The Student Voice of MSU Denver
Volume 38, Issue 3
Brewing returns to Auraria
August 27, 2015
Sports
Met
mymetmedia.com
Roadruckers: They’re not your average birds PAGE 13
Met
Reviews
Met
Met does music: Back-to-school play list PAGE 12
News
New program utilizes restored brewery PAGE 3 Beertender David Hubbard pours beers for a packed house at the grand opening of the Tivoli Brew Pub Aug. 22 at Auraria Campus. Photo by Alyson McClaran • amcclara@msudenver.edu PAGE 10 >>
The story behind John Alexander
a familiar face at Auraria Campus By Joella Bauman jbauma17@msudenver.edu
It’s a familiar childhood tale, but John Alexander tells it differently. Once upon a time, a foul creature drew air into its large brooding chest and — with a huff and a puff — shattered a pig’s wooden abode. Just like that, the little pig
was homeless. “Show me a homeless character, and you’ll see someone dealing with circumstances outside of their control,” said Alexander, local vendor of the Denver Voice, public speaker and mentor. The story of the wolf and the pig is one which Alexander has told many times as part of his goal to educate people and humanize
the face of the homeless experience. He told it once more as three cameras rolled and Alexander spoke about his life and connections to white-collar crime, which led to drug addiction and homelessness.
PAGE 9 >>
2XX
Mile Spective Break High Events August 2015 Met Date xx,27,xxxx Sports Review Insight
mymetmedia.com f: themetropolitan @themetonline
Student Housing Designed for You!
All inclusive rates starting at $475/month! RegencyStudentHousing.com
— Becca Borowski, psychology major @themetonline f: themetropolitan mymetmedia.com
News
Met
“This old place has great bones. A lot of trades were brought in to rebuild this place, and it’ll bring a lot of people - students and alums - back to the Tiv.”
August 27, 2015
3
Beer Comes Home
MSU Denver becomes nation’s first university with its own brewery, beer programs together By Cassie Reid creid13@msudenver.edu A pub is not the image that comes to mind when envisioning a classroom. Yet, Auraria Campus has welcomed back the Tivoli Brewery as a resource for students in the school’s Brewing Industry Operations program, making it the first campus in the nation with an active brewery. “This old place has great bones,” said Dieter Foernster, head brewer for Tivoli Brewing Co. “A lot of people from a lot of trades were brought in to rebuild this place, and it’ll bring a lot of people - students and alums - back to the Tiv...to sit and have a beer.” President Stephen Jordan officially announced the two new majors — Brew Hub Operations and Brewery Operations, at the grand opening, Aug. 22. Students in the programs will work in the
brewery if they are studying beer science and manufacturing and in the pub if studying distribution. “Technically, in front of the glass, we are Tivoli distribution,” said Scott Kerkmans, Brewing Industry Operations program coordinator. “Behind we have the brewery, but customers will get to see the very inner workings of brewing.” Customers will be able to see both elements in play, as the 30-barrel copper brew kettle is boxed in by floor-to-ceiling windows. One of the eight screens adorning the pub’s walls will be dedicated to live-streaming what is behind the kettle that normally blocks customers from seeing around it, including pH levels of the brew, temperature controls and output measurements. The cellar will also be accessible for watching students monitor equipment and transport kegs. “It’s what we call secondary
education,” said Corey Marshall, CEO and founder of Tivoli Brewing Co. “We educate the students working, yes, but people can see all of the processes outside. There’s more going into brewing and more science-involved than people think.” Microbreweries recently established themselves as part of Colorado’s cultural identity. The success of microbreweries can be traced back to the ever-present groundbreakers at Tivoli-as they were the very first brewery in the state. The Brew Pub itself is open from 11 a.m. to 7 p.m. Monday through Friday. While only a few students are currently in the program and employed by the brewery, the students are eager for this opportunity to put their education to use. “We are in a shifting industry,” Marshall said. “We have a responsibility to educate the next generation of brewers and distributors.”
