging hofessions in Science )A r^^,^ ^^^ grant. The threeyear grant from the National bond performed lnstiurtes of Health nrovides $599.306 for os o portof the Metro, in cooperadon with CCD and the I OthAnnuol Community College of Aurora, to increase Africon-Americo n the number of minority shldents pusuing StudiesDeportment caxeers in biomedical research and to incelebrotion. creasetheir successin the program. The newly awarded STEPS program will be implemented from December 2005 to November 20ffi. The shrdents involved in the program will have a chance to gain hands-on experience in the technioues of biotechnology. Also, program partilpants will have accessto training, seminars, and shrdent and faculty urton throughout their college careers. C ni at n n ' c
Contor
gront touptheonte Ieoching As oart of Meho's $9.5 million U.S. Departnent of Education Teacher Qpality Enhancement gran! 30 teacher educafion studentsare currendy completing their early ffeld experiences in participating Denver Public Schools. The granl which involves Meho's Teacher Educalion departnenl the School Photo by Emily \hrisco o varisco@nrscd.edu of Irtten, Arts, and Siiences, and DPS, is designed to create a new model of support for secondary teacher education shrdenb and new hires from the College's secondary "We are blessedlrcre at Metro.We have a fionderful leader teacher education pool. Leadership is about sereice,about moeingpeople to another Ultimately, the goal is to heh improve retention in urban schools, thereby teacher lertel." boosting sh.rdentachievemenL
- LUCAS SHAMALA
tostudents Flu shots ovoiloble
professor Metro sounds off0nCundD Support for Referendum D is running even with opposition, the poll showed. "Proponenb of Referendums C and D Of the 625 ranneed to-throw harder blows at the opposi domly selected regtion to gain grormd in dre political bafile that istered voters polled, wil culminate when voters go to the polls 44 percent said they Nov. 1," said Meto politcal scienceprofes- would vole in favor of sor Nomran kovizer. the referendum and hovizer said that the zupporters of the 45 percent said they l.|ormon Provizer referendums need to react more harshly to would vote no. advertisementsrun by the opposition. The poll was conducted Oct. 11 to OcL "They need to have harder-hitting ad- 13 and had a margin of error of plus or mivedisemenb," kovizer said. "When you are nus four percentage poinb. involved with this kind of campaign, with ff passed, Referendum C would elimithe stakes as high as they are, you have to nate for ffve years the spending limib on respond in kind." state government imposed by the TaxpayOne of the more recent television ad er's Bill of Rights. vertisemenb supporting the measuresshows This would allow the legislatue to Denver Mayor John Hickenlooper jumping spend $3.7 billion that would n'omrally be out of a plane touting the beneffts the refer- refirnded to taxpayeni. That money would endums would bring to Colorado. be earmarked for education, health care and A television advertisement paid for by bansportauon. the Independence Institute, a freemarket Referendum D would allow the state to think hnk in Colorado opposed to the ref- borrow $2.1 billion agairst the money from erendums, shows an actor portaying a poli- Referendum C, which would be used for uriician snatching an envelope marked "hx gent road and school construction. refimd" out of the hands of a citizen and Provizer, a suppoder of both referenher family. dums. said the ooll numbers are less than A recent poll conducted for The Denoer ideal for those ieeking a yes vote on the Past showed that zuppon for Referendum C meiBures, holds a narrow lead of 3 percent over the The opposidon has had successin the opposition. campaigrr by playing to the public's fear, he
B,vBrad Riggin rigginb@mscd.edu
"What they'oedone right is playing one of the oldest games .
,.
-
, .
,
-
?
rn polrncs, wnrcn 6Jear
n
The Health Center at Auraria will be providing $15 flu shots on a ffrst-come.ffrstserved basis to hculty, staff and shrdenb. The shob will be ofrered from ll a-m. to 6 p.m. on Oct 26 in the Tlvoli Tavem and 8 am. 0o I p.m. on Oct 27 in the Plaza Building, Room 150 Corridor. Depending on vaccine availability, shots will also be available in the Plaza Building, from I a.m. to I:30 p.m. on Nov.2 and ll *m. to7 p.m. on Nov.'3. Payment is by eash or check- For the latest information regarding Flu Shot Clinics, go to www.mscd.edr4&nrdentTtesources/ healtb/.
- ].|ORMAN PR()VIZER
saro. "What they've done right is playing one of the oldest garnes in politics, which is fear," kovizer said. "Widr the opposition, they try to make you think you're going to be mugged by a group of politicians in some wavward 'The allev." proponents of the referendums are playing the fear card as well, but it is a fear based in fact, he said. "To be fair, the opposition would say the other side is playing on fear as well. However. one fear is based in realitv and the other one is dressed in a Halloween costume," hovizer said. He said thag in these kinds of elections, voter turnout is critical and mobilizing vobrs will be essentialftir both sides. The abllity of community organizations supporting the referendums to get voters to the polls will be key to the passageof the measures.Provizer said. "They have the support of hundreds of organizatioDs in the community," he said. "Thev need to hrrn out the vote."
SGA
Continued From 3
Due to tbe difrcult task of reviewing the manual, which is over 100 pages long, the senaton have divided the sections among themselves-giving groups of senalon either the general, execudve or legislative section. The SGA has also decided to olace a gGday grace period on $s arnen.llng of the document, which would allow the newlyelected senate to amend the policy manual by a twothAds vote as it seesfit "Ids pretty much the standard amending process," White said. "We'll just have 90 darzsto do iL"
OCTOBFIR 27.2005. THE \IETROPOI,ITAN
PAGII6 o NEWS
\LI,I{il
I :m
il
I
I
I,
I
(
ll[rlII il c il I
N
7
(oordinator Posse 4Event nstudent Squad 0rganization &leadetship O (ustomerseruiceUnit Team Management &Business 4t Marketing \ GraphicDesignGang 'B Information Technology Bunch l/ I il
r a?, a I
l,lI Pr t
ru.1
(q
Ir .G I II ifi I I l iilt{i rvllt ]ifTETEfI, 'I*ffif,}. ,Ir rllr I lt rIr iltr \r{r fI. I
I
a !
a
r
T
I
,a
rl
if. lr
a,
-
NEWS . PAGE7
THE METROPOLITAN. OCTOBER27.2005
A nightto muke o stond By Heather Embrey h.embre.t@mscd.edu More than 30 men and women marched Sahuday night from the Civic Center Station in Denver to the Auraria Campus, marking the annual Take Back the Night celebration. The movement began in Europe in the late '70s protesting assault and rape during the nighf It was brought to Arnerica" and groups from all over the nation have collab orated and brought the march to their cifes. This year, Denver celebrated the liberation of taking back the night in October. "We wanted to pick a night were we could all come together and have a good hrmoul" said Sara Miller. oresident of 'Breakir:g the lnvisible Chain. "This was a grear night and it was trll of enerry." Supporters of the event rallied on campus at 8:00 p.m. and cheered and shouted Photo bv Jonah Ileideman . heidemai@mscd.edu chanb to make their voices heard through the darkness. kd by the Radical CheerociivistgroupSporkleMotionporticipotein o leaders, the group entered campus and was Membersof the FortCollins-bosed greeted by a banner held up by male shr- condlelight vigilduringtheIoke Bockthe Night rollyot theflogpoleon Oct. 22. The dents, brothers, fathen and friends, who had rollyfocusedon women'srightsond feoturedbooths,speokers ond music. their hand prints painted on it The banner *These read, hands dont hurt women," NARAL hoChoice of Colorado was women taking back the nighl They help "We enjoyed this march very rnuch and represented with the help of Gwendolyn women and men who are victims with adwere glad to come down to Denver,' said the Bety, who handed out pamphlets and bro- vice and counseling. Radical Cheerleaders fiom the Fort Collins chures educating people on what their org'aEmily Steed sat behind the Colorado chapter. They came down to support their nization does in the goverfinent to allow saf- AIDS Project table and discussed ways to "sisten" and be reminded of the rally they er eovironmenb for women. They campaign promote a safe and healthy life through held last April. As they marched onto the for the safety of women from both phlnical AIDS prevention. Her organization prG Auraria Campus, the Cheerleaders led the and mental violence, especially rape victims. motes HIV prevention by allowing conffgroup in a chant of "Who's got the power? One of dreir bigest campaigns has been to dential and anonFnous testing for AIDS We've got the power! What kind of power? make emergency contraception available for and HIV. They support the Take Back the Lady power!" victims of rape and assaull Night campaign by helping to take the fear Many organizations at the rally handed RAAP, the Rape Assistanceand Aware out of being outside at nighL out information about victim advoca.cy. ness hogram, promoted their support of
oAbuserscontrolvictimswith fear ABUSE and embarrassed to hlk about it with her Linda Pettit, executive director of Abufriends. sive Men Exploring New Directions, said "The abuser will make the victim feel As time and the relationship went on she batterers are everywhere. wone in ways that aren't obvious,' said Kar- kept justiling his behavior because nOh, "They're successfrrl politicians, church enJackson, a psychologist and domestic via he's just being a guy," Brooke wrote. After 5 deacons, altomeys and more," Pettit said. lence expert at Metro's Counseling Center. months of dating, their relationship became "These men deny that they're doing any"And it can be very subde," she said. more serious, "and things went drastically thing wrong." "Anyone could become a victim of do- downhill fiom there," she wrote. Batterers, who are mosdy men, tend to mestic violence," Jaclaon said. Then, the verbal abuse built up !o physi- start a relationship with a speed and intensity Often after a bad episode, batteren be- cal abuse-he hit her. that their pa.rbren might consider flattering, come loving and apologetic. That's just a "He immediately apologized and told Pettit said. part of the cycle. Statistics overwhelmingly me he just lost his tempeq" she wrote. But "These men lie better than people tell show that the pafrem becomes more volatile he blamed her for making him angry. the butb"" she said. as time goes on. The victim's self<onffdence Georgia, 42, has her own business,loves "I made sure to be carefirl of what I said erodes and her world gets smaller and small- around him." shewrote. the Gratefi:l Dead and ffnds henelf lookine er over time, Markins andJackson said. After she became pregnant she thought for clues that anyone she meets has beei Intimate pa-rtner violence happens in re- there was an opportunif for change. abused. When she notices someone with lationships from all socioeconomic, cr,rlb.rral, "Maybe now that we were going to be heavy make-up or sitring timidll she ap religious, ethnic and sexual orientations. parents, he would make a complete 180with proaches her and asksif she can help. how he handled his temper," she wrote. She She'd like !o help younger women see Finding a way out wanted to have a perfect family. the tight before they end up in the same Brooke, 20, said her friendships suffered But that wasn't the case. She said know- place shewas. becauseof her boy-friend'sdemands for time ing her son was seeing and hearing things Georgia said she'd ask women in these together. no child should have to, she reachedout for relationships, "How did you feel about your"I just ffgured this was what I was sup help and called her mother. self when this (abuse)happened?" posed to do now that I had a boyfriend," she Then she'd ask, "What a.reyou going to "Something in my mind ffnally lit up," wrote in a letter for the SafeHouse Denver she wrote. .\4hal I was trying to provide do to chanse that?" newsletter. for our son was hur6rl, not helpfirl." She Georgii wants to wam others to get out "I thought his words lyere just conskuc- reached out for helo. Her mother called or changeit before maltreatmentnbecomes tive criticism,"shewrote, 'I was in love." SaleHouseDenver and Brooke took it from somethingyou expect." He'd verbally put her down and per- there. "The fint time you're abused by your suadeher not to socializewithout him. She wrote that for the past yea.r she has parbrer needs to be the last tirne,nshe said, "If he allowed it ... I achrally f"lt C,rilty been receivingthe support she needed, "or else you're setting your own destructive and selfish,"she wrote. "I began to believe pattem." what he was saying more and more with Suruiving each passingday." *Due to the nature oJ the stories, onllt A relationship with an abuser tends to She said she felt she needed to put up become noticeably more abusive once the first na.nzesu*e used, and sornc pseudwith it because they were a popular couple couple begins living together or they get ontrns Tsere used to Trotect the identity on cunDus, She said she felt too ashamed married,Jacksonsaid. of the aictints. Continued
from 3
woges Compoign ogoinsl bofile $udent debt By Jimnv Cusack cusack@mscd.edu
Colorado Public lnterest Research Group Student Chapters, or CoPIRG, sponsored a national day of action to save ffnancial aid on campus and organized an event to raise awarenessof surdent debL Auraria studenb joined other students from across the nation with a- "CaII In Day to Congress" on OcL l9 to save federal loan programs Fom downsizing and vote in favor of higher education fr-di"g. CoPIRG placed an oversized.graph in tre Tivoli and encouraged sh:dmb to write the arnount of debt they carried. The graph ranged fiom $5,000 to $40,000. Studenb were also encouraged to call their local rep resentatives and ask them to vote in favor of higher education fi-di"S as well as sign a "debt yearbook" to record the speciffc arnount they owe in student loans. "Our goal is to let congress know that surdent debt is a big problern and we don't want this problem to get any worse," said CoPIRG qpokeqpersonAshley Cameron. Cameron said the national average for surdent debt is $18,m0 and the average for Auraria studenb, according to CoPIRG's chart, is $%,000. She also said drat 39 percent of recent college graduates have unmanageable loan paymenb, which is determined if more than eight percent of a studendsmonthly income go toward paying off loans. Congress is currendy calling for $11 billion in cub to student loan programs. If passedin its current fonr\ House Resolution 609 would make it harder for 5 million shrdents to afiord college by cusing student aid programs such as the Pell Grant program. The proposed cut, onethird of the federal government's allobnent for ffnancial aid, could cause :rn increase of $5,800 per student in just interest charges alone. Bqcause CoPIRG is a registered nonprofft organization, they cannot lobby for or against any law or persuade a legislator. "What we are Fying to do is educate the public that congress has control over these things and students should call and let them know how they feel," said Corey Nadler, campus organizer for CoPIRG. Nadler said that, ultimately, CoPIRG would like to see more federal student aid so people can afford a.college education "Higher education should be a dght, not iust for the elite," he said.
