September 2024 Lee Family News

Page 1


ClearwaterBeach:Perfectfamily getawayjustashortdriveaway

ForSouthwestFloridaparentslooking fortheperfectfamilygetawaywithout thehassleofalongjourney,Clearwater Beachisagemjustacoupleofhoursup thecoast.Withitssoftwhitesandsand shimmeringGulfwaters,thispopular destinationofferseverythingyouneed foramemorablefamilyvacation,blendingrelaxationandadventureinaway fewplacescanmatch.

OneofthehighlightsofClearwater Beachisthevarietyofactivitiesavailableforfamilieswithinwalkingdistancesofsomanyhotels.Onarecent tripwithmyfamily,wechoseourhome awayfromhomeattheACHotelsby Marriott.Thisstylish,modernhotelis juststepsawayfromthebeach,making iteasytodropyourbagsanddive straightintovacationmode.TheAC HotelscombineEuropean-inspired designwithalltheamenitiesfamilies need,offeringacomfortablebasefor exploringeverythingClearwaterhasto offeratareasonableprice.

Boattoursareafantasticwayto experiencethebeautyofClearwater’s coastline,withoptionsthatcaterto everyinterest.Whetheryou’rekeento spotdolphinsinthewild,enjoya romanticsunsetcruise,ortakeaneducationaleco-tourthatwillfascinateboth kidsandadults,IfoundthatTropicBoat Toursprovidesanunforgettablewayto seetheareafromthewater.Theyguar-

anteeddolphinsightingsandboy weretheynotlying!Wesawso manydolphinsintheirnaturalsetting-itwastrulymemorable.

Ofcourse,notriptoClearwater wouldbecompletewithoutvisiting theClearwaterMarineAquarium. Thisisn’tyourtypicalaquarium;it’s aworkingmarinerescuecenter, hometotheworld-famousWinter theDolphin,starofthe"Dolphin Tale"movies.Winter’sstoryof resilienceandhopeisinspiringfor allages,andtheaquariumoffersa hands-on,educationalexperience thatbringsyoufacetofacewith seaturtles,otters,andotherrescuedmarineanimals.It’savisit thatnotonlyentertainsbutalso educates,makingitamust-dofor families.

Asthedaywindsdown,make planstovisitPier60,wherethe dailysunsetcelebrationisa ClearwaterBeachtradition.This family-friendlyeventincludesstreet performers,localartisans,andlive music,allsetagainstthebackdropof astunningGulfCoastsunset.Thepier itselfisagreatspotforfishing,orsimply strollingwithanicecreamconeasyou watchthesundipbelowthehorizon.It’s anatmospherethatcapturesthelaidback,communityspiritofClearwater Beach,andit’stheperfectwaytowrap uptheday.

DininginClearwaterisanothertreat, especiallyifyouenjoyfreshseafood withaview.Onelocalfavoritewereally enjoyedisPalmPavilionBeachsideGrill &Bar.Itofferscasual,beachsidedining withamenuthatincludeseverything fromfreshcatchsandwichestoclassic burgersandfries,ensuringthere’ssomethingforeveryone.Therelaxedatmospherewithlivemusicandfriendlyservicemakethesespotidealforafun,familymealafteradayspentexploringthe beachandbeyond.

ClearwaterBeach’scharmliesinits abilitytooffersomethingforeveryone. So,ifyou’redreamingofafamilyvacationthatcombinesthebestofFlorida’s naturalbeautywithahostoffun,familyfriendlyactivities,looknofurtherthan ClearwaterBeach.Packyourbags,load upthecar,andheadupthecoastfora fewdaysofsun,sea,andunforgettable memories.

MandyMichelleCarter...Justa SWFLmomlivingthedream.Sheloves toinspireparentstospendauthentic timewithyourkidsandtochaseyour owndreamsunapologetically!Foundon Instagram@mandymcarterandherfamilyblogatAcupful.com.

Boattoursareafantasticwaytoexperiencethe beautyofClearwaterʼscoastline,withoptions thatcatertoeveryinterest.

RegistrationopenforLakesPark FallFestivalScarecrowsinthePark

TheLakesPark EnrichmentFoundation andLeeCountyParks& Recreationinvitebusinesses,non-profits, groupsandorganizationstosponsora “ScarecrowinthePark.” Entrieswillbeexhibited Oct.11throughOct. 31intheChildren’s GardenatLakesPark, 7330GladiolusDrive, FortMyers,andwillbe apartoftheLakesParkFallFestival.

Thethemeofthe2024competitionis “TheGreatOutdoors.”Designyoursingle standingscarecrowtodepictthegreat outdoorsfordisplaytothe50,000visitors thatenjoythisfamily-friendlyfestival. Examplesofscarecrowsforthisyear’s themeincludeananimal,jogger,camper, tree,lumberjackorfisherman.Thepossibilitiesareendless.Yourbusiness,family ororganization’snamewillbeondisplay showingyoursupportofLakesParkand thecommunityofLeeCounty.

Youthandschool groupsareneededfor thosebusinessesthat sponsorbutdonot wishtodesignand buildtheirownscarecrow.Youthgroups receive$50forsupplies.Scarecrowswill beondisplayinthe Children’sGardenwith awardspresentedto theVIPandPeople’s Choicewinners.

TheLakesParkEnrichmentFoundation hasorganizedthiseventforthelast14 yearsaspartoftheLakesParkFall Festival.Activitiesincludeapumpkin patch,hayrides,inflatables,andconcessionspresentedbyWheelFunRental,as wellastheHalloweenExpresstrainride presentedbytheSouthwestFloridaTrain Museum.

ThedeadlineforregistrationisSept. 29.Formoreinformationvisit www.LakesPark.orgoremailscarecrows@lakespark.org.

Leesummerreading programsuccessful

LeeCountyLibrarySystem’s2024 SummerReadingProgramputthousands ofbooksintothehandsofchildrenand teensandsawoutstandingparticipation byallagegroups.

Theannualprogramservestofoster theloveofreadingandhelpprevent summerlearninglossbystudentson schoolbreak.Insupportofthegoal,the librarysystemdistributedmorethan 13,000freebookstochildrenandteens throughoutLeeCounty.

Thisyear’snationalSummerReading Programtheme,called“Adventure BeginsinYourLibrary,”encouraged everyonetogetoutandbeactivein theirlocallibrarybranchesandcommunity.Atotalof3,709participantsjoined theall-agesreadingchallengeand loggedmorethan17,000booksand 827,270minutesread.Additionally,the AdventureBucketListactivityengaged morethan8,000peopleinfuntasksand reading.

Libraryprogramstakeplaceallyear longandarealwaysfreeandopentothe public.Formoreinfo,visitwww.leelibrary.netorcall239-479-4636.

FALL CLASSES

&OTHER GREAT OPTIONSFOR KIDS

ArtsBonitaDanceAcademy

FallclassesstartAug.26.Wewelcomekidsages2,5 anduptotheArtsBonitaDanceAcademyfeaturing classesinBallet,Tap,Jazz,Lyrical,andmore!Jointoday andexperienceaworldwheredreamscometrue, friendshipsflourish,andself-confidencesoars.Whether you’reabuddingballerina,arhythmictapper,orajazz enthusiast,ourclassesaredesignedtosuitdancersofall levels,frombeginnerstoadvanced.Signuponline today,orcalltheofficetotakeadvantageofourmultipleclassdiscounts.Registeronlineorcall.