Tivoli Brewing Co. CEO Corey Marshall does little to hide his jubilation during the festivities of Aug. 22, the reopening of the Tivoli Brew Pub. Photo by Alyson McClaran • amcclara@msudenver.edu
At last! New ConnectU intergrates student experience By Justin David Tate jtate15@msudenver.edu For years, students new to MSU Denver’s ConnectU portal have found themselves puzzled and lost. For hours, students try to decipher the web of clicks and links necessary to get of information on registration and financial aid. “If you have to find a page, you have to go through like 20 different pages to get to it,” said hospitality major Lauren Johnson about her
first semester at MSU Denver. Today, MSU Denver Chief Information Officer James Lyall believes that time of confusion will cease to be. “For the first time, students will be able to log into MSU Office 365, Blackboard and financial aid, banner related-things with one username and password instead of having multiple usernames and passwords,” Lyall said. Lyall formed a vision and a team roughly one year ago with a small goal in mind: Make students’
lives easier. One of the ways they are doing that is by creating a brand new version of ConnectU that serves as a one-page dashboard for most if not all necessary online services a student may need to access. The new ConnectU is currently available for students to try by visiting the ConnectU login and entering their Net ID. (The first part of the student email before the @ sign and their Net ID password.) Since students have started adopting the interim ConnectU,
Lyall said he’s already seen positive results. “We’re seeing a dramatic decrease in the number of calls and contacts to the help desk for password resets,” Lyall said. Computer science major Armand Sadozai has taken a look at the new interim ConnectU and finds it to be a more enjoyable experience for him as a student. “I think it looks a lot easier to navigate than the other one,” Sadozai said. “The other one was kind of cluttered. This one seems
more direct.” The new interim ConnectU will become permanent in “the coming weeks” according to Lyall as the old one is phased out. Lyall said he is pleased with the progress of the new site, but maintains that this is only the beginning. For now, he believes the new ConnectU is helping serve the purpose of why he came to work for MSU Denver: helping students have a more comfortable experience in school.
4XX
Mile Break High August 2015 Met MetSpective NewsEvents Date xx,27,xxxx Sports Review Insight
mymetmedia.com f: themetropolitan @themetonline
50-YEAR REVIVAL
tivoli celebrates the return of its brewery, restaurant Story and photo by Justin David Tate jtate15@msudenver.edu
Stephanie Rayman, manager of the Tivoli Brewery restaurant expected at least the 800 guests who RSVP’d to show up for the reopening on August 22. Over a thousand people, hungry for the traditional salty indulgence of pub food and thirsty for the kind of craft beer that gets natives of the brewery hotspot of Denver excited, arrived opening day. “Everyone is really excited that we’re bringing back this pre-prohibition style beer as well as this historical brewery back into action and bringing it into the 21st century,” Rayman said. The festivities included ‘round-the-clock tour guides through the distillery equipment Ryan Swift serves as a tour guide Aug. 22, the grand reopening of the Tivoli Brewery and restaurant to and brewery. the general public. He is the nephew of Corey Marshall, CEO of the Tivoli Brewery. Dozens of people at a time squeezed for 18 years, said he was enjoying the facility, Black said. “If they want to expand or do s is your total recruitment solution down bottlenecked pathways through offering darkly food and beer. He considers their 52 taps DENVER something seasonal they can but a great b fair, broadcast, andwith print. lit basements filled tubes and large taphouse isn’t made by how many beers respectable, but says it isn’t uncommon for metallic containers, twisting and connecting breweries to have more. you have on tap. It’s made by the selection together to form a maze of beer-flow. of beers you have. Anybody can have 100 Black believes they will have more and Stephen Black, one of three brothers who can expand, but their quality of beer is what taps but nowadays beer drinkers are more have owned the Falling Rock Taphouse on discerning.” will have to sustain them in the long run. Blake and 19th Street in downtown Denver Though the beer impressed, the food “They’re on campus, they’ll do great,”