AAS.
Continued from 5
to another level. We want to give permission to go forward-to transform us, to hansform Meto Denver, to harsform America, this country." Sankofa u,as the cry heard throughout he day. Sankafa. said Christina tU. Srgla the interim associatedirector of the Women's Studies Departrnenl "means 'all my relations,us united.'" Opalanga Pugh, a well-known storyteller from Denver, who also studied in Nigeria to attain a greater sense of the oral tadition, led a song, prayer, me&tation and storytelling. Many people in the crowd were moved . to yell out the names of their ancestors.and invited them to be part of the celebration. "It is a time of looking back and looking forward," Pugh said. "If we stand tall, lt is becausewe are standing on the shoulden of our anceslors."
. TI{E METROPOLITd\ OCTOBE,R 27,2OO5
PAGE8
il\SIGHT
. 303-556-6925 Nic Garcia . Insight Editor . ngarci2O@mscd.edu
J,A,NTIE DICKERSON fiiclcer5@msalalu
"On the brink of lvar, may we remember how divine human beings can be.'
-suheirHammad
Attendance
.t
6 MT OUSINCSS I have always been a penon of a rebellious and somewhat militant nanre and I have never been very accepting of burdensome nrles and policies. Just ask .my one of my supervisors at any of rny meaningless iobs who told me that if I did not like the policies and procedwes, I could leave. I would tip over rnyself to get out the door. So, imagine my horror when one of my professors told me he would not accept my homework because I missed the class before and did not have a doctor's note. "It is the departnends policy,' he said. I felt heat rush to my face, I know I urmed several shadesof red as I swallowed my anger and attempted !o vocalize my displeasure as tactfi:lly as possible. It was not my professor I was angry a! it was the phrase, "it is the de-' parhnents poliry" that was too laree
formeto,*uilo#. lf I want to show , k.T older.shr-up for testsonlle dent I have diffi-
;;;.";;.;
,ru"i to i'..11"off
5',1TlT';#; Pholos Courtesv ol \Iark Tumer
An lsroeliDefense Forcesoldierfiresot MorkTurner.Thebulletstruckhimin thethigh.Turneris producing o filmobouthislimespenfin Polestine. "Ripples Cross"will debuton Nov.8 in Thefivoli.
luffi#:+#fi'#i#"**q1
ColoradoBoulder and no idea about udrat he was going to experience. Three years, a gurxhot wormd and a fflm production la.ter, Tumer prepares to make his third voyage to Palestine to document daily life in the West Bank. "What prompted me to go (to the Mddle East) was an almost endemic lack of understandlng" Tumer said. uMy only exposure to the region was from mass media ... I knew I had to go to *ris place to truly undentand." Tumer originally planned to remain in Israel, though his itinerary abrupdy changed at a meeting hosted by the International Solidaxity Movenent in the West Bar*, This was during the siege of Nablus, an Israe[ Defense Force atack coinciding with the beginning of conskuction on the enormous apartheid wall that now encircles much of the West Bank wifi concrete and barbed wire. The lntemational Sohdarity Movement
ZOE\IIILLLA,MS williamz@msd.edu meeting was intem.rpted by the sound of gunshots. As atendees rushed into the street,Turner had a moment of panic. 'I "I said, have no idea what I am doing' to the guy next to me. He turned to me and said, 'Baptism by ffre.'' What Tumer found before him was a bloodbath. An Israeli Defense Force tank had opened ffre on a carload of women and children, as well as two loddlers pinned against a wdl by the spray of br:llets. "These toddlers just dropped to the ground," he said. International Solidarity Movement medical volunteers took the chil-
dren inside to heat them. "I looked over and saw one had blood coming out of its ears ... their screaming was rattling-but good, because I knew they weren't dead." After that experience, with nothing more than a Dictaphone, a camera, a journal, a toothbrush and trvo shlrb in his bag, Tumer set up camp for tve weeks in the West Bank. 'I'm not leaving." "I just said then, Work with the International Solidarity Movement involved staying in villages to prevent evacuation due to Israeli Deferse Force or Israeli seffler harassmen! aiding in negotiations at Israet Defense Force check points, protecting Palestinian homes from demolition, assistingin hawests, taking down roadblocks and visiting houseswhere families were being detained by Israeli Defense Force soldiers and offering relief. "I have never been beter at anyhing in my whole life." The work that meant the most to Tumer involved children.
N{ARK'S\I0\ IE 0nNov. lounge See "Ripples Cross" ot4:00p.m. 8 infieMulticulturol g0l0 informolion. formore or www.ripplescros.tom
SeeTI.IRNERon 10
iturthar'
whom? I decided to check out the attendancepolicy at Meto. The information provided in the catalog and on the Mebo Website states that attendance is necessarythe ffrst week of the new semester to ensure that you are going to be in that class. Since there are studenb who waidist classes,it is important that the inskuctor knows exactly how many sbrdents are going to be in that class, so those waitlisted sh.rdentswill be able to get a seat. I get this policy and I agree, but what about asendance for the rest of the semester? I spoke with Eugene Ackler, assistant regish-ar with the registrar's office, and he said that it is up to each departnenl and sometimes the individual insFuctor, to set their own attendance policy, For instance, my political science professor does not have a set policy because the belief is that if the student does not go to classit is detrimental to his grade not to attend. Participation goes hand-in-hand with tlle attendance poliry. If you axe not in dass to participafe and you miss more than the allotied number of absences,your grade will be reduced by one whole letter. Ackler also informed me that the department s attendance policy is zupposed to be on the syllabus. I checked the sylabi of all of my classesand not one of them states the deparhnent's policy. However, each one does provide the attendance policy for class attendance on religious holidays. So, if you are like me, arrd you take classes in a variety of deparhnenb, what do you do? Ackler's advice is to read the departrnent\ notes and know what you are getting into before registering for that class. I say if I rvant to show up for testsonly, I should be allowed to do just that. After all, it is mrr money, my educaffon, my grade and my knor.r'ledgethat will suffer. And thar should be my choice.
,BAPITS|/M BY FIRE] American learns truth of conflict firsthand
I shouldbe
allowed to rto
-
INSIGHT o PAGEI
THE METROPOLITAN. OCTOBER27.2005
OUR OPII\ION JonColdoro,right, Independence presiInstitute dentondchoir of the qy'oteNo ll'sYourDough" compoign,offers hisperspective on Rebrendums C ondD in the VoteSmortDebob heldin theTivoli Turnholle on Sept. I l. Thedebote plocedColdoro ogoinstBrod Young,formerRepubliconchoirmon of Colorodo's Joint BudgetCommittee, ondwosmedioted by Dr. Normon Provizer,left,of Metro'spoliticol science deportment.
Photo by Emily lhrisco e varisco@mscd.edu
Somehelpful hintsfrom a eetera,n, whether rou want them or not To the shrdents at Meho and beyond, I come to you with some advice. You didn't ask for i! but I am here to help any,vay. It's what I do. As college students, we all need some help at tjmes and the experience of others can be most beneffcial. To sorne of vou. this advice I'm about to disseminate is not news at al! for others this could be very valuable. I'll let you decide. Five preces of advice is wha.tI'm oflering. My ffrst piece of advice is to buy a Flash Drive. For those who do not know what this is, a Flash Drive is like a floppy dislq but is way smaller and can hold much more information. They can be found at the campus bookstore and al most oftce supply or elecb:onics stores. They can hold several years worth of assignments, essays, PowerPoint presentations, pictrres, whatever you need stored from a computer. Many shrdents try to saveffles to the Student Drive on the campus network. Ever try to go back and ffnd something you saved on there? It could take vou all dav to ffnd which document labeled nEssay" is yours. Meanwhile, those of us with flash Drives know where our ffles are at all times: on our key chains. I say this !o you both tech sawy and novices alike: get a Flash Drive; it will saveyour sanity. Secondly, utilize the public transportation system in this town. In our shrdent fees, we pay an RTD fee, which gives us the opportunity to use the buses and light rail whenever we want without buying a ticket Just flash your student ID and that's good enough. Parking is free at any of the Park-n-Ridesin town and there are a lot of buses that make drops on or near c:rmprur many times a day. The train has two stations on c-ampusfor sLrdents.When you drive to campus you have to find a place to park and pay upwards of $1.75 per day. If you come to class four dals a week 16 weeks a semester, that comes out to $l 12 per semester (and that's for the cheap spob). The choice is clear.BuL while vou're at it ... Carpool. I can'i stressthis enough. With gas prices at an all-time high I know every-
VOIE YES ONREFERENDUMS C&D M.yb"
we're not voting for a president or even a senator this
time around the polls, but we are betring the bank on higher educaton and other essentialstateprograms. In caseyou've been living under a rock and haven't heard the news, Colorado has a bit of a problem on her hands. The problem isn't the budgel Rather, ids the lack of one. Colorado, for severalreasons,has seena lack of income and it essentially can't afford to function any more. That's where you come in. There is a solution, but it can't happen without you and a yes vote on two ballot measures:Referendums C and D. Here's the deal: TABOR was cool back in the '90s.It held a tight leash on the politicos, and rightfrrlly so. They bend to have a compulsive spending habit especially when it's not their own money. However, all good things must come to an end. Colorado's economicboom did. And so, too, must TABOR But that's the genius behind the balloc it doesn't end TABO\ it only furloughs it for five years so the statecan reclaim its losses. The.state has already cut billions. Yeah. that's a 'b" as in BIL LIONS. You've ,u"n it in the neverending hrition increases.And another $ZO0million will have to be cuf not only from higher educatior5 but also from bansportation and health care. Simply, if C and D don't pass,publicly-funded higher education will ce.Ne0oexist in Colorado by 2015.According to the Bell Policy Action Network, the College Opporhrnity Fund stipends will drop from the current $2,400it curently is, to zero by 2015. We can't let this happen. Leds say C and D don't pass.You as a taxpdyer will receive, on average, a combined total of $450 over the ffve years C and D would stand. Dont spend that all in one place, like, say, the Auraria Bookstore. Seriously, the refirnd you'll receive may buy you three textbooks, if you're lucky. Then agair5 compared to what you'll have bo dish out for hrition, $450 will be nothing more than a blip on the radar. We urge you to vote yes on Referendum C and D.
SLAN G. DONO\,AN sdorne,a3@msaledu one is looking for vrays to save at the pump. One way is to ffnd people in your classesor friends on campus who live near you, have a schedule complimentary to yours, and who want to carpool. I have recently started carpooling myself and it has saved me a lot of monen and I only do it twice a week. Since money is impodant to us all, and our gas bilb are geting higher and higher, this would be a good alternative. Speaking of saving money, what is the one thing studenb spend more money on outside the classoom than anything else? Alcohol. I used to think it would be rent until I went down to LoDo one night and spent a hefty arnormt of money buying drinks. Not only did I drive from zuburbia to get down to the overcrowded bars on Blake, Marke! and larimer (gasmoney), but I a]so had to pay for parking and then pay out the rear for a watereddown rum and Coke. From that night on I thoughc forget l,oDo, ty a lo cal dive bar. Much of the Meho population lives oubide tre city and driving downtown to &ink is impractical. Instead, ffnd some dive in your own neighborhood that has a good drink special, a pool table, and doesn't have a line out the door to get served. I assure you, someday you'll thank me for this. That's iL lt's my advice to you. Take it or leave iL llave idvice of vour own that vou would like to sharewidr tle MeEo reading public? Send it in to me and I'll nrn it next time, with all credit given to you, of couNe.