PerformingArtsCenter 10150BonitaBeachRoad,BonitaSprings 239-495-8989 www.ArtCenterBonita.org

CalusaNatureCenter &Planetarium

Homeschool-ologyandpreschoolprogramsinclude funmonthlythemes,hands-onactivities,outdoorexploration,andliveanimalencounters.NatureExplorersisa monthlydropoffprogramforchildren5to11thatruns from9to11amonselectSaturdays.Saturday,Sept.7is BeesandHoney!Forhomeschoolers:NatureArtisset forSept.5andNatureJournalingwillbeSept.19at CalusaNatureCenter.Forthemes,times,prices,andto register,visitcalusanature.org.Becomeamemberand receiveadiscountontheseprograms!Youareinvited tojoinusSept21&Sep2210amto4pm-Friendly ForestFallFestivalforafundayofFallFestivities,Crafts, Games,Pumpkins,FoodTrucks&More! 3450OrtizAve.,FortMyers www.calusanature.org 239-275-3435

CapeCoralRowingClub

ComejoinusforourseasonkickoffeventonSaturday, Oct.19at7:30a.m.Neverrowedbefore?Noproblem. Youthcrewhostsa2-weektrialperiodatthestartof everyseasontoallownewrowerstolearntheropesand practicewiththeteamseveraltimestodeterminewhether rowingisagoodfit.Don'tmissoutonthisopportunity totrysomethingnewandamazing.Twoweektrialperiod withpracticesessionsonTue/W/Th/Sat(Tue10/22& 10/29)4-6pm,(Wed10/23&10/30)4-6pm,(Thu 10/24&10/31)4-6pm,(Sat10/26&11/2)7:30–10 am.Bringwater&wearathleticattire.Newrowerswelcome.Noexperiencerequired.Coxswaincandidates needed!ContactCoachSaundraWestonformoreinformation.hscoach@rowccrc.org www.rowccrc.org 330-495-2364

CoastEliteGymnastics

Readytogetyourkidsmovingwhilehavingfun?Put CoastEliteonyourbacktoschoolschedule.Our12,000 squarefoot,air-conditionedfacilityisfullyequippedwith stateoftheartgymnasticsapparatus.Highlightsinclude in-groundfoamblockandResilandingpits,30ft.TumbleTracktrainingtrampolineand18’climbingropes.We offerpreschool,recreational,andwomen'scompetitive gymnastics.Also,offeringcheer-basedclasses(tumbling andcheerbasicsfor5-17yearoldsandboysclasses. CheckoutourFridaynightOpengym&weekdaymorningToddleropengym+ourNinjabasedclasses!Coast Eliteisagreatafterschoolactivityforkidsofallagesand helpsstrengthandcoordinationwithanysport! 6360ArcWay#1B,FortMyers 239-936-8467 www.coastelite.com

FMTwirlersBatonLessons

BatonlessonsinLeeCounty.Comeoutandtwirlwith us.Twirlingisgoodforallage!textformoredetails: 239-747-3760ORemailFMtwirlers@myyahoo.com

FallFashionSewingClasses

FashionFirstWorkshopsoffersClassesforKids&Teens interestedinFashionDesign(Ages7&Up).Classesare offeredSept.9–Oct11.Learnhowtodesignclothes, UseaSewingMachine&havefun!Classesstartafterschoolfrom3:45-7:00forschoolagechildren.Locations includeBellTowerShopsonMondaysandWednesdays, AlliancefortheArts(Sept.12)&LakeKennedy(Tuesdays, Sept.10-24).Homeschoolclassesarealsooffered. renee@fashionfirstworkshops.com FashionFirstWorkshopsDesignStudio 13499S.ClevelandAve#181 908-578-8561 www.fashionfirstworkshops.com 10-September2024

FortMyersTennis

Discoveraskillforlifewithour#TennisFam atFortMyersTennis.Weareacommunityof dedicatedparents,coaches,players&friends, amongwhomyoucanbesureyourchildwill learntolovethegameoftennis!Nowoffering Fallclassesforchildrenaged3+!Signup online,forquestionscontactusviaemailat fortmyerstennis@gmail.comorcallus.Seeyou onthecourts!

www.fortmyerstennis.com239-653-7773

IvybrookAcademy

Explorethehalf-dayprogramatIvybrook AcademythatblendstheMontessoriandReggio Emiliaphilosophies,tofostercreativityandcollaboration.TheDiscoveryProgramatIvybrookoffers classesinmusicandmovement,foreignlanguage, creativeexpression,andthelibrary.TheDiscovery teacherworkswitheachclassroomtoexploreall formsofcreativeexpressioninthemini-artstudiosor ourlarge,centralartstudio.Scheduleatourto experiencetheIvybrookdifference.Visitourwebsite orcalltosecureyourchild’sspot. 21300SouthBranchBoulevard, Suite611,Estero 239-893-6538 www.ivybrookacademy.com/estero

SouthernStarz

JumpintothenewSchoolYearatSouthernStarz Gymnastics.OurLittleStarzgymnasticsprogramis gearedtowardgymnasts1-5years.TheseStarzwill focusonbeginninggymnasticsskillswhilehaving funinour11,000squarefootfacility.Weoffer gymnasticclasses,tumblingclasses,boys gymnasticsandcompetitivegymnastics.

915SE11thPlace,CapeCoral 239-574-0034

www.southernstarzgymnastics.org

YMCA

AfterschoolprogramsattheYkeepkidssafe, introducethemtonewfriendsandactivitiesand arefocusedonsafety,health,socialgrowthand academicenrichment.Childrenareplacedin age-appropriategroupsandtakepartinadaily rotationofactivitiesthatincludehomeworktime, arts&crafts,guestspeakers,enrichment programs/specialtyclubs,physicalfitnessactivities, learningcentersandmuchmore.TheYalso providesanutritiousdailysnack.

27200KentRoad,BonitaSprings 239-221-7560•www.ymcaswfl.org 1360RoyalPalmSquareBlvd.,FortMyers 239-275-9622•www.ymcaswfl.org

SizzleDiningoffersspecial pricing at116restaurants

SouthwestFloridaresidentsandvisitorsareinvitedtodinewithapurpose duringtheregion’sbiggestculinary eventoftheyear,SizzleDining.

SetforSept.5-Sept.25,arecordbreaking116restaurantsinLee,Collier andCharlottecountiesareservingspeciallypricedprix-fixemenusincluding two-courselunchesfor$19or$29,and three-coursedinnersstartingat$29, $39or$49.Newthisyear,Sizzle Diningisintroducingapop-upbrunch serieseachSaturdayandSundayduring thethree-week-longevent,foratotalof sixeventsatsixdifferentrestaurants acrossSouthwestFlorida.Forafulllist ofSizzleDiningrestaurantsandtheir menus,visitSizzleDining.com.

Onedollarfromeachmealpurchased fromtheSizzleDiningmenuwillbe donatedtotheSouthwestFloridaChapter ofBlessingsinaBackpack.Onedollarat atime,morethan$90,000hasbeen raisedthankstolocaldinerswhoparticipatedinSizzleDining.Blessingsina Backpackusesthedollarsraisedtofill backpackswithfoodforlocalfood-insecureelementaryschoolstudentstoeat overtheweekendwhenschoolprovided mealsareunavailable.Overthepast threeyears,SizzleDininghashelped morethan700localchildrenbyensuring 25,000hunger-freeweekends.

Inadditiontomakingadifferencein thelivesofhundredsoflocalchildren, SizzleDiningcomesatatimewhenthe localculinaryindustryneedsthesupport ofthecommunity.

“Septemberistraditionallytheslowest

monthoftheyearfortherestaurant industryinSouthwestFlorida,offeringan opportunetimeforpatronstoexperience SouthwestFlorida’svibrantculinaryscene withspecialpricingandwithoutlong waittimes,”saidGuyClarke,founderof SizzleDining.“Newthisyear,weare excitedtoofferabrunchserieson SaturdaysandSundaysatparticipating restaurantsandtowelcome39new restaurantstotheSizzleDininglineup. FromMarcoIsland,throughoutCollier andLeeCountiesextendingintoBoca Grande,weareexcitedtoofferthe biggestSizzleDiningexperienceyet.”

SizzleDiningbeganin2016,asa week-longdiningeventinNaples.Year afteryear,ithasgrownsubstantially thankstothecommitmentoflocalrestauranteursandSizzle’sfounders,Guyand ErinClarke.Eachyear,participatinglocal

restaurantscreatemouth-wateringprixfixelunchanddinnermenusthathighlight theirchef’simpressiveculinaryskills.The menusareofferedataffordablepricesto encouragevisitorstotryavarietyoflocal restaurants.Thiseventhelpsdrumupbusinessforourlocaldiningsceneduringone oftheslowestmonthsoftheyearin SouthwestFlorida.Ontopofthemuchneededboosttoourlocalculinaryindustry,SizzleDininggivesbacktothecommunityinanevenmoreimpactfulway.

Foreverymealpurchased,restaurant ownersdonate$1oftheirproceedsto BlessingsinaBackpackofSouthwest Florida,anincredibleorganizationthat helpsfeedourlocalelementaryschool childrenovertheweekends.