TI{E MtrTROPOLITAI\o SNCE 1979 EDITOR IN CHIET Tim Dunbor NEWSED]TOR CloYfon Woullord ASSISTANT NEWSEDITORS ilatt Gluone . iloyo Solom INSGHTEDTIOR Nic Gorcio FEATURES EDITOR Adom Goldstein ASSISTANT FEA]URES EDITOR Hcother Wohlc MUSICEDNOR Gory Coscioto ASSISTANT MUSICEDITOR lllegon Gorneol SPORTS EDITOR Mclt Gunn ftIOTO EDITOR Iflotihevn Jonos ASSISTAMPHOTOED]TOR lcoh Blunrschli CHIEF COPYEDITOR Shoron Alley COPYEDITOR Scott Hc sbrcuck . Nicole Greinier ADVISER Jone Hobqck DIRECTOR OFSTUDENT MEDIA Doug Bell ASSISTAN'i DIRECTOR OFSruDEM MEDIA Donnilo Wong
coNTACr US Editrcriol: 303.556.2507 303.556.2507 Advertising: Fox:303.556.3421 E-moil: dunbor@mscd.edu
77u McrroPolitanis produced by and for the shrdentsof Mehopolitan StareCollege of Denver and servesthe Auraria Campus. TheMaropolitants supportedby advertising revenueand shrdentfees,and is published every Thursday during the academic year and bi-weekly during the Summer semester. Ihe Metraplilan is distributed to all campus buildings. No person may take more than one copy of each edition ol Tlu Mctro@litan without prior written permission. Please direct any questions, cornmenb, complaints or complimenb to Metro Board of Rrblicarions c/o Iftc Metroplitan. Opinions expressed within do not necessarily reflect those of Metropolitan StafeCollege of Denver or ib advertisen. Deadline for calendar items is 5 p.m. Thunday. Deadline for pressreleasesis l0 a.m. Monday. Display advertisingdeadline is 3 p.m. Thursday. Classfied advertisingis 5 p.m. Thursday. Our officesare locatedin the Tivoli Surdent Union, Room 313. Mailing addressis P.O. Box 17336! CampusBox 57, Denver, CO 80217-3362.
@ Alldghtsle$rved.
OCTOBER27.2005. THE METROPOLITAIi-
PAGE10r I\SIGHT
. Eyesopento a newunderstanding TURNTR NL{RK'SCAI,L TO ACTION f. Go to Palestine. 2. Donate money to help activistsgo to Palestine. 3. Give time to organiz.ations setting up firnd-raisers and gathering sup plies for activists. 4. Offer emotionalsup' port and time to activists upon returning from Palestine. goh theInterformore iffirmotion, nolionol Solidority Movemenl's Websih olwww.pohlidorily.org orlurne/s site, ww.ripplesaos.mm.
Tumerin Polesline.
Continued from 8 Every moming he, along with other Intemational Solidarity Movement activists, would walk Palestinian children to school to protect them from Israeli Defense Force gunfre and tanks. The activists would then create a human barrier between the tanl<s and the schools to prevent gunfre while classeswere in session. 'There's nothing I wouldn't do for those Iitrle kids." Mark said. When his kip ended, Tumer said he had a rtifficult time retuming to the States. "I felt guilty about leaving." Afur nine months of bartending, selling his car, buying a camera on a credit card and geting a computer donated, Tumer rehrmed to the West Bank with a mission; make a fflm about what he saw. The retuming trip provided a very dil ferent climate for intemafional activists.This was 2003 and the Intemational Solidarity Movement was having a difficult time. Brian Avery was shot in the head and blinded. Tom-Hemdall was in a coma, later to die, and Rachel Corrie had been murdered with the use of a Caterpillar bulldozer. All three were Intemationit Som"tity Movement activisb. Additionally, the Israeli Defense Forces had developeh tactics to counter the efforts of the intemational activists. With a camera that was concealed a majority -t'me of the tjme, Tumer documented his monitoring checkpoins, arrests,peacefirl protests,oliv! harvese and his own-baule
scar, a gunshot wormd ln his right thigh from the Israeli Defense Forces. Throughout it all, Tumer said he was inspired by the will of the Palestinian people. "I ffnally understood whether or not I am here, this will go on ... these people are never going to disappear. There is nothing they can do to destrov Pa]estine." 'Now, Tumer is lreparing 0o retum to Palestine for the third time in January of 2006 for more leaming, activism and fflming. I did not write this story about Tumer to tell vou about his bio to Palestine, He does that well enough i" hi. tt-, "Ripples Cross.n In the process of interviewing Tumer about the Israeli occunation and. human rights abuses against Palestinians, he said, "It isn't about who you elecq it is about your willingness to disassemblepower structures that oppress." He said he warted to deliver a call to action and ask others to display such willingness' That is what my job is here: to relay this call '.earmsto you; Turner realized he did not know muchan American hfr_"rity' really_.-Tumer went to another_partof the world. He took a risk. He took a bullet and survived iL Tumer will retum to Palestine in January, as he found new truth, new passion and a home within a movement during his.past trips. Tumer is just -like yoy-or 1e.- Th{ means r'vecan do this too. Why dont we?
Hq 'tr-
mffimuffid
As Halloween approaches, many of us wonder what coshme to wear this year, and whose pa.rty is going to be the besl But how often do we really stop to think about where Halloween came from? Or, more importandy, as we parqv on Ha.lloween night who are we partying with, our friends, or the neighborhood ghosts? Halloween started over 2,000 years ago. It was not a festival to see who could Eet dressed up, yet wear the least amount'of clothes: it was a festival to honor the dead. People would not dress as sassyschooL girls or wear masks that looked like good ol' George W.; rather, *rey would wear the skins and heads of animals. It was believed that this was the night the ghosts of the dead rehrrned to earth. But there is no such thing as ghosts ... or is there? I decided to find out on my own. I am tough to penuade without cold hard facts. And let it be known to all: I am convinced. - I started . my- search by looking up "ghosb" on the.IntemeL Were there any lTnt9d spoj.sright here in Denver? I almost fell off my chair when, at the top of the_list (www.geociges.com),I saw our own shrdent center-the Tivoli! Before the Tivoli was converted to the student center it now is' it was a brewery. Sincebeing converted into the Tivoli Student Union, there have been sFange incidences lepofed-, such as noises froT F" vents on the third lloor sounding as if there was an elegantparty going on, and stange whispen being heard when alone -in the batbrooms. According to ar issue oI The Metroplitan, from Oct 30, 1998, Auraria historian D-ennis _Bryantells a story of a litde girl in a formal dress who is often seen upstairs in the multiculhral lounge. Bu! I was not yet convinced of the reality behind ghosts. - Next on the ghost filled hst was the wellknown Cheesman Park, formerly Fo*" _{ City Cemetery,_andnow simply a beaufrfrrl park firll of gardens... and ghost? According to Denver native PhiI Goodstein it is. Goodstein n:ns *The Ghos.F of Cheesman Park" tour -everyyear as Halloween approaches, and has heard stories that are m-ore than convincing. t !"g* q read the- history of Chees man Park, and the scandalsthat had taken place there. Graves had been dug up to be reburied in a new cemetery. The Capibol Hill neighborhood was overflowing with repocs cf ccnF.rseda;:d _lost on people's doon and windows. This was the talk of Denver until it got so out of con-
BF]THIt{NNON b/mnnon@rnscdeda trol that reconstruction of the cemetery was brought to a halt by the mayor. The haunting continued and go on even today. According to neighbors in the area, moaning is often heard by current Capitol Hill residents. It is said that stange shadows and misty ffgures are often seen floating around the area. There are still an estimated 2,000 bodies gnder the park's gardens. Goodstein telli of a legend tha! at midnight during a total eclipse of a blue moon yo-o .an staird on the sieps of the pavilion ^Park lyind, rather than seeing C'heesman ing in front of you, you-will seea grave-tlled ceinetery. The iast place I decided to researchwas a bar in my neighborhood, The High Steet Speakeasy.Sorie friends and I deiided to 96 to The Speakeasyfor some drinks. At ilosing time we weie invited to stay. and wl did. Until 5 a-m. stay 'The owner of the bar, John Wallace, led me on a tour of the old 6rothel, including the 16 rooms upstairs--one with bloodso-akedwallpapet -ghost and t6e basement where he says the of a man is occasionally seen.The basement was the only spot in thb bar where he seemed a little tense to take rne. Whjle down there, I understood why, as chills exuded ttrough my spine. But io te[ you t]re truth, I was shakin! during Sre whole 3 a.m. tour. There have been reports af the Speakeasyof doors slamming and women."ie.-ing but nobody is evei there. It is supposed ttrit -any deaihs happened there, ind the angry ghrisLslinger. Ghbst hunten have spent tle ,iight therefand some of the things ihey have ieported are astonishing. A rlportrir for Wesiuord, John la Briola, ipent i night there as well. Fe reported sounds on his iudiotape such as "a mocking female laugh ... thir:gs ihat I saw, heard and-felt were lust as scary-and I have yet to retum to thisbar.
WORKII\G IT o gboley@mscd.edu ByGory Boley I cannot find a job I like. Are their any resources on campus that can help me out ?
o tmccort9@mscd.edu ByTesMcCorthy
Don't drink the woter... reolly.
Thingsmorefriglttening than being single... or in lo(,e
@ lc :,1
More than you think! Finding employment is a contact sport Of course, you know, I believe the staxtingspot is the Meto Career Services Office located in CenFal Classroom 203.We offer qualified careerspecialists who will listen to what you want and prescribe a career st'ategy udque to you and your job interests.Also, sign up with us for "Take a Meto Sudent to Work Dav." happening Nov. 2. Mero alunni wil in;te you to come in and observe how they work in a orofession of vour choice. This is an excel]ent opportuniiy to leam, network and find a mentor!