Formoreinformationandthefulllist ofparticipatingrestaurants,visitonlineat www.sizzledining.com

TrendingBookstoGoogle

Publisher’s top picks

See You Later, Alligator

A silly story with bright, engaging illustrations and expressive, rhyming text that children will want to read-and giggle throughagain and again.

Don’t Wash Winston

We’ve all been there... A bit of a spill, an overenthusiastic leap, one mud pie too many, and OH NO! our beloved stuffed animal friend suddenly has to be (gulp) WASHED! When Winston, Liam’s favorite teddy bear, gets muddy, Dad decides that Winston needs to be washed. But the washing machine is big and loud and scary!

I am Stuck

A tender (and humorous!) look at the way tough emotions can make us feel stuck, and how the presence of a good friend—and a deep belly laugh-can make it easier to get through stormy feelings.

The Bee Who Lost Her Buzz

Little Bee isn't being kind and sharing the pollen with her friends. Join her on a journey where she learns it's better to be kind and share.

Practice, Patience and Focus: Playing the maze puzzle ball requires careful observation and thinking. It could help you build genius skills including the ability to problem solve, imagination, creative thinking and more!

Amaze 3D Memory Sequential Maze Ball www.amazon.com

GIDGETS, GADGETS AND GIZMOS!!

Challenge your brain by remembering the light sequence and following along for as long as you can without breaking the pattern. Sound easy? Not so fast! Take the challenge and see why Brainbolt is an addicting puzzle game to play until you win!

BrainBolt Handheld Electronic Memory Game www.amazon.com

Craft Fluffy White Snow Anytime: A fun STEM activity for little scientists who like fast results, Insta-Snow transforms into a magical mound of snow 100 times its original size within seconds.

Insta-Snow Powder www.amazon.com

Simply press a button, and the ETENWOLF ball pump automatically inflates each ball to the desired pressure in just 1 minute! This ball pump can not only inflate, but also deflate to save space while travelling or just soften the ball.

Electric Ball Pump www.amazon.com

This handheld sound and light button press toy has different levels to match age-appropriate playing. Press correctly the bubbles in rhythm, exercising hand eye coordination, memory and logical thinking skills.

Pop Quick Push Game

www.amazon.com

Create beautiful crystals for 4 hedgehogs and bring them into life! Let your child feel like a real chemist watching the crystal grow in 72 hours. Chemistry has never been so fun and colorful! Growing kit is for kids ages 8-12.

Crystal Growing Kit

www.amazon.com

This children's microscope, designed for little scientists, offers the convenience of multiple magnification settings ranges. Whether they are fascinated by the intricate patterns on insect wings, plant cells, or the beauty of mineral crystals, this microscope provides them with an excellent tool for preliminary scientific exploration.

Miniscope Portable Microscope

Enjoy the new twist on the classic potato game, but instead of sitting out when the dance music stops, the Wacky Ball surprises you with one of 36 funny, random challenges.

Wacky

Pass www.amazon.com

This Kick The Can Ignited Game Kit offers endless fun with an electrifying twist on classic game play. Just flip the switch and ignite the fun!

Retro Glow-in-The-Dark Kick The Can Game www.amazon.com

Ongoing

FREE Kids Crafts

Miromar Outlets

10801 Corkscrew Rd, Estero Tuesdays • 10 a.m. to 11 a.m.

Near the WINK Playland. 239-948-3766

Saturday Storytime

Barnes & Noble - Coconut Point

8052 Mediterranean Drive, Estero Saturdays • noon 239-427-1799

Sun - 1

Young Eagles Rally & Pancake Breakfast

EAA Chapter 66 House at Page Field

5200 Captain Channing Page Dr., Fort Myers

Sunday, September 1 • 8 a.m.

The Young Eagles program is designed to teach youth, ages 11-17 about general aviation. The Young Eagles first flight program is free of charge. The minimum age to fly is 11 years old. A parent or legal guardian must be present to sign the waiver and be on-site during flight. Kids younger than 11 may participate in the instruction class and walk around the aircraft but they cannot fly. A breakfast is also available for $6 per person. Questions, email youngeagles66@gmail.com.

Free tickets to the Mighty Mussel’s game

Hammond Stadium

14100 Six Mile Cypress Parkway, Fort Myers

Sunday, September 1 • 12:05 p.m.

All kid's 12 & under get free tickets available at box office only. Ages 12 & Under. All kids can play catch on the field prior to each Sunday home game from 11-11:30 a.m. and run the bases after the game. Mighty Mussels vs Clearwater Threshers. www.milb.com

September

Things to do

Tue - 3

Kindness Club

Bonita Springs Public Library

10560 Reynolds Street, Bonita Springs

Tuesday, September 3 • 5 p.m.

Join us at the library to create kindness in our community. Kids can participate in fun activities designed to encourage kindness and help make the world a better place. Please dress for a mess. For ages 5-11 years. Registration is required. 239-479-4636

Center Stage Fun and Games

Northwest Regional Library

519 Chiquita Blvd. N., Cape Coral

Tuesday, September 3 • 5:30 p.m.

Tuesdays mean later hours at the Northwest library. Come join us centerstage to enjoy games, chess, puzzles and more. 239-479-4636

Baby and Toddler Storytime

East County Regional Library

881 Gunnery Road, Lehigh Acres

Tuesday, September 3, 10 • 10:30 a.m.

For children through age 36 months and caregivers. Wiggle and giggle with your littles during this interactive storytime that uses stories, music, movement, and rhymes to support early literacy skills. Each program offers helpful strategies to continue encouraging language and motor skill development at home. 239-479-4636

Build-It: Racing Day Vehicles

East County Regional Library

881 Gunnery Road, Lehigh Acres

Tuesday, September 3 • 3 p.m.

Use your imagination to build amazing things. Join our new Build-It series, where we challenge you to use our engineering toys to create a 3D structure inspired by a monthly theme. For September, we're challenging our builders to create a racing vehicle. Finished builds will be put on display until next month's Build-It event. This program is intended for children ages 5-11 years. 239-479-4636

Books and Blankets

North Fort Myers Public Library

2001 N. Tamiami Trail NE, N. Fort Myers

Tuesday, September 3 • 6 p.m.

Join us with your blankies and pajamas for this nighttime edition of storytime. Your whole family is invited to this enjoyable, all-ages storytime that encourages the development of pre-reading skills through songs, rhymes, fingerplays and stories. 239-479-4636

Wed - 4

Library Teen Talk

East County Regional Library

881 Gunnery Road, Lehigh Acres

Wednesday, September 4, 11, 18, 25 • 2 p.m.

High school teens are invited to the library for a weekly discussion about current events, everyday life, library resources and more. Teens will be encouraged to post an answer to a weekly question while socializing and making new friends. 239-479-4636

Thu - 5

Chess (teen)

Bonita Springs Public Library

10560 Reynolds Street, Bonita Springs

Thursday, September 5, 19 • 2 p.m.

Sharpen your mind by playing a competitive game of chess. We supply the board and all we ask you to bring is your skills. This program is for adults and teens. 239-479-4636

Teens Create

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral

Thursday, September 5 • 4 p.m.

Get those creative juices flowing with a new project each month. This month, we will unleash our creativity by diving into the mesmerizing world of pour painting. No registration required. All supplies and snacks are provided while they last. This program is intended for ages 11-18 years to attend independently. Please speak with staff if caregiver assistance is needed. 239-479-4636

Spanish Time for Kids

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Thursday, September 5, 19 • 4:30 p.m.

For children ages 6-11 years. Learn how to speak basic Spanish through games, projects, songs & more. New vocabulary will be introduced through crafts & games with an additional activity to take home. 239-479-4636

Teen Thursday: Teen Advisory Group (TAG)

East County Regional Library

881 Gunnery Road, Lehigh Acres

Thursday, September 5 • 2 p.m.

Be a part of the East County Regional Library's Teen Advisory Group (TAG) and help make your library's teen area the place to be. TAG members assist with program planning, suggest book titles, and help create displays in the teen area. Service-learning hours and light snacks will be provided. For teens, ages 12-17 years. 239-479-4636

Fri - 6

Puzzles, Puzzles and More Puzzles

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Friday, September 6 • 10:30 a.m.

Join us for a morning of giggles, learning and the joy of discovery. Let's sow the seeds of curiosity and set our little ones on a path of early learning adventures with our huge floor puzzles. For ages 2-5 years. 239-479-4636

Things to do

Beach and Estuary Walk

Lovers Key State Park

8700 Estero Blvd, Fort Myers Beach

Friday, September 6 •10 a.m.

Join a park ranger for a leisurely hike along the beach and estuary shorelines of Lovers Key. Discover the natural beauty of both ecosystems as you encounter the seashells, crustaceans, birds, and other creatures that reside amongst these waterways. Space is limited; reservations are required. Program is free with paid park entry. To register, visit https://bit.ly/FOLKS-Events.

Sat - 7

Be Red Cross Ready (teen) East County Regional Library

881 Gunnery Road, Lehigh Acres

Saturday, September 7 • 1 p.m.

The American Red Cross will present this course designed to teach people how to prepare for and respond appropriately to disasters likely to occur in their community such as hurricanes, wildfires, tornadoes and more. Registration is required. 239-479-4636

Super Fun Saturday

Northwest Regional Library

519 Chiquita Blvd. N., Cape Coral

Saturday, September 7 • 10 a.m.

Come play with us at the library. Activities change monthly and vary from dancing, storytelling, art projects and more. Fun for the whole family. 239-479-4636

In-Store Kids Workshops: Field Goal Game

Home Depot - Local Home Depot locations

Saturday, September 7 • 9 a.m. to noon Time to pull out your apron! First Saturday of every month for this fun, free event. www.homedepot.com/c/kids

Kids Fishing Event

Bass Pro Shops, 10040 Gulf Center Dr, Fort Myers

Saturday, September 7 • 10 a.m. – 1 p.m.

Come out to Bass Pro Shops the first Saturday of every month and fish on the back lake (catch and release)! Earn your First Fish Award if this is your first time fishing with us! 239-461-7800

Barbie Dance Party

Four Freedoms Park

4818 Tarpon Ct, Cape Coral

Saturday, September 7 • 6 p.m.

Dress in your best Barbie or Ken inspired outfit! Enjoy a night of dancing, dj music, costume contest and our 360 photo booth! Refreshments included, byob. Event open to everyone ages 6 and up, guardian must attend with minors! Call 239-574-0804 to register! $15 per person.

20th Anniversary Celebration

Veterans Park Recreation Center, 55 Homestead Road South, Lehigh Acres

Saturday, September 7 • 10 a.m. - 2 p.m.

Join us for our 20th anniversary celebration of the Veterans Park Recreation Center. Live entertainment, including music and dance performances, class demonstrations, a bounce house for the kids, and cake and ice cream for everyone to enjoy. 239-533-7530

Nature Explorers: Honey Bees

Calusa Nature Center & Planetarium

3450 Ortiz Ave, Fort Myers

Saturday, September 7 • 9 a.m.

Nature Explorers is a drop off program for children 5 to 11 that occur 9 a.m. to 11a.m. The cost is $10 per child. 239-472-3644

STEM Saturday

North Fort Myers Public Library

2001 N. Tamiami Trail NE, N. Fort Myers

Saturday, September 7 • 11 a.m.

Join us for a family-friendly STEM exploration. Each month will feature a different activity based on the aspects of STEM: Science, Technology, Engineering and Math. This is a great opportunity for parents and kids to build, learn and play together. Space is limited. Registration required. For ages 5-11 years. 239-479-4636

Sun - 8

Fort Myers Collectorfest 2024

Luminary Hotel & Co.

2200 Edwards Dr., Fort Myers

Sunday, September 8 • 9 a.m. - 4 p.m.

10,000+ Sq Ft of vintage & modern Toys, video games, Hot Wheels, comics, artwork & more pop culture goodness! Kids under 12 get free Hot Wheels. $15 - 9 a.m.-noon, $10 Noon-4 p.m. www.floridatoyshows.com

Mon

- 9

Chess Anyone?

East County Regional Library

881 Gunnery Road, Lehigh Acres

Monday, September 9, 16, 23, 30 • 2 p.m.

Rise to the chess challenge and join the fun. Chess enthusiasts of all ages are welcome. Bring your own chess set or use one of ours. 239-479-4636

Under the Sea Paper Plate Craft

Captiva Memorial Library

11560 Chapin Lane, Captiva September 9 – 13

Available during normal library operating hours. Make a cute under the sea paper plate craft using natural materials collected at the beach. This is a fun craft idea you can also make at home and is great after a family holiday or trip to the beach. 239-479-4636

Tue - 10

Creative Clay Workshop

Bonita Springs Public Library

10560 Reynolds Street, Bonita Springs

Tuesday, September 10 • 6 p.m.

Join us for an hour of clay creations where children will explore their artistic talents and have a blast molding and shaping their unique creations. All materials are provided. Please dress for a mess. This program is intended for ages 6-11 years. Registration is required. 239-479-4636

Tween Art: Air Dry Clay Creatures

Fort Myers Regional Library

2450 First St., Fort Myers

Tuesday, September 10 • 4 p.m.

Have you ever used air-dry clay? Now is your chance, as we will be creating mini magical creatures. All supplies will be provided. Registration is required. For ages 9-12 years. 239-479-4636

Bricks and Pixels for Teens

Bonita Springs Public Library

10560 Reynolds Street, Bonita Springs

Tuesday, September 10 • 5:30 p.m.

Unleash your creativity as you build with LEGO bricks or in Minecraft creative mode on the PlayStation 4. 239-479-4636

Family Storytime

For children through age 5 years and caregivers. Families with young children enjoy a variety of stories, songs, rhymes and movement. Space is limited. Arrive early to check in.

Bonita Springs Public Library

10:30 a.m. Thursday, Sept. 5, 12, 19, 26

Cape Coral Lee County Public Library

10:30 a.m. Wednesday, Sept. 4, 11, 18, 25

East County Regional Library

10:30 a.m. Wednesday, Sept. 4, 11, 18, 25

6 p.m. Monday, Sept. 9, 16, 23, 30

North Fort Myers Public Library

11 a.m. Wednesday, Sept. 4, 11, 18, 25

Pine Island Public Library

10:30 a.m. Thursday, Sept. 5, 12, 19, 26

Riverdale Public Library

10 a.m. Friday, Sept. 6, 13

Preschool Storytime

For ages 3-5 years. Children attend this program independently while parents and caregivers wait nearby. Space is limited to 15. Arrive early and pick up a ticket at the Youth Desk.

Cape Coral Lee County Public Library

10:30 a.m. Tuesday, Sept. 3, 10, 17, 24

Dunbar Jupiter Hammon Public Library

10 a.m. Friday, Sept. 6, 13, 20, 27

East County Regional Library

10:30 a.m. Monday, Sept. 9, 16, 23, 30

Fort Myers Regional Library

10 a.m. Wednesday, Sept. 4, 11, 18, 25

Northwest Regional Library

519 Chiquita Blvd. N., Cape Coral

10:30 a.m. Thursday, Sept. 5, 12

11:30 a.m. Thursday, Sept. 5, 12

Toddler Tales

For ages 18-36 months and caregivers. Toddlers & caregivers move and groove during this interactive storytime. Space is limited to 14. Arrive early to check in. First-come, first-served.

Bonita Springs Public Library

10:30 a.m. Wednesday, Sept. 4, 11, 18, 25

Fort Myers Regional Library

10 a.m. Tuesday, Sept. 3, 10, 17, 24

Northwest Regional Library

519 Chiquita Blvd. N., Cape Coral

10:30 a.m. Wednesday, Sept. 4, 11

11:30 a.m. Wednesday, Sept. 4, 11

Things to do

Tuesday,September10continued

Racing Day: Off to the Races

East County Regional Library

881 Gunnery Road, Lehigh Acres

Tuesday, September 10 • 5 p.m.

For grades 6-8. Can you build the fastest car? Come test your skills and creativity at the library. Build, test, and race your own cars against friends. Challenge your friends to Mario Kart while you're waiting for your turn to race. 239-479-4636

Readiverse Kids

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Tuesday, September 10 • 3:30 p.m.

An exciting and engaging reading program designed especially for kids. This program aims to foster a love of reading, improve literacy skills and create a sense of community among young readers. This program is intended for ages 7-11 years. 239-479-4636

Wed - 11

Crafty Creations: Where Imagination Takes Flight

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Wednesday, September 11 • 4 p.m.