INSIGHTOPAGE1l
. OCTOBER27.2005 THE tr,IETROPOLITAN
YOI]R OPINIOI\
EYESIGHT ogold$eo@mscd.edu ByAdom Goldstein
upphotogrophy Shoping lve always been drawn to imagery. Before I could talk, I comrnunicated through my stylized stick$gure drawings. As I reffned my style, I continued to rely on my googley+yed cartoon chaxactersto r€lay my deepest and most personal sentimenb, even after fd gotten the hang of speech, When I enrolled in my filst photography course this summer, I was somewhat leery about switching vizual mediums. I was newous about making the jump ftom the ffgurarve and stylized to tlrc lit€ral and pre cise. SUL I bougbt a used Penta:<and threw mlnelf into dre process, snapping shots rvhenever I trought I spied somedring "compositional." This was one of my ffrst solo prinb, a moment capnled on camprs through the vantage of a bicycle wheel. When I developed the photo and I ffrst dipped this piece of photo paper into the developer, the shapesand tones that emerged from the
redolent brew held my gaze. I liked the way certain shapes repeated themselves: the qpheres of the wheelq the squares of the windowg the oblong rectangles of the bike seat and the umbrellas. I liked the way that the car's tire was caught within the larger circle of the bikes, I liked the thought that I had pressed the button at exactly the right moment
I know Im no Cartier-Bresson, bw I was pleased to thiDk that I had captred a "defining momeng" however small it may have beenAs I continue to toil under safe lghc and oven the potent smell of pholo chemicals, Im beginning to realize that photography can be$rst as zubjective, just as ffgur+ tive and just as free rN iury cartoon chaiacter
THE,IROPII\IOI\ ByAlon Fronklin
Re: Referednums C&D Brad Riggin\ explanation of Referendums C&D is not completely accurate Under Referenduns C&D, the voters will forfeit a tax rebale ... one which no voter has even received in the last few years. Everyone who qurliffes for tax credib will still get them. Everyone who qualiffes for a tax refrmd will still get one. If Referendums C&D pass, your taxes will be the siune as they were last year! Referendums C&D bring more money to the statebudget becauseColorado's economy is gowing. More people are working. In most shfeq that means the state gover* ment geb a share in the growing prosperity, and can use these firnds to improve quality of life. Referendums C&D mean that the state can keep the ta;< dollars it collecb, and invest them in serviceslike pubhc safety,road repairs, higher education, and ffrefighten' pensions (atl of which are at risk without C&D). These improvements will draw new business to the state, and more business mearrl an economy that can continue to imProve. What's on the clropping block without Referendums C&D? The sta.tebudget ofrce just released a list whictr includes: Increase resident undergnduale trition by an average estimated $3,952 for a fouryear degree. Some rural conmunit)t colleges or state colleges could close. Eliminate Colorado Cowrcil on the Art fu.dirg. Cap fie prison populatioq resulting in the releaseof many prisoners. You can go orline to MehoConnect and look at your tuition bill. There is a line there for the College Oppoftnity Fund. That s the share of your irition that Colorado is paying, for now. Keep in mind that the amount you see there is just for one semester! If Referendums C&D don't pass, how will you make up the difference? Sara Raab Metro Sophotnorc
Reoding thefineprint hove soved us,fienondnow could The tiny percentage of Metro sfirdents who have achrally paid attention to their disintegrating student govemment over the past year won't be zurprised by what I'm about 0o say. The fact is, I've been accused of a lot of prefry nasty stuff since Iast spring. I "sabotaged" last year's electiors, you know. I engineered the forcible passage of "questionable" election bylaws through the SGA executive committee. I didnt do enough to recruit candidates.After I resigrredfrom the cormission, I was even seen o[ce or twice near the dreaded 'illegal polling station" that threw the whole proceedins into chaos. ' Oh. the humanitv. ThaCs one way of looking at iL Another is that the SGA doesn't reaA anlthing yort give them to approveIt's possible that people didnt want to join their litrle club last year becar:se they got over their own wet-nosed social inadequacies back in grade school. And maybe frl.erewas tuoer a problem,legally or ethicalll with tlrowing some laptops on a table and inviting students to vote there if they want: it only became a problem when the incumbents realized the outcome might be some
thing other than what they had in mtnd. What you've seen over the past year is two very different philosophies at work in your student govemment elecdons. One ap proach sought the broadest possible student pa-rticipation,a level campaigning field, and lively debate about Meho's fulre and the SGA's role in iL The other is the approach we've seenfrom mv successor.election commission chair, Richard Boetkrer: an incoherent grab bag of oppressive nanny dictates and harsh penalties for anything remotely 'disorderly.' Appaiently, *rough, if you catch Mr. Boettrrer on the right dan he'll tell you to foqget about those n es and moreor-less do whatever the hell you wanl ICs inshuctive to note that the candidate he told to disregard the nrles is the former chairman of the Auraria College Republicans,just like the siffing president and shrdent trustee. I'm sure that's just a coincidence, though I'm glad the Met was here to ask the question, since the SGA Executve was doubdess a Iiule conflicted. This incident cannot help but raise larger and more houbling questions about our SGA. who, after the disaster of last year's
elections and all their hand-wringing about the bylaws I wrote, apparendy didn't even bother to edit Boethrer's mles for spelling or grammar-let alone appropriatenessto govem an election. Are we to believe that Richard Boetlner 'forced" these laughable guidelines through a helplessSGA Executive like I did? The sitting president expressedshock thal Boethrer had contradicted his own n:les, and promised to look into i! but that's secondary at this point to the larger problem of rules that are poorly written, childishly restrictive, and arbitrarily applied - isn't it? Based on my eqrerience with these peo ple last year, I'm guessingthis is just tlu wa1 thn likb rf. If the new SGA administration decides.they.would.lil.e.to start.again,.witb" election bylaws that are wdtten in complete sentences.thev should feel free to p€ruse the perfecdy gbod document I compiied for them last spring. Perhaps this time they'll achrally read iL
Alan Franklin is thc fornr clu.ir oJ tIE Electiorr Comnissiott. He nzy be reached atfr anH a@n scd.edu
Apparendy, as a Meho student I am in the minority for opposing Referendums C&D. While I rmdentand that many studenb believe it is in their interest that C&D oass becauseit oromises lower hrition (or smiller increases),izuggestthat in rhe long run it is a bad deal. The next time the politicians squeal that they need more money for whatever the causeof-the-momentis, they will be coming right back to us (when we are making the big bucls in a few years) to fund the necessary initiative that will prevent the statefrom collapsing. Besides, if they really wanted to lower education cosb in this state, they have to look no firrther than right here at the Auraria campus. There is no logical reason to have two different undergraduate instih,rtions on this campus, but that is exacdy what we have with the redundant and expensive overhead of each. It is simply much easierfor the poliUciansto ask the taxpayers for more money than to deal with issueslike this. Cfieg D@ni@t Il,Iet o S''.dent
TheMetropolitazwelcomes all letters from Metro students,teachers,faculty and administration. Letters must be typed and submitted to the Insight Editor by Monday,3p.-.the week of production. Send lettersto ngarci20@mscd.edu or leaveyour letter for Nic Garcia in the Office of Student Media,Tivoli Student Union, Room 313. Editors reseryethe right to edit all letters for content, clarrty ard space.Letterc must be signed and dated with contact information for the writer. Letteri may be no longer than 300 words. Any submissions longer will be considered for "Their Opinion." All rules apply to longer essays.Essaysmay be no longer than 500 words.
PAGE12 o METROSPECTI\rE
THE METROPOLITAN_:
Adam Goldstein. F-eaturesEditor. 1
Buntport' s tronsformotion genres group Locol theoter new dromatic explores
By Adam Coldstein . I Photos bv Matthew Jonas
Here, the characters' pedestrian and the pl arormd the minufiae ol like "Titus Andronicus: The Musical' The dramatic effe, and "Kafl<a On lce' decided to tackle rely purely on the skj new genres, the biggest &amatic chal- the players for its eff lenge was keeping it real. are no elaborate prop Since 1998, the BunQort Theater coshmes. The ft'anspa Company has carved its own niche holds ie own daunting in the local theater scene, building a comPany. quirky, brainy and coruistendy fi.urny " ('Realism') was dr repertoire of shows that draw from the sbetch for us than any finest literary and dramatic sources. nah Duggan, a Brmpr Their plays combine a reffned senseof worked behind the scer cultrue with an unabashed silliness, an and stars in "Horror.' intimate knowledge of the old masters much more friehteninr with a brazen and brave brar:d o{ com- "Horror") we iad rio' edy. Aiong with thet live sitcom, 'Magscare people and if we nets on the Fridge,' which resumes scaring people. But i Nov. 2, the Br.rntport'son-stageoeuvre was horrifying. " has alwdys effectively used diverse inUnlike the staighd fluences to create comedy that is fresh, ism of "Realisrq' mucl innovative and just plain funny. is involved in "Horror: For the new season, however, the tion." B:xed on the l[ Buntport crew has skayed from its co- "Weiland or the Tra medic roots. The two new shows mark a collaborative effort to experiment with new and untapped genres. Both nHonor: The Tralsformation " and 'Realism: The Mythical Bronoosaur" ale apdy named, representing the comparry'sfint forals into foreign dramatic tenitory. In choosing a different direction for the new season, the Bunport's players hope to expand their horizons and display their vaded interests. "Part of it, deffnitely, is just for our ow'n arnusement-for us to h:y new things," said Charles Brockden -Dro Buntport member Brian Colonna. "I tion experiments with think it's also imoortant for us to make ties of the staâ&#x201A;Źeto co sure people realize that there's a diver- genuinely scary play, sity of things that we do ... We're not makes full use of div their efforts to deliver a devoted onlv to comedv." Indeed,'these two shows reveal a ening effecL Puppets, I varied set of interests ald directions for fects and other ahnosl the company. "Realism: The Mythical the oroduction's com Brontosauruso explores a character's the brainy roots oFth< existential crisis in a stark and sober are clear in the dialog nu lner. Evan Weissman plays Jack, indulge in highbrow d w'ho has locked himself in his room af- practical implications ter leaming a distLubing truth about the Socrates.Even the mo brontosaurus. His sister Fiona" played of the play are intersp sophical musings. By c by Erin Rollman, and her bofiend Michael, played by Brian Colonna" try ceral impart of scary r to coax him out of his room and back the satiric and inElle into the living world. Meanwhile Ben, Brown, the members Jack's roommale, played by Erik Ed- make an effort 0omake borg, takes a more resigned approach more palatable for aud be unfamiliar wi*r th toJaclCs self-imposedimprisDnment theater. "Realisn' represenb a bold step to 'Part of our missio ward minimalisrn, loward the most basic and fr.rndamentalaspectsof theater. be accessible,"Werissn
W:h::T#$?.d#
"Horror:TheTronsformoproduction, ployso phonhcm in Buntport TheoierCompony's EvonWeissmon they for thecompony,os explorenenvlormsond premiere deporture tion."Ihis seosonmorkso stylistic twooriginolproduclions.
@mscd.edu.303-556-3424
,ldstea@mscd.edu rJonasm(gmscd.edu rises are utterly t twisb revolve everyday life. ls of Realisrn' I and ability of cL Here, there q flamboyant rncy of the play :lemenb for ihe
who dorft normulV go to the theater or don't want to ... can come see some. thlng of ours. Maybe because we're irreverent about ig hopefuIly they'll see other thealer." In both "Horror" and "Realisrn " the Buntpod tries to balance experimenhtion with accessibility, innovation with appeal. "I trink a lot of people think (of initely a bigger theabe) as a four-letter word" said Erik ting," said Han- Edborg. "We're fying to alleviaie that t member who and make it come alive." eson "Realism" Even in breaking into different "It seemed so genres, the company has retained its !c tackle ... (For qeative flair for the phpical and tactjle lei what would elemenb of their producfion. A two,vere capable of story set piece functions as the stagefor e realism show both pmductions, but the way in which it is used varies dramatically in the two rward minimal- pieces. In "Realism," the set is transpaxmore stagecraft ent There is sealing on either side of Le Transforma- stage and the theater-in{heround feel ' benhrry novel, adds a complementary irnmediacy to sbnnafion" by fre drama- For 'Horror," however, walls are added and give the set the eerie appearance of a Mctorian dollhouse. "I think that the set almost came first," Rollman said. "We talked about horror as a genre that we were interested in exploring ... and someone pictured a house. The idea to do a realistic play might have technically spun from thal" The pieces are correlated thematically as well as physically. Both deal with the crises that arise with a change in conviction. Both involve characm,rthis produc- tels that face the consequencesof such rll the possibili- a change, even if the responses vary y a chilling and gready from one play to another. Both The company explore the fine line between illusion se elements in and reality, myth and facL Much of the Buntport s continued ;enuinely frightlrting sound ef- successas one of the foremost and well:erics play into reputed local thea-he companies relies lex craft. Still, on its audience. With its popular comesortrce material dic productions and ongoing sitcom, e, as characters the company has built a solid reputacussionson the tion and fan base that sewes as their f Aristode and most reliable and rewarding source of ) gruesome acb advertising. rsed with philo"When something happens wordmbining the vis it feels really good," Colonna 4ge effecb with said. hral content of "Especially when... there's not a f dre company budget for advertising on billboards or righfalutin ideas buses.o nces that might For morc information about experience of the Buntport Theatrg visit www. buntporlcorn or call (720) 946 statement is to 1388. n nid. "People
whoploysHenqy, posein â&#x201A;Źenfer:EvonWeissmon, ond ErinRollmon, whoploysCotherine, thekitchensetof "Horror:TheTronsformotion." Topright BrionColonno,whoploystheobedholdingo knib on thesecondftoorof theset..Botbm dore,sftrnds wer o blood-splonered right Theodore ond C.otherine sii withtheirtwochildren,TimondKob, os Corwin,plryedby wereoperold by theentireBunlportcost. ErikEdborg,lookson.Thepuppets
Getlnvolved JoinoStudent 0rgqnizulion! Metro hosneorly | 00regislered orgonizolions inolloreos of Slole inlerest. inonycurrenf Nolinlere$ed orgonizolions? [omeondsee Studenl Activilies t0find0d howh slorlyourown.