Crafty Creations is a dynamic and interactive craft program designed to spark the imagination and creative spirit of children. This program is a hands-on adventure where kids can explore their artistic talents, build self-confidence and create unique masterpieces. This week we will be making sombreros, or traditional Mexican hats. All materials provided. This program is for children in grades K-5. 239-479-4636

Thu - 12

Teen Thursdays

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral

Thursday, September 12 • 4 p.m.

Sesame Street Live!

Say Hello

Barbara B Mann Performing Arts Hall, 13350 FSW Parkway, Fort Myers

Sunday, September 15 • 2 p.m.

Elmo, Abby Cadabby, Cookie Monster, and their friends from Sesame Street are coming to your neighborhood to say hello! At Sesame Street Live! Say Hello, sing, dance, and play alongside your favorite furry friends, all while you follow Elmo’s puppy, Tango, in a fun game of hide & seek. So put on your dancing shoes and make your way to where the air is sweet for this all-new celebration on Sesame Street! 239-481-4849

Hangout, tinker around and geek out with something new each month. This month, we will be playing with Nintendo gaming systems and Buildy Bots. No registration required. All supplies and snacks provided while they last. This program is intended for ages 11-18 years to attend independently. 239-479-4636

Teen Thursday: Cooking Matters

East County Regional Library

881 Gunnery Road, Lehigh Acres

Thursday, September 12 • 2 p.m.

Cooking Matters provides a flexible, hands-on lesson to develop a love for cooking and the skills to make healthy food choices. The program includes meal planning tips, activities, handouts, recipes and food sampling. Open to teens ages 12-17 years. Sorry parents, the sponsoring agency allows this program to be attended only by those 17 and under. Space is limited to the first 20 participants. 239-479-4636

Preschool Playdough Play Date

Lakes Regional Library

15290 Bass Road, Fort Myers

Thursday, September 12 • 10:30 a.m.

Preschoolers, let's get creative with playdough. Join us for a fun and imaginative playtime. Dress for mess. For ages 2-5 years. No registration is required, but space and supplies are limited. 239-479-4636

Racing Day: Little Racers

East County Regional Library

881 Gunnery Road, Lehigh Acres

Thursday, September 12 • 10:30 a.m.

Zip and zoom around the Storytime Room with toy cars and handmade racetracks. For ages 2-5 years. 239-479-4636

Fri - 13

Colorful Creations: PreK Face Painting Program Celebrating Hispanic Heritage Month

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Friday, September 13 • 10:30 a.m.

Bring your child's imagination to life with our vibrant and exciting face painting program. Whether they dream of becoming a superhero, a whimsical fairy or a roaring lion, our skilled face painters are ready to transform those dreams into a colorful reality. This program is intended for ages 2-5 years. 239-479-4636

Seashell Walk

Lovers Key State Park

8700 Estero Blvd, Fort Myers Beach

Friday, September 13 • 10 a.m.

Join a park ranger for a relaxing hike along the Lovers Key shoreline. Learn the names of the seashells that wash ashore at the park, fun facts about the creatures who craft them, and the shelling regulations that help protect these iconic Florida treasures. Program is free with paid park entry. Space is limited; reservations required. To register, visit https://bit.ly/FOLKSEvents.

Parent’s Night Out

William Austen Youth Center

315 SW 2nd Avenue, Cape Coral

Friday, September 13 • 6-9 p.m.

The Youth Center invites you to Parent’s Night Out for kids ages 3-5! Enjoy a night full of fun activities, games, and more to keep your little ones entertained. Pizza and snacks will be provided. Only $20 per child! 239-242-3950

Sat - 14

Read to Dogs

East County Regional Library

881 Gunnery Road, Lehigh Acres

Saturday, September 14 • 11 a.m.

Join us at the library for reading to dogs. The dogs are registered therapy animals who volunteer with their owner/handlers as a team to help improve the literacy skills of children. Children can read down fines or just develop a love of reading through reading to dogs. 239-479-4636

Blacklight Bingo

Fort Myers Regional Library

2450 First St., Fort Myers

Saturday, September 14 • 2 p.m.

Join us for a fun afternoon of Blacklight Bingo for adults and teens. Register to guarantee your spot, but a number of walk-in spots will be available. First come, first served. 239-479-4636

Run Like A Kid 5K

Bell Tower Shops

13499 S Cleveland Ave., Fort Myers

Saturday September 14 • 8 a.m.

Our course will wind through the charming Bell Tower Shops, providing a vibrant and engaging atmosphere for runners and spectators alike. With lively decorations, music, and plenty of surprises along the way, this event. Dress up in your favorite childhood costume, bring your kids, and get ready for a day of fun and fitness. Benefits Golisano Children's Hospital and Barbara's Friends. www.belltowerfl.com

All-Abilities Kids Storytime

Lakes Regional Library

15290 Bass Road, Fort Myers

Saturday, September 14 • 10 a.m.

For ages 3-12 years and caregivers. This storytime emphasizes books, music and sensory experiences designed for children with adaptive needs and their families. Using visual schedule boards, stories are told through multiple modalities. This creates a positive storytime experience in a quieter environment with reduced sensory stimuli. Class size is limited to 10 children, plus their parents or caregivers. 239-479-4636

Family Wet Walks 2024

Six Mile Cypress Slough Preserve

7751 Penzance Boulevard, Fort Myers

Saturday September 14 • 9 a.m.

Don’t miss out on a unique experience. Get up close and personal, and experience the beautiful wetlands in new and surprising ways. Led by trained guides, these walks follow a restricted, water-filled, sinuous trail amidst thick green ferns, towering cypress, and chattering woodpeckers. Water levels may reach chest high, depending on recent rainfall. www.sloughpreserve.org

Teen Arts and Crafts

Lakes Regional Library

15290 Bass Road, Fort Myers

Saturday, September 14 • 2 p.m.

Teens, get creative with a variety of arts and crafts supplies. While supplies last. For ages 12-18 years. 239-479-4636

Read to the Dogs

North Fort Myers Public Library

2001 N. Tamiami Trail NE, N. Fort Myers

Saturday, September 14 • 2 p.m.

Join us at the library to read to dogs. The dogs are registered therapy animals who volunteer with their owner/handlers as a team to help improve the literacy skills of children. You can read down fines or just encourage a love of reading in your children with reading to dogs. 239-479-4636

Things to do

Friendly Forest Fall Festival

Calusa Nature Center and Planetarium, 3450 Ortiz Avenue, Fort Myers

September 21 - 22 • 10 a.m. - 4 p.m.

Join us for a fun day of fall festivities such as crafts, games, pumpkins, Smokey The Bear, food vendors & more. 239-275-3435

Sun - 15

Fiesta Bonita

Riverside Park

10450 Reynolds Street, Bonita Springs Sunday, September 15 • Noon - 8 p.m.

A day filled with music, dancing, and delicious food! www.cityofbonitasprings.org

Dan Christopher

Embassy Suites by Hilton Fort Myers Estero

10450 Corkscrew Commons Drive Estero Sunday, September 15 · 5 p.m.

An evening of ventriloquism, magic, and comedy. What do you get when you start with some wild and crazy Puppet Pals, add some mysterious magic tricks, and some funny jokes that'll have 'em rolling in the aisles? The answer is Dan Christopher...and friends! A family-friendly show suitable for all ages! www.venturinoscomedyclub.com

Mon - 16

Create a Custom Button (teen) Captiva Memorial Library

11560 Chapin Lane, Captiva September 16 - 20

Available during normal library operating hours. Everyone loves a touch of creativity in their life. What can be more creative than the art of button-making? It feels so satisfying to craft your own adorable buttons. If you're adding a personal touch to your favorite jacket, or trying some DIY fun, there's something truly special about creating your own custom buttons. 239-479-4636

Washi Tape Crafts

Fort Myers Regional Library

2450 First St., Fort Myers

Monday, September 16 • 4 p.m.

Teens are invited to decorate a light switch and clothes pins with washi tape. All supplies will be provided. Registration is required. 239-479-4636

Tue - 17

Books and Blankets

Bonita Springs Public Library

10560 Reynolds Street, Bonita Springs Tuesday, September 17 • 6 p.m.

Join us with your blankies and pajamas for this nighttime edition of storytime. Your whole family is invited to this enjoyable, all-ages storytime that encourages the development of pre-reading skills through songs, rhymes, fingerplays and stories. 239-479-4636

Anime Hour

Riverdale Public Library

2421 Buckingham Road, Fort Myers

Tuesday, September 17 • 2:30 p.m.

Enjoy an hour of anime entertainment, creative expression and lively discussions. This program is specially curated for anime enthusiasts to indulge in their passion for Japanese animation while hanging out among like-minded peers. Snacks provided and cosplay encouraged. This program is for teens ages 12-18 years. 239-479-4636

Racing Day: Off to the Races - Elementary

East County Regional Library

881 Gunnery Road, Lehigh Acres

Tuesday, September 17 • 3 p.m.

Can you build the fastest car? Come test your skills and creativity at the library. Build, test and race your own cars against friends. Challenge your friends at Mario Kart while waiting for your turn to race. For grades K-5. 239-479-4636

Sing Along with School House Rock!

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral

Tuesday, September 17 • 11 a.m. – 1 p.m.

Celebrate Constitution Day at our sing along with School House Rock! Drop in and join the fun, featuring favorites from the election collection including "The Preamble," "I'm Just a Bill" and "The Great American Melting Pot" among others. This program accompanies "Voices and Votes: Democracy in America" opening at the Cape Coral Lee County Public Library September 14. 239-479-4636

Fantasy Masquerade Ball

North Fort Myers Public Library

2001 N. Tamiami Trail NE, N. Fort Myers

Tuesday, September 17 • 6 p.m.

Come one, come all and join us in this magical night to make merry. Dress in your most fantastical attire and bring your most mysterious mask. Immerse yourself in this fantasy night of fairies, elves, nobles and more. 239-479-4636

Thu - 19

STEAM Club

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral

Thursday, September 19 • 4 p.m.

Be ready for fun experiments and projects as we explore the world of STEAM (Science, Technology, Engineering, Art and Math). This program is intended for ages 5-11 years. This month's theme is Weather Wonders. Dress for mess. Registration is required and is guaranteed until the start of the program. All materials provided. 239-479-4636

Teen Thursday: Acrylic Pour Painting

East County Regional Library

881 Gunnery Road, Lehigh Acres

Thursday, September 19 • 2 p.m.

Let your creativity flow and create a unique abstract masterpiece using the art of acrylic pour painting. All supplies provided. For teens in grades 9-12. Space is limited to the first 40 participants. No registration required. 239-479-4636

Fri - 20

Chalk It Up Sidewalk Chalk Adventure

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Friday, September 20 • 10:30 a.m.

Drawing with chalk isn't just about creating art, it's also a form of physical activity. Children will stretch their muscles and get moving as they bend, crouch and reach to cover the sidewalk with their colorful masterpieces, promoting gross motor skills development in a playful way. For ages 3-5 years. 239-479-4636

Walk on the Wild Side

Lovers Key State Park, 8700 Estero Blvd, Fort Myers Beach

Friday, September 20 •10 a.m.

Join a park ranger for a guided hike along our Black Island Trail. Learn about the fascinating vegetation and wildlife that reside in our maritime hammock ecosystem and enjoy a little local history along the way. Closed-toe shoes, sunscreen, bug spray, and water bottles are highly recommended. Program is free with paid park entry. Space is limited; reservations required. To register, visit https://bit.ly/FOLKS-Events.

J.N. “Ding” Darling National Wildlife Refuge Family Fun Night

Lakes Park

7330 Gladiolus Dr., Fort Myers

Friday, September 20 • 4:30 - 6:30 p.m.

Join the J.N. "Ding" Darling National Wildlife Refuge in celebrating the kick-off of Hispanic Heritage Month with the (FREE) Family Fun Night. Learn about the environmental importance of monarch butterflies and their cultural significance within Latinx communities, plant cempasúchil (marigold) seeds, join a bilingual-birding walk, kid-friendly archery, explore archeology, and other FUN activities for the family. 239-472-1100

Baby Rhyme Time

For babies up to 18 months. Babies and caregivers wiggle and giggle in a supportive environment. Space is limited. Arrive early to check in. 239-479-4636

Bonita Springs Public Library

10560 Reynolds Street, Bonita Springs

10:30 a.m. Monday, Sept. 9, 16, 23, 30

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral

10:30 a.m. Thursday, Sept. 5, 12, 19, 26

Fort Myers Regional Library

2450 First St., Fort Myers

10 a.m. Thursday, Sept. 5, 12, 19, 26

Lakes Regional Library

5290 Bass Road, Fort Myers

10 a.m. Monday, Sept. 9, 16, 23, 30

North Fort Myers Public Library

2001 N. Tamiami Trail NE, N. Fort Myers

11 a.m. Thursday, Sept. 5, 12, 19, 26

Northwest Regional Library

519 Chiquita Blvd. N., Cape Coral

10:30 a.m. Monday, Sept. 9

Riverdale Public Library

2421 Buckingham Road, Fort Myers

10 a.m. Friday, Sept. 20

Sat - 21

Family Build It

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral

Saturday, September 21 • 2 p.m.

For all ages. Drop in for building challenges the whole family will enjoy. No registration required. All materials are provided. 239-479-4636

Charley Maplewood’s Big One-Oh!

Cultural Park Theatre, 528 Cultural Park Theatre Blvd, Cape Coral September 20-29

An enchanting children’s production offering a magical experience for audiences of all ages. 239-772-5862

Kid Craft Saturday

North Fort Myers Public Library

2001 N. Tamiami Trail NE, N. Fort Myers

Saturday, September 21 • 11 a.m.

Children and their families are invited to join us for a morning of crafting. All supplies will be provided, just bring your creativity. Space is limited to 12. Please register your participating child. For ages 6-11 years. 239-479-4636

Food STEM

Riverdale Public Library

2421 Buckingham Road, Fort Myers

Saturday, September 21 • 11 a.m.

Does your child love food and enjoy hands-on experiments? Our Food STEM program is designed children ages 6-12 years and blends the excitement of food with the wonder of science. Registration is required and space is limited. Children under the age of 8 must be accompanied by an adult. 239-479-4636

Clips for Cancer Family Fun Day featuring a Touch A Truck

Bell Tower Shops, 13499 S Cleveland Ave., Fort Myers

Saturday, September 21 • 10 a.m. - 2 p.m.

Come out and see big rigs, fire trucks, police vehicles, ambulances, boats, tractors and so much more! Enjoy meet and greets with local fire and police and photo opportunities in and around a variety of vehicles! Then be sure to head inside the mall & enjoy a day of family friendly activities featuring a bounce house, face painter, balloon artists, live performances, vendors, games, visits from your favorite princesses and the infamous stilt walker Way Too Tall Torrie, Adam's Animal Encounter and their mini zoo, inflatable axe throwing from Chuck it Axes and more! For more information please visit: www.belltowerfl.com

Trivia: Harry Potter Edition (teen)

North Fort Myers Public Library

2001 N. Tamiami Trail NE, N. Fort Myers Saturday, September 21 • 2 p.m.

Grab your wand and prepare to apparate into the magical realm of Harry Potter trivia. Delve into the depths of Hogwarts lore, uncover the mysteries of the Marauder's Map and put your knowledge of spells, potions and magical creatures to the ultimate test. 239-479-4636

Family Build It

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral

Saturday, September 21 • 2 p.m.

For all ages. Drop in for building challenges the whole family will enjoy. No registration required. All materials are provided. 239-479-4636

Reading is "Doggone Fun"

Pine Island Public Library

10701 Russell Road, Bokeelia Saturday, September 21 • 1 p.m.

Enjoy a Saturday afternoon reading to registered therapy dogs at the library. Choose to read your own story, or we can provide one for you. You and your family will spend quality time reading to these furry friends in small groups. Families will be given access in ten-minute intervals, so plan to enjoy the library while you wait. 239-479-4636

Lowes KId’s DIYer Workshop: Harvest Hayride

14960 S. Tamiami Trail, Fort Myers

Saturday, September 21 • 10 a.m.- 1p.m.

Embark on a magical journey into the treetops! Our expert instructors will guide kids in basic carpentry as they construct a tiny abode. 239-433-9255

Tue

- 24

Family Tabletop Game Night

Bonita Springs Public Library

10560 Reynolds Street, Bonita Springs

Tuesday, September 24 • 5:30 p.m.