resources! Join ondopen upoworld ofvoluble gelmore Studies show fial involved $udents odofcollege, groduole grodes. ondgetbeiler sooner
METROSPECTI\IEo PAGE15
THE METROPOLITAN. OCTOBER27.2005
Hung ty for Poe lTi'iffi1,;:ill1,:1, By HeatherWahle o hwahle@mscd.edu
derer in 'The TellTale Heart" Tenured With the pare and language of poety, actor Verl Hite, who has been active in the precise vocabulary of an eloquent mortheahics in the Denver area for the oast tician and the dark themes of the best ffre30 years, brings his yeats of e*pertise to side ghost story, each reading of Edgar Al"The Raven." Amy Ratlifi, Iaura Ione lan Poe's haunting poems and short stories and DelI Domnib who also conhibute is sure to zummon chills. to an evening of frightening entertainThe talented cast of The Hunger Artists menl round out the ensemble. &rsemble Theane gives endlessfrights with Poe's dark tales transplant the audieach masterfi:lly performed piece. ence to another era as the tradi[on of Poe provides material that is dassically stories read aloud is continued in its thrilling, combining frightening pmse with nost capturing form. The theatrical perdramatic elements. Hunger Artists Ensemformance of the classictwisted tales is a ble Thea.he has hosted the production "An delightful change frorn the conventional Evening widr Edgar Allan Poe" for four scaresof the Halloween season. yeaxs. The Byen-Evans house offers guidAt ffrst, fie acton anticipated ihat their ed tours in the safety of daylight from I I readings of vintage Poe would be witnessed a-m. until 3 p.m. Tuesday-Sr.rnday.The by a select few interested in haditional sue tours are provided by the Colorado His pense. With the constant presence of gory torical Society and cost $3. horror movies in the theaten and on televi Tickeb to "An Evening With Edgar sion, one might aszume that most people Allan Poe" presented by The Hunger crave cinematic violence over psychologiArtlsts Ensemble Theahe are $15 each cal terror. However, classic scares still ator 2 for $20. Surdent discounts are oftact large audiences. fered. Performances are held until Nov. The Poe readings have consistendy endrralled audiences, who often request lhat hos been decorotedlike o l920sero Holloweenporf. The museum, one of Denver'sgreot 6, Fridays and Satrdays, 7:3G9:30 p.n'., Sunday Ocr30 from 68 p.m. A qpecial they retrrm each year, making the Hallow- hislorichomes,offersHolloween-themed eventsin Ociober,includingreodingsof EdgorAlHalloween performance is also scheduled, een production a new Eadition. len Poesloriesond poemsby theHungerArtistsEnsemble. Make reserv-ationsearly, seafing is limited. "An Evening with Edgar Allan Poe," is To purchase ticket call (3ffi)$35a88. presented in the historic ByersEwansHouse On Sundan Oct 29, the Byer-Evans al 1310 Bannock Steel The house, con- of ghost sightjos and many mmors circu- such as an unlucky cal o ner in oThe Black *The Spirit of flallowstucted in 1883, has been preserved as a late that fie stately mansion is haunted. The Caf and a crazed wine connoisseur in oThe house will also host nruseum. The beautifirl Victorian house is atnoqphere of such a mysterious residence Cask of Amontillado." Ianghoffs energetic een" from ll a-m. to 3 prn This is a holithe perfect seting for the literary honor cla+ increases the suspensetlroughout the per- performance was a higtrlight of the show. day celebration geared towards families and srnall children. sics zuch as 'The Raven " considered by formance. Steve Padun, a UCD senior, also hingF Events will include garnes, fortrnes, his many to be Poe's most famous poem. Ensemble cast member Daniel Langhoff welkrafted rendiuons of a prisoner in *The The ByervEvans house has had claims portrap many charactersin the works oJPoe, Pit and the Pendulum" and a guilrfilled mur- toric decorations and crafo.
qdinner rlll'JBt""ti-t1,ll':ii:Li:; iilH::.:;ffi:f* neor Director Kevin Gromor sronds "ur"
RBVIEWS
Fovorites Seasonol TOP FN/E\TDEO GAMES House of the Dead (ARC) Although "House of the Dead" and ib sequels can be found on Sep, PC and Xbox, the arcade version is the perfect marriage of interactive grm games and graphic undead villains. The game's only weapon is a gun, in &D environments, fflled with creative zombie chnracten and devil dogs. "House of the Dead" is a must play at the local arcade. Resident EviI 4 (GC) Being hailed by GamespoLcom as, furobably dre single greatesthorror{hemed action game ever created," dris garne has re deffned the horror+hemed genre. Wiihin the ffrst few minutes of playing it is easy 0o tâ&#x201A;Źll that the beautifirl graphics were well planned and that this is not an average "Resident Evil" garne. The plot is mrre caretrlly laid ou! as the mrin charaater is a govemment agent who finds zombies and humanoid crea,trreswhile on.essigtrrnentin a Djropean village. "Resident Evil 4" is difrcult and by no means a monotonous zombie game. Castlevania: Symphony of the Night (PS) This insdlknent is simply superior to previous Castlevaniaeditions. Instead of playing a Belmong the player is cast as Alucard the son of Dracula. "Symphony of the Nighf intoduces mone weaporui and a level map, making tre game more enjoyable. The score and graphics are incredible, given the forum and time period in wbich it was released. "Casdevania" is a very enjoyable, spooky series, but "Symphony of the Night" is a rmique addition
Top fivepicks forHolloween
Audition (2000, dir. Takashi Miike) This story about a man searching for love is one of the most gory and truly horriling fflrns io come out in the past l0 years. Part love story, part gruesome horror flick, Mike's "Audition" will surely leave the audience questioning what their signiffcant other is really capable of. Bubba Ho-tep (2OO2' dir. Don Coccarelli) (Ps) This is a story about an ageing Elvis heAn undead champion has retumed from the spirit world to rid the world of dark sley, played by Bruce Carnpbell (see"Evil crea.h.rresand their evil leader Kain, The Dead Trilogy"), and a blackJFK (Ossie world is in darkness so the graphics tend Davis) teaming up to defend their nuning to stick to the same color palate of browns home from an ancient Egyptian munmy. and gays. Still, there axeplenty of details as Although the plot reads like a Bhorror the player impales zombie-trikecrratures and movie, it's the side story of Elvis that gves lighb varnpires on ffre. iSoul Reaver" deliv- it heartw-armingcharm. Idle Hands en dark action on wery level. Sara Brito (1999, dir. Rodman Flender) Devon Sawa plays a teena{ie bumout abrito@mscd.edu whose hand becomes possessedby a murderous spirit The fflm wholeheartedly TOPFIVEMOITES The Evil Dead Trilogy ((The embraces the fact that it's a teen-stoner comedy. It is fflled wift s[rpid-yet-clever Evil Dead' 1981, eThe Evil Dead jokes, It also stars Seth Grcen ("Austin PowIftt 1987r and 6Army of Darkneestt ers") andJessica Alba ("FantasticFoul). 1993, dir. Sam Raini) Ids not often *rat the guy wielding the Shaun of the Dead chainsaw is the hero in horror movies. The (2004, dir. Edgar Wright) movies in this series evolve from a tradiA masterfi:l mixture of comedy and hortional horror movie, as in the original, to ror, "Sharm of the Dead" stands out at the top of its classin the latest rise of zombie a wild, comedic experience, as in uArmy flicla, which include "28 Dals Iater," and of Darkness.oConsidered by many to the remake of "Dawn of the Dead." 6s ths king of cult horror mo.ries,'-fhe -Joe Ngryen Evil Dead" series,staring a campy Bruce nguyejoc@mscd.edu Campbell, is a cheesy, funny gorefesL Silent llill 3 (PS2) This game has realistic graphics, making ib horriffc monstes even more unnerving. The hero of this game is Heather, a character who 6nds herself in an abandoned shop ping mall trying to survive in a dowly unraveling plol By the time Heather reaches the town of Silent Hill, fear has set in-making this game a heart-pounding advenh:re. Lelgacy 6f l(nin; Soul Reaver
TOP FNC}AMPIRE BOOKS I ott legend by Richa.rd Matheson kstead of one vampire preying on countlesshaplesshumaru, "lcgend" tells the story of the last man on earth, surrounded by legions of hungry rmdead. A suuuring inversion on the classicvampire story. Intenriew with a Vampire by Anne Rice The book that set a million goth heara aflutter. Rice makes varnpires sexy and welte, but still keeps them just scary enough to keep it interesting. Dracula by Bra^m Stoker It can be slow going, but it's a bona fide classicdrat qpawnedthe whole bloodzucking ge e. Salemts Lot bY StePhen r(ing One of Kingfs tue mastâ&#x201A;Źf,pieces,lhis is probably the best modem varnpire novel that sticks (more or less)to the classicmlthos. \Iampire$
by Joho Steaftly
When it s time to stop betngafraid,and time to staxtkicking bloodsuckerass,pick this one up. It's a pulpflavored tale of hardbiuen vampire hunten employed by the Valican. 4ory Casciato casciato@mscd.edu
aunfedhiti j6/ hor alloweenplaylists By NleganCarneal mcarneal@mscd.edu It takes carefirl plarming for a HaJloween party-the perfect costume,just the right amount of dry ice for the punch, and shategically placed cobwebs for that oh-sascary a.mbience.And, o{ coti'-e, the all-important Halloween playlist to set the mood and get those rmdead feet dancing. Here are some suggestionsfrorn the siaff to lift those "spirib." Hck and choose and find the oerfect songsfor a spooky soundtrack. 1lrs llsll$illi65
- "Rockin'
in the Grave-
yaf,dtt
This is a surf-rock song out of hell cornplete with werewolf-like howls and fastpaced riffs sure to get those dead bones moving.
Nekrornantix - "flaunted Cat-house" Another great psychobilly song fi.rll of aliusions to classic horror movies and infamous ghosts.The bass line is smooth and melodious and the vocals are reminiscent of the Screamin' Iav Hawkins Halloween classic "I Put a Soell on You." David Byrne & Brial Eno - "TheJezebel Spirit" Creepy world music with "found" vocals of an actual exorcism. Guaranteed to get the skin crawling! - CC Enon - "The Nightrnare of Atornic Men" Chirpy synfh-pop on a collision coune with a planet peopled by hardcore noise fans, with a lyric that could be a plot summary for a classic '50s Bmovie. - CC.
Siouxsie & the Banshees - "Halloween" Siouxsie has an uncarmy ghosdike voice,, and bansheesare a t?e of phantom, so this is a great additon. Plus, the eerie new wave/ punk sound createsan ominous mood
High on Fire - "Devilution" No Halloween playlist is complete without a litde metal, and a nod to the Dark Lord himself. This track has both. - CC
TSOL - "Code Blue" The classic punk rock necrophilia anthem, Sinister Iyrics and sexual innuendos about why the dead are so much easier to love make this a perfect choice.
A classic oldschool jam takes the plot from the 1984 horror movie "Nighhnare on Elm Sneet' and flips it into a fiur Halloween dassic.- CH
DJ lazzy Jeff and the Fresh Prince t'Nightmare On My Streettt
Geto Boys - *Mind Playing Tricks on Me" The Geto Boys did a filre job of giving psychotic paranoia a home on wax. This track is a h:ip down the dark alleyr,raysof the ghetto - a sure scare. Ozzy Osbourne - 'rBark at the Moonto The classic werewolf anthem, a must-have for any Halloween mix. -SH Psychedelic Furs You" Ghost in the tide + ler's hauntins voice = ryrth-pop .ottt-ib,rtiotr rux.
r'Ghost in Richard ButAnother '8Os to the perfect
Warren Zevon - "Excitable Bov" Here we meet a boy, who, among other things, rapes and kills his prorn date. Then, 10 years after being released from "the home," he digs up her grave and builds a cage with her bones. Scary stuff, indeed. TD Tl Illustratiorr by llecan Carneal . mcarrreal@rnscd.cdu Bloodrock - "D.O.A." A song about a plane crash from a dying victim's point of view, with one of the most haunting melodies in rock history. Other contributorsto this precewere Add distorted guitars that sound like an Casciato(CC),Tin Dunbar (TD), ambulance siren and l)dcs zuch as, "Life is Cory Scott Hasbrouck(SH)and CeliaHerflowing out my body / Pain is flowing out (CI I) erra with my blood / the sheetsare red and moist where I'm lying / God in Heaven, teach me how to die,o for a tsuly chflling song. - TD
Bull-shoking funk ocouslic By Boyd Fletcher fletcha@mscd.edu It's not a busy Monday night off Colfax in the smoke-filled, low-ceilinged conffnes of Denver's oldest Gratefi:l Dead bar, Sancho's Broken Arrow, but there is a good crowd nonetheless. Bob Marley's "Could You Be Loved' blasf on the jukebox as the Angels beat the Yankees on the unwahhed TV. The bar slowly fills up with Monday-night regulars out for some good music and decendy priced booze. Chicago's 56 Hope Road rolled into Denver Monday, Oct. ll, bringing their highcnerry, super-tight acoustic-basedfunk to the cozy confines of the Broken Arrow. In a bar where the staff, drinkers and bands often look the same, it's hard to pick out just who is in the band and who is just off work and enjoying a cold pint' This, of course, only adds to the partyin-your-living room feel of seeing live music here-that is if your living room is a shrine to all things J"t l'. "We love it here," said drummer Greg
Frurdis of playing in Colorado. Taking the stage, the band immediately went into some high-energy acoustic boogie. With harmonized soulfi:I, Sublimeesque lFics; two aroustic guitarists embracing the chanky, percussive element of their instuments; and a buttery*mooth, frrll-sized standup bassthat brings a subde, yet punchy groove, the band's sound is well balanced. Unlike most bands that play in this bar, their inskuments sound clear and defined through the their P.A. system. 'It has a very percussive, pizzicato element to it " bass player Chad Sanders said of the band's sound. Sandershas been playing the standup sincearound 1996. Rounding out the sound is Fundis' snappy-tight drumming and Chris Corsale -['hoto bv Sophia Throop o stlroop@mscd.edtr adding the roar of a Fender elechic, without Dove Homiltonof 56 Hope Roodperformsot Soncho'sBrokenArrow on Oct. I 1. The overpowering the sound or the room. group's musicis describedos o "midwesternrootssound." Knowing each other's musical abilities and being well-rehearsed shows in 56's the band's roots go back to Mllikin College, be a hain wreck of guitar-winking proporsharp changes and organized jams. The tions or a perfect blend of rhlthm, percus- the small, private university in Decatur, Ill. tight rhythms and scru$, yet harmonized sion and melody, These guys deffnitely lean vocals accent the acoustic nature of the mutowards the latter. SeeHOPE on 17 sic. Three guitaxs on one stage can either Touring and perforrning full-time now,
'|IIE
\ I I l) lO FI l, l, lS. PA( 1E17
\,t l. t T RO t ' ( ) LI T \N . O C ' | OB ER2 i .2 0 0 3
. Jamminggoocltime HOPE Conl inuc d f' ro m l (i rvhere they originally met. The band came togetherfor one simple reason: tro make money selling merchandise. "We are actually t-shirt salesmen," Fundis said jokingly. "We startedmaking these great lshirts and thought 'How can we sell thesethings?We have to get them out to the people,' so we decided to starta band." Actually, thlngs fint came together in 1999when Fundis and Sanden, on a road trip west, stopped in Fort Collins where guitariss StephenGoveia and Dave Hamilton were living and writing music. "So, we played and itjust felt right so we were like. 'lets do this."' Fundis said."So we formed the band and moved to Chicago at the sametime that year." C.onale was playing in Chicago *'ith other projects. After playing with the guls from 56 Hooe Road a feu' times. he defectedto the band and has been playing wiih them ever since. In the studio and often on the road, the band isjoined by sa-xplayer Matt Cashman, percussionistMatt Kaufey, and his wife, Anne Hamilton Katzfey on vocals. This show, however feahrreda strippeddown 5ti Hope Road. "The thing about this group is that ii's a rotating collective of musicia:rs.There is a core group a.nd then you have backup vc three sax players,"Fun cals,percussionists, dis said.'All thesepeople really know our music. so it's not just 'oh I'll come and try and sit in with you guys tonight.'" Sars a hom section.the band's sound
changesfrom in-your-face,polver-hom firnk, to a very mellou', yet butt-shaking frnk groove infused with elements of rock, New Orleansjazz, dance and even Latin blended throughout. 56's influences are at times subdued, such as the band's name, which is a nod to the address of Bob Marley's Kingston studio. But they a.lsoaren't hesitantto pull bits from other songs,as when they ended their show r.r.itha quick vamp into a verse of I'hish's "Julius" out of their origina.ltune, "Carolina." The band even had the Birkenstor.kand Croc-footedcrowd dancing a con ga line betrv'eenbarstools and pool tables as they went into Harry Belafonte'sclassic callpso number, i]*p i. the Line." The band nlaved around the summer festival circui! in;luding the 10,000 Lakes Festivalin l{innesota. WakarusaMusic and Ca:nping Festivalin Kansas,and a feu' onedal festivals around their adopted hometo*n of Chicago. "Chicago gave us our star!" Gor.era said."Chicago is the reasonthat w'e can con tinue on - becauserve have a home baseto go back to." The band just released a live album. On,:ein our Lioes,with various tracks culled from three of the band's live sholvsor.'erthe Dast vear 5-ti Hope Road recently signed rlith Mountain High \{usic, a booking and promotions agency based out of Boulder, and already have plans to be back for a brief ski tour in December.with a oossiblethree nights back at Sancho's,or her sister club next door, Dulcinea's 100d'Monkey.
Doom is his characteristicallv odd self. ashe deftlv weaveshis lab)rinthine rh)rnes over the ice{rean-sweet beats laid down by Danger Mouse. The pop work ethic demorshated by Danger Mouse's production work on the Gorillaz Demon Day is evidencedhere in the form of the airy beal on the first track "F,l Chupa Nibre." The track "Sofa King" feahues a violin that careens tightly through the maze created by Doom's delivery. Danger Mouse provides a ligh! sometimescartoonish,counterpoint io Doom's earthy, grou'ly rhyrne spitting. Doom reliably provides what iongtirne fanshave cometo expectfrom him: rh).rnes that only follo*' his tu'isted intemal logic. I)anger l)oom For example, Doom is probably the only 7'ltatrIousaand thc lln.sk MC u'ho could spit: "Everybody talkin' 'bout pistols;gatsis borin' He cameuith a / iF)pitaphi\rla) new topic to flip you, vats of urine." Doom maintains a much lighter tone throughout B r- l ' rank l l otn er , , ihis a.lbum than on his earlier eflorts. On lrntat,f i'aG!nt.scd.etlu "Old School," he is even able to limit the ever serious Talib Kweli b rapping about cereal.The efiirsivefeelingof car brea.kfast NIF Doom could easily be considered the ultimate outsider of hip-hop. He plies toons is evident on every hack. A sense his trade under a metal mask and releases of innocence is purposefullv cultivated through the use of purely aesthetic,strategi albums devoted entirely to food. His mind placed censorbeeps. housesan entire roster of alter egos-from cally 'lhe one potentialweak spot on the al the man under the mask named Viktor is the appearanceof the Adult Swim bum Vaughn to King Geedorah, the threeHowever. their berw'eencast of characbers. headed denizen of Monster Island. Nou', to reinforce the lishthea-rthack skits serve with the assistanceof DJ Danger Mouse, ed feef of the album. \Vhile The.iousc and Doom flexeshis prodigiousmuscle on l/re Mouseand the fuIask,a tribute to Cartoon the Mask lacks some of the over thetop Nehvor-k'spopular Adult Snim series of prorvessof an unreshained MF Doom, it is still one of the best hiphop albums carrc()ns. the vear.
'.','f)emonstrations! ? a
303-ss6-4s89 SpnrurdBy: 5',rI C-'4 -B rt I
.
,..i. :':. t , ..t
4..-lt
,
Dr Hv: c
#-R"KS*ffi
PAGE18. SPORTS
. THE N'ETROPOLITAN OCTOBER27.2OO5
HeyStudent 0rgunizations!
BREAD GET SOME FROTUI THE CFC
Campus Villageat Auraria Live it "DENWR STWE"
re
M
ring... Featu . FullyFurnishedApartment . Parking . UrbanLiving
. IndividualLeases . FitnessCenter , laundryFacilities
InupttrVrLrnrr AT A.URARIA
. Caf6and ConvenienceStore
-,,:::"::1.tt";ilsrnd
w w wm . yow napart mâ&#x201A;Źnt . co m Tivctistud6ntunion,slite 124 30&5?3-c272
The Co-Curricular Funding Conmillee serves toossist ollreghtered sludenl orgonizolions withfunds forcompus events. forupto Regislered Student 0rgonizolions oreeligible yeot 53500eoch
MSCD hosovoriely ofestoblished ocodemic ondsociol sludenl getinfoonfteseorgunizulions ortheStudent orgonizolions.Io please Aoivities conlocl us:
. 303.55 Tivoli-30s 6.259r-hnp: mscd. edu denloclivilies. / / stu
lEt st -
f
'P.*-':
THE METROPOLITAN.OCTOBER27.20[/5
PAGE 19
Roodrunn SPORTS viclimize conferenc ground Metrosplit,loses opponenls 1-I Weekend Matt Gunn r Sports Editor o gunnma@mscd.edu.303-556-3424
setsmen back
Women shut out two more teams
By Keith Franklin cfranklT@mscd.edu The men's soccerteam dropped another garne over the weekend during a twogame home stand at Auraria field. The Roadrunners beat the University of ColoradoColorado Springs 3{ Friday, but lost to Colorado State Univenity-Pueblo ?l on Sunday. "We were very forhrnate to get those goals," head coach Ken Parsons said. "We had some opportrrnities to get some more, but we'll take the shutout." The loss brings &e 'Runners to a I2-*l record on the season.The team entered the weekend in the No. 3 spot for dre NCAA Dvision II Midwest Regional rankings, but the loss may force a change this week. "It was two defensive errors that cost us those goals," Parsorx said. 'This far into the season the team that makes the least amount of mistakesusually wins," There had been three teams tied for the No. 4 spot. Missing from the lineup on Sunday was Metro's star midfielder, heston Borrego. He went down with an injury following a rough tacHe during Friday's match. It was the third game Borrego has missed this season. Without him, Meto has won only one of the three games, This is the ffnal week of the regular season. The Roadrururers faced Regis University on Wednesday, OcL 26. In their previous meeting, Meho beat Regis 52. The final game of the seasonwill be in Dr-rrango,where the 'Rururers will square off with the No. 3 tearn in the nation, Fort Lewis College. The Skyhawks are nearly perfect on the year with a 1401 record. Fort lcwis will host the 2005 Rocky Mountain Athle[c Conference men's soccer charnpionships Nov. 4 and 6.
Bv Jeremy Johnson jjohn308@mscl.edu
Photo by\triilliam Nloore . moorwill@nscd.edu
MehoforwordShounElboumbottlesfor controlof thebollwithCU{olorodo Springs'MorcusReynoldson Fridoy,Oct. 2l during o 3-0 win ot Aurorio Field.