Challenge your friends and family to a variety of tabletop games including chess, Monopoly and Uno. All ages and skill levels are invited. 239-479-4636

Teen Tuesday

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Tuesday, September 24 • 2:30 p.m.

Come to the library to talk about your favorite books, play games and take part in other special activities. Teens will diamond paint a coaster. For ages 13-18 years. 239-479-4636

Anime Club

Fort Myers Regional Library

2450 First St., Fort Myers

Tuesday, September 24 • 4 p.m.

For teens ages 12-18 years. Show us your anime style. Create your own art while discovering new content. Design your own anime character using Perler beads. All supplies will be provided. 239-479-4636

Homeschool Hangout: Paper Bag Puppets

Riverdale Public Library

2421 Buckingham Road, Fort Myers

Tuesday, September 24 • 1 p.m.

Join us for a fun and creative hangout where elementary children ages 6-12 years can unleash their imagination and craft their very own paper bag puppets. This hands-on activity encourages creativity, fine motor skills and storytelling as each participant designs and constructs their unique puppet character. Supplies provided. 239-479-4636

Middle School Game Day

East County Regional Library

881 Gunnery Road, Lehigh Acres

Tuesday, September 24 • 5 p.m.

Compete in our Mario Kart racing bracket. Open to all middle school teens. Bring your own snacks and covered drinks to enjoy during the event. We'll also have board games, video games, card games and more on hand to play. For grades 6-8. 239-479-4636

Wed - 25

Crafty Creations: Where Imagination Takes Flight

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Wednesday, September 25 • 4 p.m.

This program is a hands-on adventure where kids can explore their artistic talents, build self-confidence and create unique masterpieces. This week we will be making harmonicas. All materials provided. This program is for children in grades K-5. 239-479-4636

Thu - 26

Sensory Play: Exploring Primary Colors

East County Regional Library

881 Gunnery Road, Lehigh Acres

Thursday, September 26 • 10:30 a.m.

Enjoy a special sensory playdate that promotes social skills, fine motor skills and helps develop early literacy skills. Sensory toys, activities and music will be available to encourage a fun bonding experience for families and for children to make new friends. This program is for ages 2-5 years. 239-479-4636

Teen Thursday: High School Game Day

East County Regional Library

881 Gunnery Road, Lehigh Acres

Thursday, September 26 • 2 p.m.

Play board games, video games, card games and more at the library. Open to all high school teens. Bring your own snacks and covered drinks to enjoy during the event. 239-479-4636

Family Fun Night

Bell Tower Shops

13499 S Cleveland Ave, Fort Myers

September 26 • 5 - 7 p.m.

Adam's Animal Encounters will be exhibiting Live Exotic Animals in their Mini Zoo display with educational and hands-on opportunities throughout the evening. Inflatable axe throwing, cotton candy, face painting, balloon artists and bounce house. In addition, there will be a variety of vendors throughout the shopping center! belltowerfl.com

Black Light BINGO

Lakes Regional Library

15290 Bass Road, Fort Myers

Thursday, September 26 • 4 p.m.

BINGO for kids with a fun glow in the dark twist. No registration is required, but space and supplies are limited. For ages 6-11 years. 239-479-4636

Fri - 27

PreK Playtime

Dunbar Jupiter Hammon Public Library

3095 Blount St., Fort Myers

Friday, September 27 • 10:30 a.m.

PreK Playtime is designed to provide a nurturing environment where kids and caregivers can bond, explore and discover together through engaging activities specifically crafted for their developmental stage. Kids will have the opportunity to explore various sensory experiences, including textures, sounds and gentle movements, to stimulate their senses and promote cognitive development. For ages 3-5 years. 239-479-4636

Bilingual Family Storytime

Riverdale Public Library

2421 Buckingham Road, Fort Myers

Friday, September 27 • 10 a.m.

For children through age 5 years and caregivers. This fun and engaging storytime for children and caregivers promotes and reinforces early literacy skills and language development. Stories, music, movement and activities are shared in both English and Spanish. English or Spanish language skills are not necessary to participate in this program. 239-479-4636

Sat - 28

L is for Llama Storytime

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral Saturday, September 28 • 10:30 a.m.

Join us for stories, songs, rhymes and more about llamas. For ages 2-5 years with a caregiver. Space is limited. Arrive early and pick up a ticket at the Youth Desk. 239-479-4636

Geocaching

East County Regional Library

881 Gunnery Road, Lehigh Acres Saturday, September 28 • 1 p.m.

Come enjoy geocaching at your library. This event is open to all levels of geocaching experience, from first timers to experts. Geocaching, a treasure-hunting sport using GPS-enabled devices, is family-friendly and fun. 239-479-4636

Books with Blue: Storytime with a Police Officer

Fort Myers Regional Library

2450 First St., Fort Myers

Saturday, September 28 • 11 a.m.

Join us as we partner with the Fort Myers Police Department for an in person, interactive storytime. Enjoy books, learn safety tips, ask questions and connect with an officer. 239-479-4636

Kids Day!

Miromar Outlets

10801 Corkscrew Rd, Estero

Saturday, September 28 • 10 a.m. - noon

Come join us for face painting, crafts, pizza and ice cream at the WINK Playland! Toddlers to 12-year-olds can participate in fun activities and other goodies. While supplies last. www.miromaroutlets.com

Freaky Friday A New Musical

2268 Bay Street, Fort Myers

Friday, September 27 • 8 p.m. Saturday, September 28 • 2 p.m. & 7 p.m. Sunday, September 29 • 2 p.m. & 7 p.m.

When an overworked mother and her teenage daughter magically swap bodies, they have just one day to put things right again. Freaky Friday, a new musical based on the celebrated novel by Mary Rodgers and the hit Disney films, is a heartfelt, comedic, and unexpectedly emotional update on an American classic. By spending a day in each other's shoes, Katherine and Ellie come to appreciate one another's struggles, learn self-acceptance, and realize the immeasurable love and mutual respect that bond a mother and daughter. 239-332-4665

More than Orange Blossoms:

Feisty Fabulous Females of Florida

Cape Coral Lee County Public Library

921 S.W. 39th Terrace, Cape Coral Saturday, September 28 • 2 p.m.

Though not always in the history books, the women who helped build, form, shape and develop the state have inspired hope and possibility. Stories of strong, courageous women like Julia Tuttle, known as the Mother of Miami, or Mary McLeod Bethune, daughter of enslaved parents who went on to become an adviser to several US presidents. Discover and rediscover some of the women who grew and shaped the state. Registration is required. 239-479-4636

Farmer Mike’s Fall Festival & Corn Mazes

Farmer Mike’s U Pick

26068 Morton Ave., Bonita Springs

September 28 - October 27

Bounce houses, corn mazes & pumpkin patch. You can walk into the field and pick your own sunflower or pumpkin this year right off of the vine! Children 2 & under are free! Festival not open for activities Monday through Thursday or Sunday nights. www.farmermikesupick.com

2024 Springtime Farms Fall Festival

Springtime Farms & Adventure Park

10761 Aqua Vista Lane, North Fort Myers

September 28 - October 27

With over 200 animals have a fun-filled day with up-close hands-on experiences. Explore 4 acres of fun and educational activities for the whole family, a 70 foot long jumping pillow, interactive petting zoo, bird aviary, gardens, pumpkin patch, maze, haunted walk, playgrounds & more. One free pumpkin per child. www.fallfestivalfortmyers.com

Thepickyeater

Manyhaveencounteredachildfittingthepickyeaterdescription.Maybe youhaveachild whoplaysthis role.Perhaps youareoneof theparentsIsee whohaspleaded, begged,bribed, orbargainedwith theirchildtoeat thefoodyou haveprepared. Youmight haveevenmade airplaneortrain soundstogetonebiteoffoodinyour child’smouth.I'vebeenthere,andIsee manyofyouinthesamepredicament everyday.

Severalmanufacturersmakesupple-

mentaldrinkstargetedatpickyeaters.I onlyrecommendthemforspecific patients.Itisanecdotalevidence,but mostpickyeatersIseehaveanappropriateheightandweightfortheirage despiteahorriblediet.Thesearenotthe childrenwhowillbenefitfromsupplementaldrinks.Mostofthesesupplementscontainover250caloriesper8 ounces.Thisisanexcessofcaloriesfora childwithanalreadyappropriateweight.