The Mebo women's soccer team swept yet another twGgame division road trip to improve to l1{ in the Rocky Mountain Athletic Conference. With the win over Mesa State College -to on Sunday, the Roadrunners improved 174 overall. Metro is rmdefeared in 4Oconsecutive games. The 'Runners began their weekend in Durango, where they defeated Fort kwis College (1G3.3,7+3 RMAC) for the second time this season.The 5{ win, paired with a 6{ blanking of Mesa State, gave Meto ib I3d shutout of the season. 'The team finished really well," metro head coach Danny Sanchezsaid. "They de fended well and got us a great result on the road." Senior captain and forward Amy hicl iter started the Roadrunnen ofr when she nailed her own rebound into the back of the net in the 24n minute of the game. Leichliter assisted frestman forward Anne Ormrod a minute later to make it a 2{ game. Ormrod scored goals in the 67s and 8Fd minute for her ffrst hat tick this year.Junior midffelder Kira Sharp assistedOrmrod's last goal. Jrmior forward Kylee Hanavan scored her 21"'goal of the seasonin the 56u rninute on a header off freshman defensive back Nicole Cito's assist 'Our success is obviouslv due to our coach," freshman midfielder Vanessa Mais said. "Bu! as a tearn, this year we have really come together and played for each other.' The 'Runners outshot the Skvhawks bv a 27-S margn and had a 90 advantage iir comer kic}s. Meto Faveled to Grand Junction on Sunday to take on Mesa State, where they defeated the Mavericls (414, 39 RMAC) 6{. Hanavan had three goals on the game for her third hat trick of the season. Hanavan's fint goal came quickly when she scored off Omrod's assistin the 4d minute in a one-on-oneshowdown. Orrnrod had two goals, with the ffrst of the day coming in.the 166 minute off a oenalw kick and the latter off an r-rnassis0ed bfiort i -itrnt" before the end of the first half. "We've kind of been stuggling, but I think we've been able to come together as a tean\' senior defensive back Stephanie Prouty said. 'Our defense wi$ awesome and our forwards came together.n "We've been seuggting with our forwards connecting passes," Prouty continued. "They probably had the best weekend so far." Meho traveled to Regis Univenity Wednesday for an RMAC showdown. A recap of the game will appear next week
Eorly BirdInvilolionol forswim leom ochollenge By JeremyJohnson fiohn308@nscd.edu
ming and diving coach Winthrop Dyer said. "It's good for (the team) because it opens their eyes and shows them where they need The Metro swimnrtulg and diving team to be." kicked off the seasonwith a pair of seventh Discouragement was not necessary as place ffnishes this weekend at Colorado both squads showed marked improvement State Unlversity's Early Bird lnvitational in fiom last year. The women scored 9l team Fort Collins. points compared to two the previous year. The 'Runners fared well considering; The men scored 145 points for an improveother than the Colorado School of Mines, ment of 97 points compared to last year's Meto was the only other Division II team invitational. to comDete at the invite. Junior swimmer Casey Story led the Division I schools Texas Christian Unimen's tearn in points, placing a team-high versity, Colorado State University, Univer7h in the l0Gyard breaststroke and also ffnsity of Wyoming Air Force Academy, Uniishing 14&in the 20Gyard breaststoke. versity of Colorado-Boulder and University Freshman Jake Haftrer ffnished in 156 of Denver, also competed. TCU took ffrst place or better in four different events, inplace in both rnen's ind women's competi- cluding an 116 place finish in the l0Gyard tion, with 1024.5ard 1152.5points respec- bacl$hoke. ti""ly. Jrmior Ryan Moseman also scored in "It s good for our learn to seewhat is out four difierent events for the Roadrunnen. there and see the competition," head swimFreslrnan IGrhy Lind anchored the
women's efiorts with a 12h place ffnish in the l0Gyard badsstroke, while juniorJessica Barrios followed suit with a 136 place finish in the l0Gyard bunerlly evenl The stongest showing for the men and the womm came in the relay evenb. The men's team ffnished in the too I I of ffve events, including an 8s place ffnish in both 20Gyard and 4(Dyard medley. 'fhe women's best relay was also in the 20Gyard medley, where they took 96 place. They also ffnished lOh in both the 20Gyard freestyle'and the 400yard freestyle. "The competition gave us a tue indication of how our current training is going and sets the direction for the upcoming weeks,' Dyer added. The Roadrunners face Air Force and Mines again, along with Univenity of Nebraska-Keamey and Colorado College this weekend. The event will be held Ocr 29 in FL Crlins and is being hosted by AIA.
'Runners roce RMAC
Hockey splits weekend wilh Lumberiocks
Men finish eighth, women take ninth
By Shaun Cook scoolc43@nLscd.r:du Meh:o club hockev solit another series last weekend, winning'big in game one, but falling short at the end of game two. Fridav. the Metro men blew out Nor*rem Arizona University 1,1-3,but dropped the second game 43 on Saturday. Coming in to the rematch, the Roadrunners showed the confidence and sawy that coach Greg Woods said was a hallmark of his young and talen0edsquad. This was highlighted Saturday night by the almost constant barrage they unleashed on the NAU goalie. "We're fast and young and incredibly talented," captain Chris Dufrrs said of the squad'seagemess,"but we have to get used to a firll game. This is a rebuilding year, and the guys we have are allying themselveswith
By Heather Em Lre-r' hembrq@rxcd.errtt The Meho cross counh:y team raced in its first Rocky Mor:ntain Athletic Conference championship in over 20 years last Sahrrday. The Roadrunner men earned a seventh place ffnish and the women came in nintll "To be competitive in the RMAC, ir our first seasonin over two decades,is pretty specialto both teams,"head coach Peter Julian said. "Finishing seventh and ninth, men and women respectively, isn't exacdy something to shout to High Heaven abou! but we can build upon back." The men's race began at 9 a.rn., and the ffrst runner ftnished at approximately 9:20 a.m. Mario Macias of Adams State College won, and all the runners fiom Adams state ffnlshed in the top 10. As a team, the Roadrunner men scored 196points. 'We did beat some established RMAC qr129(9 opponents, but the real goal is tp..c.p. for the conference title in the fuhre,"Julian said- 'Adarns State arrd Westem State have totally controlled this league for a long, Iong time. Our eves are on those teams." The firsi two runners to finish for Meho were Todd Tolentino, 19 and Brice Young,
!L
----!---
---i-l-l--
t
This acceptance was made obvious by Metro's "goal parade" Friday nighc "I almost felt a need to slow them down," Woods said about the l,l-3 blowout. Saturday night the NAU men cane out to save face. They showed this by scoring the only two goals of the first period. The 'Runners were scored on earlv in Metro answered ouicklv the second with a
Photo bv llatthew Jonas o ionasm@mscd.edu
n^
MetrocrosscountryrunnerMeogonMortinezsprintshcthefinishot Chotffeld ReserTolentino ffnlshed at 29:56, and Yormg voir duringtheRockyMounluinAthleticConference CrossCountryChompionships was right behind atD:57. OcI.22.Mortinezfinished24thoverollin the6k rocewitho timeo[ 26:22.The *Teamwork plays a huge role in the crosscounlD/teomfrooknin$ overollot thechompionship. individual aspect of cross cowrky, because Mehowomen's without a team you have no individuals," Tolentino said. 'Being a part of a tearn is comforting and knowing we are just going to get better is even more welcoming." Meho's women's tearn rallied 244 ooints and was a mere three poinb behind New Mexico Highlands University. Emily Mortensen of Adams State was ffrst ln the women's race, and the Grizdies took ffrst
-
The fint two nmners for the women wqre Meagan Madinez, 19, and Lisa Aquino, 18. Martinez was at 26:22 and Aquino was at %:22. Both women commented on the race itself, saying it was harder the ffrst rnile b* cause it was all uphill. Then it leveled out and they gained speed. "The course was frut," freshman Martinez said. "It was tough the first rnile because
there were a lot of hills and the rest of the cou$e was prefiy flaL The second and third mile it felt like it was long.' The Roadrunners' next race is the NCAA North Cenbal Regional on Saturdan Nov. 5 in F{ays,Kan. "Certainly everyone on the team pushed one another in workouts and races; but ofi the course is where we push one another the rnost " Tolentino said. "In the classroom
Luke
assist Arizona scored again at the end of the second, despite the endless offensive bombardment of the Roadnrnners. The score was 42 heading into the third. The 'Runners' opportuniues paid off with another lamming.Duftrs combo, but Mebo ultimately fell short Outshooting NAU b'y a drastic margin was not enough as time expired. During *re two gaJrres, the 'Rwmers showed their mettle and their ability to skate and score aror.rndanyone in their division. Woods said he is optimistic tha! as the season draws on, the younger members of the team will come together. With their obvious talen! this team will accomplish what his system has set out to do - win. They've won thus far and have hrmed some heads throughout the league with a solid 4-4 start Metro hockey will ffnish October in the Beehive Statewith a game against Utah Valley State College on OcL 28 and a game againstUtah State University on OcL 29. The Roadrunners reum to Colorado in the ffrst week of November for a homeand-home series against the Colorado State University Rams.
poirofwins Metro volleybull r00d triplunds By Jennifer Hankins jhankin4@mscd.edu Away from their home cout this past weekend, the women's volleyball team worked. hard to come up with a pair of victories. eThe two wins we had this weekend were huge for our team," junior Megan Wifrenbug said. "Our on-theroad play hasn't been the bes! and we knew that both teams were going to play well on thea home couris. We bariled well both nights and stayed together as a team." On Friday evening Oct 2l against Colorado School of Mines in Golden, Julie Green had l8 kills to lead Meto to a 2530, W27,32-n,3Gl8 victory. SheenaBohannon stole the show with a career-high 16 hlls and six blocks. For her
eflort over the weekend, Bohannon became the third Roadrurmer in 2005 to eam Rocky Mountain Athletic Conference Playerofthe Week honors. Stefanie Allison added 17 kills to Metro's attack, wbile Wittenburg got into the groove and tallied ll kills. Gabrieue Curtis had a great night at Volk G)rynnasiumwith 55 assists. Following Friday night's action, the women haveled back to Denver to face Re gis University. In the Sahrrday evening rnatch at Regis Field House, the Roadrunners' offerxive leader was Allison. With 13 kills and a .400 altack Dercentage. Allison led Metro o its secondvictory of the successfirlweekend. The 'Runners went away with scores of 31-D, 3G19, 3G27. Wiuenburg added
10kills and hit .529,while Greentallied l0 kills. Sheena Mclaugtrlin had a match-high 17 digs, while Kylie Schmeekle put away five blocks. The Roadrurmers hit .it4l in game two with 17 kills and just two enors. 'Runners With these wirs, the improve to lG6 overall, 12-3in the RMAC. They are No. 2 in both t}le conference and the Southwest Region. Metro hosts the nation's No. 1 tearn" the University of Nebraska-Kearney at 7 p.m. Friday, OcL 28, and plays Fort Hays State Universityat7 p.m. Saturday,OcL 29. "We have Keamey and Hap at home this coming weekend, so we need to be playing at our best levels to add two more wins to our record,' Witenburg said. "As a whole, our tearn is starting to play more consistent and together as one."
Nuggets Tickeh A group of Meho spots marketing students is selling [ckets to a Dec. 6 Nugets game, and are gaining experience while rai* ing money. Students in Clay Daughtrey's class are eaming their grades by plaruring and executing va.rioussport-related events. "We've divided into different groups and we're learning through real-world expe rience," senior Stephanie kouty said. For more info on the eveng contact Daughtey at (3O3)55G2114 or ai daughee@mscd.edu
SCOREBOARD 0ct.2l oilFort bwb
23 00
Meho FortLewis
5 0
2315.2, iletrq Gools: l. lldro,bidrliter, llonovon, 55:46.4, Melrq Omrod, 2{:17. 3,Llelro, Onrrd,66:18. 5,ltelrq()md,8l:53. Scves: l{elrqZdlner,3.bor*nrd,0. Forlleuis,Iu*, 9. 42
It4eho
6
44:ll.5,lle,lrc, Honown, 52:12. 6,[bn, Itnnvon, 54:26. Zdlner, 3.l-eonlnrd, l. Scves: ltelro, ileoStte.Woil<er,8.
Men's Soccer
04.21w.(K&mdoSginp
CUColorodoSpringsI O 0 O rO 3 3 Metro Gools: l. lletrqEboum, 54:ll.2,lilelrq 0rcn, 78:53. 59:43. 3,ilelq Ponos, McReovy, l. Soves: lthho, Hovose, 9. O{ohru&Sprinp, Oct23vs.tSt!ftnblo CSUfueblo
lll2
lO I
Meho Photo by Matthew Jqnas o jonasm@mscd-edu
lvieho Rugby flyholf Evon Swiecko'r,skiflghts off o bckle ogoinst Colorodo fthool of Mines on his woy to scoring ot JocksonField Oct. 23. Swieckowskiscoredone lry in lvlehos 44 v 17 win.
t
80hs0n, 2l:34.2,tlero, Gools: l, 6U-Puebl0, 0mil,8717.3, 6u-Pudb, lhilirel,88:01. Sores: [hro,lkleovy,0. 6U-hdb,Windrell,6.