Thesechildrenneedbetterfoods insteadofmorecalories.Someparents usethesedrinksasmealreplacements fortheirchildren,whichisnotrecommended.Thishasthepotentialtomake yourchilda"pickier"eater.Theyalso lackimportantthingsagrowingbody needsfromawell-balanceddiet,suchas fiber.

Whatdoesapediatricianandfather ofapickyeaterultimatelyrecommend?

Patience.Itcantakeseveraltriesfora childtodevelopatasteforsomefoods. Makemealsfun!Takeyourchildtothe grocerystoreandhavethemhelp choosefoodsandseehowmealsare preparedfromstarttofinish.

Ifyouplantorewardyourchild’seatinghabits,rewardthemwiththingslike goingtotheparkorthemuseum.These setagoodexampleandteachthemhow tomakehealthychoicesastheyage. Consultyourpediatricianifyouhave concernsaboutweightorifyourchildis experiencinggastrointestinalsymptoms.

Beingapickyeaterisachallenge, butyouarenotalone.Remember,the habitsyouteachyourchildtodayinfluencetheirchoicestomorrow.

DavidButler,D.O.,FAAP,iswith Physicians’PrimaryCareofSouthwest Florida)withofficesthroughoutLee County.www.ppcswfl.com

AnnualClipsforCancer Sept.21atBellTowerShops

ClipsforCancerwillbe heldSaturday,Sept.21from 10a.m.to2p.m.atBellTower ShopsduringChildhood CancerAwarenessMonth.

Thisyear’seventthemeis “GoGoldforGolisano”in recognitionofthegoldribbon, anawarenesssymbolforchildhoodcancer.TheentirecommunityisinvitedtoGoGold andFightLikeaKid,from bravingtheshaveand fundraisingordonatinginsupportofBarbara’sFriends–GolisanoChildren’sHospital’s cancerfund.

AtClipsforCancer,childhoodcancersurvivorsand patientsshavetheheadsof communityleaders.These leadershelpraisemoneyand awareness,showingthatbeing baldisnotasignofweakness butstrengthinthelongfight throughchemotherapytreatment.

Thisyear,ClipsforCancer willbecenterstageatBell ToweronSaturday,Sept.21, withalltheshavinghappening at10a.m.insideDave&

Buster’scommunityroom.The daywillcontinuewithfree familyfriendlyactivities, includinggames,animal encounters,firstresponder meet-and-greetwithatouch-atruckandtoursofthefirst-ofitskind,sensoryfriendly GolisanoAmbulance.ABell Tower“GoGold”Shopping& DiningDiscountCardwillbe availableforpurchasewith proceedsbenefitingBarbara’s Friends.

Thecommunitycanget involvedandsupportlocal childrenwithcancerby:

•Becomingashavee:Sign uptohaveapediatriccancer survivor/patientshaveyour head.Registerfor$25,seta personalfundraisinggoaland createafundraisingpageto supportthecause.

•Donating,fundraising andsponsoringtheevent.

Forinformationonthis year’seventandsponsorship opportunities,visit BarbarasFriends.org/ClipsForCa nceroremail

Amy.Frith@LeeHealth.org.

Freeautismscreenings foryougchildrenSept.20

GolisanoChildren’s HospitalofSouthwestFlorida, inpartnershipwithRonald McDonaldHouseCharities® ofSouthwestFlorida,offersa freemonthlyautismspectrum disorderscreeningfortoddlers 18monthstofiveyearsof age.

Thenextscreeningwillbe heldonSept.20from9a.m.2p.m.atthePediatric SpecialistOffice,15901Bass Road,Suite102,FortMyers.

Itisestimatedthatonein every44childrenisdiagnosed withsomeformofAutism SpectrumDisorder,makingit morecommonthanchildhood cancer,juvenilediabetesand pediatricAIDScombined. Medicalconsultantsforthe

projectstressthatanearly diagnosiscanmakeavastdifferencefortoddlersandtheir families.Theysayearlyintensivebehavioralintervention canmakeanimmensedifferencenotjustinthedevelopmentofthechild,butintheir familiesaswell.

TheASDscreeningisconductedbytheGolisano Children’sHospitalof SouthwestFlorida.Thescreeningsareadministeredbyan AdvancedPracticeRegistered Nurse,whohasextensive trainingandexperiencein typicalchilddevelopmentand developmentaldisorders.

Aphysicianreferralisnot required.Toschedulea screening,call239-343-6838.

Fun Around Florida

Suncoast Kids Extravaganza

England Brothers Park

5010 81st Ave N., Pinellas Park

Suncoast Kids Extravaganza and Sunday Market in the Park will be held on September 1. It will feature bounce houses, pony rides, face painting, petting zoo, obstacle courses, vendors, food trucks and more. Free admission and parking. Hours: 10 a.m.-5 p.m. bestlocalthings.com

Orlando Fanboy Expo

Hyatt Regency Orlando

9801 International Dr., Orlando

Orlando Fanboy Expo will be held September 6-8. It will include celebrity guests, cosplay, vendors, live entertainment, comic industry pros, food and more. Hours: Fri 4 - 9 p.m., Sat 10 a.m. - 6 p.m., Sun 11 a.m. -5 p.m. www.fanboyexpo.com

90s Con

Ocean Center

101 North Atlantic Avenue, Daytona Beach

90s Con will be held on September 13-15. This festival will feature members of 90210, Melrose Place, The Teenage Witch, Carmen Electra, Punky Brewster, 7th Heaven, Blossom, O’Town, TLC and more. www.thats4entertainment.com

Bartow Fall Fest

Downtown

395 E Summerlin St, Bartow

Bartow Fall Fest will be held on September 28. This festival will feature a variety of vendors, pumpkin patch, games, delicious food and more. Hours: 10 a.m. - 3 p.m. www.mainstreetbartowfl.com

Fall Family Fest

Water Works Park

1701 N Highland Ave, Tampa

Fall Family Fest will be held on September 22. Free fun for the whole family! Interactive exhibits, character visits, giveaways, swag bags and more! Plus great food, entertainment makes this a great way to spend the day! 11 a.m. - 3 p.m. www.tampabaymomsgroup.com

Dessert Wars Miami

Florida State Fairgrounds - Entertainment Hall

4800 US-301 Tampa

Dessert Wars Miami will be held on September 28. Dessert Wars is a celebration of the “foodie” lifestyle, featuring dessert vendors vying for the title of Dessert Champion. The event features a wide array of desserts ranging from cupcakes, cookies, ice cream and doughnuts. 3 - 6:30 p.m. Stretchy pants highly recommended! www.dessert-wars.com

Farmer Mike’s Fall Festival & Corn Mazes

Farmer Mike’s U Pick

26068 Morton Ave., Bonita Springs

Farmer Mike’s Fall Festival & Corn Mazes will be held September 28October 27. Bounce houses, corn mazes & pumpkin patch. You can walk into the field and pick your own sunflower or pumpkin this year right off of the vine! Children 2 & under are free! Festival not open for activities Monday through Thursday or Sunday nights. Hours: Fridays 6-10 p.m., Saturdays 9 a.m.-10 p.m. & Sundays 9 a.m. - 5 p.m. www.farmermikesupick.com

2024 Springtime Farms Fall Festival

Springtime Farms & Adventure Park

10761 Aqua Vista Lane, North Fort Myers

Springtime Farms Fall Festival will be held September 28 - October 27. Relax, breathe in the fresh air and enjoy the great outdoors at the Adventure Park. With over 200 animals have a fun-filled day with up-close hands-on experiences. Explore 4 acres of fun and educational activities for the whole family, a 70 foot long jumping pillow, interactive petting zoo, bird aviary, gardens, pumpkin patch, maze, haunted walk, playgrounds & more. One free pumpkin per child. www.fallfestivalfortmyers.com

Tampa Bay Kids Expo

WestShore Plaza

250 WestShore Plaza, Tampa

Tampa Bay Kids Expo will be held on September 28. The exhibitors will showcase family friendly services, resources and afterschool and year round programs. There will be arts and crafts, balloon twister, video game zone, group demos, dozens of vendors, face painting, character meet and greets, door prizes and more. Hours: 10 a.m. - 3 p.m. www.touchofmagicevents.com

Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.