perfeclion Metro Rugby ochieves
Volleyboll
()ct2l ot(olomdo $hd drtlines
Meao's larger goals. that slowed us down when we played down to their level.o "Undefeated is nice," McCorkle said, Metso played hard throughout the "but our bigger goal is the narional charn"Stop celebratlng and play,n Meho Rug' match, but was thrown off pace at times by pionship. It gves us a good base to know by Football Club head coach Gregg McMines' undisciplined play. The Orediggers' where our team is at and how we've pre Cortle shsuted at his tearn during its 4417 rressy play occasionally worked to their ad- gressed over the past tlrree years since I've victory over Colorado School of Mines. vantage. been coaching." uWhen we played to our potential we For the second consecutjve seasorL Metro's players echoed their coach's Metro RFC went a perfect 7{ and eamed played really grea! for l0 minutes at a sentimenL the top seed in next weelCsEastem Rockies time,n Walls said. ult's hard to keep *re "It's a work in progress because we're Rugby Football [Inion playoft. game clean when the other tearn's playing trying to build a program," Walls said. 'Ids "We're playing pre$ g"od a.ttimes," se. really sloppy." a work in progress and we're jr.rst going to nior oubide center Spencer Walls said, "but Wells scored a try and a pair of conver- keep gefiing better." the team we played was pretty sloppy and sions for Metro. Though it may not have been the ul6When Meho overcarne the careless mate goal, Meho eamed the No.l seed and Orediggers, the team looked sharp. Meto will play the weakest team in the upcoming out-musded Mines during scrums and ap ERRFU playoft. Meho plap Regis Univerproached lineoub like basketball players sity in the ffnt round. The Rangers upset willing to do anything for possessionof the Metro last year and went on to finish sixth ball. in the nafion. Meto's defense was on showcase early "Our plan is to go into Regis and make in the second half. After taking the ball to a statement to them tha.t we are the domiwithin a few feet of the end line, the Oredig- nant tearn," McCorHe said. "Regardless of gers were stilled by the defensive force what happened last year, we are the better of Meho. Mines tumed the ball over and team this year.' Meto took advantage, as playen worked If Metro advancespast the Rangers,they together !o score a try. eam the right to play for the ERRFU cham"We're all brothers out here" sophomore pionship. Their opponent will most ftkely be David Deagle said after the game. "It s just defending national champions, the Univerawesomerunning wi*r these gup." sity of Northem Colorado. Iafe in the game, Mines broke through "We can't let them psych us oul" Deafor a pair of bies. Mebo an^sweredby win- . gle said. "Obviously, they're national chamning a kickoff, and junior Evan Swieckowski pions, and that s going to be in the back of ran the ball to the end line to score a try as everyone's head, but we've just got to play time ran oul our garne and bring our garne out on the Seven Meho players scored Fies in the ffeld." game. Sophomore Adam Scmggs led widr The old qports dich6 "anything can hag Photo by llatthey Jonas o jonasm@mscd.edu two bies. Much of the scoring was balanced pen in the postseason," applies to Meho primarily among Metro's wings and cen- RFC. The playofls begin at noon Saurday, lv{etroRugbyweoksidefonker Brion tels. Oct 29 in Greetey. Compbellftghtsoff o tockleogoinst Deqpite their big victory over the Oredig"There's going to be ffreworla next Colorodofthool o[ Mineson hiswoy gers, nei&er the team nor coaches seemed wee\" McC,orHe said. ult should be the to theendlineot Jockson FieldOct.23. satisftedwith their performance. The und+ game of the year, as far as collegiate rugby Mehoircokfie win //lo 17. feated record is only a wrall step toward in Division tr goo."
By -\{att Gunn gtnnmn@mscd.edu
Meko Mines
25303230 30 27 3018
0cl.22otR4isUniversily lvletro Regis
31 3030 2 S1 9 2 7
lceHockey Oct14vs.t'lorthem Adzan Univenily NorlhernArizono /v1eho fuizono Octl 5vs.Norlfiem Universily NorthernArizono Metro
3 l4 4 3
Rugby ()ct.l4 rs.Cdoro& Sdmlol lrtines 17
Mines Meko
4
SCHEDIJLE llo. I Women'r Soccer n GU-Prnblo p.m. 0rt.28ottuarirFeld, 3:30 u. (oloro& Univenity Gfstion 0d.1ldfuufuFoU. noon llat'r Soccer n Fort Leutu 6llqs l:fl!p.m. 0c.28atDumgo, Yo|qtd vr 1lo.I Univer$ olllebrc*cKeonry .0d.28olfuoli! hrcrlterler,7p.m. vr todiloFSfote Univo$ily 0d.29olturofttv$l Crnl47p.m.
RuSv
(ERRIU n. REis Univerily Ploy0ffl noo ft.29 olGrehy, ilclroflqfsn Ull(Ttlesten $ae ilir 0d.30dGreela
. THE \IETROPOLIT\\ OCTOBER 27.2(X)5
PAGE22
CALEl\DAR ONGOING
- Mondays5:30-6:30pm & Thursdap I lam12pm. Iyengar Yoga - Tuesdays l0-10:55am. Nia (Nearomascrtlar Integratiae Action) Hatha Yoga- Tuesdays12-lpm,4-5pm& - A blend of dance, martial arts, tai chi 5-6pm. and yoga. Mondays & Wednesdays,llamGentleYoga- Wednesdays l2-lpm. 12pm & Tuesdays6-7pm in the St. Francis Yoga as Therapy - Wednesdaysl:15Atrium. 2:ISpm. - rhursdays, High Energy Yoga r0Mat Pilntes - Mondays 12-lpm, Tuesdays, l0:55am. 9-9:55am, Wednesdays 4-4:50pm & Thursdays 12-lpm in the St. Frarcis Atrium.
Meditation and Qigoag (Chinese Yoga) - Have fun learning simple flowing movements& deep breathing exerciseson T[esdays ll-ll:S5am & Thursdays 1-2pm the St. Francis Atrium. .in TU Chifor the Body and Mind - For all levelsmeet on Mondays 4-5pm & Tuesdays 1-2pm in the St. Francis Atrium. Unuind.! - Come join a relaxing half-hour of meditation and ulwind after your busy day on Thursdays 4-4:30pm in the St. Francis Atrium YogaPmgrams -Mats & props are provided. All sessionswill be held at the St. Francis Atrlum. Pleasewear comfortable clothing for the sessionslisted below For more information, pleasee-mail wilkinli@mscd. edu or call (303) 556-6954. Yoga Fbu - Intermediate - Mondays l2pm & Wednesdays5:15-6:l5pm;AII levels
Art-Abilitt at Auraria - For the entire month of October, this exhibit urill highlight the work of students, faculty and staff with disabilities. This artistic exhibit will be ongoing at the Tivoli Muldcultural Lounge unti the end of October. For more info, call (303)556-3210.
OCtObef
28,2OOs
Raw Materials -Jazz Duo Free Blood Prctsure Scteenings- Every Pianist, Vijay Iyer and alto saxophonist, Friday at the Health Center, Plaza 150 Rudresh Mahanthappa, represent a new from 2-4pm.
Free HIV and Tuberctrlosis(TB) Testing - Ongoingat the HealthCenterat Auraria. Call (303)s56-252s. Eatingfor Health and Energ -Pleasecall SusanKrems at (303) 770-8433or (303) for information. 556-6818
generation of American jazz musicians who explore ancient cultures through their music. The sons of Indian immigrants, they draw from Asian, African and European influences to create a unique and original fusion. Their performance will take place at 7:30 p.m. in the King Center Recital Hall.
Ocfober 30, 2(X)5
TobaccoCessationSuplort - The Health Centeroffersmany types of help to stop. Herbsfor Health and Hcaling Call (303)556-2525. AlcoholicsAnonpous Meetings- On the Auraria
campus! Tuesdays ll:45am-lpm
1020gth St. Park, #8. Call (303) 556-2525 for more information. Cancet SuPport Groups - Please contact Linda Wilkins-Pierce for details at (303) 556-6954.
October31, 2(X)5 Math Assessment Tfotoring Ses$on The Metro State Tutoring Center will have a free walk-in study sessionfor any Metro student who is preparing to take the Acuplacer Math Assessment.For more information, call the Tutoring Center at (303) 556-6439 or e-mail dunkere@mscd. edu.
November |, 2q)5 Natioe Anefican Heritagc Month: Caldn Standtng Bear Canyon Records recording a"rtist, flute flayer & historian of Lakota traditions, Calvin Standing Bear will give a free presentation that delves into Native American culture. This event will be held at the Multicultural Lounge at l1:30 a.m. For more information contact: the Institute at 303 556-8441
November2,2OO5
With the recent revival of botanica-l medicines and treatments,many questions Study Skills Workhop: Tips and Mcks regarding proper use are common. Come Science and Math learn about the ten most popular herbs for Part one of t}tisworkshop serieswill include for managing symptoms such as colds, a study skills assessmentand analysis of immune deficiency, insomnia, depression, the assessment.For more information or PMS and hot flashes. The event will be to RSVP please contact the Metro State held in South Classroom231 at l:00 p.m. Tirtoring Center at 303-556-6439or email For more information, contact Linda at dunkere@mscd.edu.The event will start rvilkinli@mscd.edu. at I p.m. in Tivoli 219.
. OCTOBER2?.2005 THE I'{ETROPOLITAN
PAGE23
CLASSIT'IED €lossified Info
Trainingprovided.Age BOOK NOW AVAILI\BLE: necessary. AVID THE COLLEGE xt 215. WHYI'M GLAD IHAD BREAST PreparatoryProgramin the Cherry 18+okay.(800)965-6520 12lr CANCER,by LeonoreH. Dvorkin, Creek School District is seeking Phone:(303)556-2507 campus author. Wildside Press, tutors to facilitate middle and Far (303)556-342r 2005. "An amazing and beautiful high schoollearninggroups.Must For Rent In person:Tivoli #313 Details, excerpts: www. story.' become a district employee.Pays Advertisingvia Internet: l2ll lrttp:/ / themet.c0llegeeIassifieds.con $10.00per hour.Variousschedules WASHINGTON PARK . 2 dvorkin.com available. For information call Bedroom,3 blockswalk to Light Classiftedads are 150 per word Kathy Vining at (720)554-4527. Rail. (720)570-3682. IU3 FREE I-ON-I SPANISH for students currently enrolled Class in Guatemala& homestay 3/30 at Metropolitan State College of for I week! Msit conexionxela. For Sqle Denver. For all others 300 per COLORADO r0127 com/ad.htm HUMANE word.Maximumlengthfor classified Societyneeds volunteers!CHS 6(SULLEY' FROM BE word ads is 50 words.Pre-payment needs volunteers to walkdogs,play Monsters,Inc. for Halloween.Full required. Cash, check, money with cats,actasfosterparents,and furry body suit for 5'f-5'11" adult. order, VISA, and MasterCaid are assist in the clinic.call (72Q23a- Completewith a child'ssocksewn accepted.The deadlinefor classified 5537. r0127to his back.$40 or bestoffer.Call ad placementis Spm on Thursday 10127 (303)523-3428. prior to the week of publication. ENLTSTMENT $10,000 Classified adsmaybeplacedvia fax, Bonus for speakers of Middle Announcemenls in personor online at hfip://tlurut. The deadline EasternLanguages.The Army has collegulassifieds.com. for placingclassifiedadsvia online immediate positionsavailablefor WWW.NOGODBLOG.COM El (aauc/ ordering is 3pm Friday for the qualified candidatesbetween the 1V10 following week.For information on agesof 17-40.For detailsvisit your classifieddisplayadvertisingwhich local Army Career Counselor of CAPITALISM HAS An Army of are ads that contain more than Call (720) 904-2174. r2lr become the most dangerous 40 words or contain larger type, One. ideology of our time. (www. borders,or artwork,call (303)55610127 parecon.org) RESIDENT DIRECTOR 2507. The Regency: Auraria's Student 3825 Tennyson.(303) 447-1633 Housing Community is seeking Help Wonted a Resident Director. Previous FLEXIBLE HOURS & director experienceis required. Casual Work Environment!!! For completejob descriptionvisit Work when you want, wear www.regencystudenthousing.com r0127 what you want, say what you want, and make as much as you want? We're an ONLINE sales AFTER.SCHOOL NANNY companyand we needsalesstaff... Needed;3:00-6:00Mon-Fri; 2 No cold calls, No dealing with girls agesB & 6. Apply at www customers! If interested e-mail nannyconnectionusa.comor (303) r0127 resume and,/or work experience 337-4772. with contact information to herb@federalsurplus.net. LV3 IBARTENDERS WANTED! . lgloeetohorneGlwortt $250/dayPotential.No experience . EvenlngandSaturday -. '. .a .,,.: gDun'ea . Freeparking the r Gornprrtertabs . Variety of nenr couases arraitabte 'Watch Metrots Only . Tele-courees Video Newscast on . Correspondencecourses
COLLEGE NIGHT Er0,"aftr/ E/ ,fllo"e/
at67n l/r/,ro,,r/a7* ELITCHLANES
Plcnnlng ycur fprlng rhedule?
fuT:i:il,*"u,h,
comcast channel 54 Watcb the Met Report rl€ht IIOWI l!
www.metreport.corl gtr€a.mlng Video On Demerdl
Call for moreinformation anda free springschedule http://www.mscd.edu/^,options
=i= $:=:,g*
,=-.'
fiction non-fiction essay short story fantasy sciencefiction
regionalism mysticalrealism Poetry
painting drawing photograph digitalart Published in Metrosphere 200S Pl197287 by Hans Hallgren
Applicanamaysendsubmissions to the MetrosphereEditorat breuer@mscd.edu or to MSCD Officeof StudentMedia,Tivoli 313.Submissions mustbe emailedasaWord attachment.There is a limit of 3.500words. per student. Maximumof five submissions
Contactthe Editor: 303.556.3940 breuer@mscd.edu