int & Web Authorization
seemed to leave an impression as well. Customers at the beer trying the mushrooms and asadero cheese had wide eyes and slowed their mouth to a near-stop in order to absorb what they loudly exclaimed as, “delicious,” “yummy,” or simply, “hmmm.” For the cooking staff, the Tivoli brought on a veteran staff from Tom’s Diner that was led by executive chef Rick Prow, a chef with 25 years of experience. He had a simple goal going into the day and according to the reactions of the patrons inside the restaurant, he achieved it. “I want big, bold indulgent food that every time you take a bite, you want to drink a beer whether that’s spicy, sweet or salty, any of those things that make you thirsty,” Prow said. During the festivities, bands played and speeches were made in the Turnhalle room down the hall from the Tivoli restaurant, including a recitation of the “beer prayer” by Tivoli CEO Corey Marshall. “Give us this day our foamy head and forgive us our spillages, as we forgive those who spill against us,” recited Marshall, unable to hide his persistent smile. “And lead us not into incarceration but deliver us from hangovers, For thine is the beer, the bitter, and the lager, forever and ever. Barmen.”
The Metropolitan State University of Denver Counseling Center invites you to participate in the following event:
Just look at a small sample of employers that have hired our graduates...
UÊ- ÞÊ, `}iÊ i` V> Ê i ÌiÀÊUÊ i ÛiÀÊ i> Ì Ê UÊ ÕÌ iÀ> Ê i` V> Ê i ÌiÀÊUÊ, ÃiÊ i` V> Ê i ÌiÀ ÊUÊ-Ì°Ê Ì ÞÊ i ÌÀ> ÊUÊ ÀÌ Ê6> iÞÊ Ã« Ì> Ê UÊ > ÃiÀÊ*iÀ > i ÌiÊUÊ-Üi` Ã Ê i` V> Ê i ÌiÀÊ UÊ1 ÛiÀà ÌÞÊ Ã« Ì>
YELLOW RIBBON
SUICIDE PREVENTION AWARENESS Tuesday, September 8 10 a.m.–noon at the flagpole Wednesday, September 9 1–3 p.m. Tivoli Tavern • Identify risk factors for suicide. • Get resources on where to get help.
Accredited by the Accreditation Commission for Education in Nursing (Formerly NLNAC). Denver School of Nursing is regionally accredited by the Higher Learning Commission. Denver School of Nursing programs are approved by the Colorado State Board of Nursing. Financial Aid available to those who qualify DSN is currently approved to train Veterans who qualify for VA Benefits!
• Obtain ideas on how to talk to friends & family members about your concerns.
THE GOOD NEWS IS SUICIDE IS PREVENTABLE! The stigma associated with mental illness and suicide may cause many people to avoid seeking treatment. Lives are saved when people learn not to keep a secret, but to seek help.
For more information, call 303-292-0015 denverschoolofnursing.edu 1401 19th St, Denver, CO 80202
For more information please contact the Counseling Center staff Tivoli 651 or call 303-556-3132
(Located 1 Block from Coors Field)
For special accomodations please contact us in advance
For consumer information please go to: denverschoolofnursing.edu
Presented as part of National Suicide Prevention Week 2015 September 4–10
@themetonline f: themetropolitan mymetmedia.com
Date xx, August xxxx 27, 2015 Met Sports Break Events Review Spective Insight Met News
Starbucks beats Dazbog in student poll for best coffee By Justin David Tate
jtate15@msudenver.edu Dazbog has long been a prominent source for the coffee needs of the students on Auraria Campus. Located near the Student Success Building, Dazbog went unchallenged until now. With the opening of Starbucks this month, competition is brewing. With Dazbog’s position as the top supplier of cups of joe for the campus at stake, we here at the Metropolitan conducted a poll of 77 students to see whose coffee reigns supreme.
Starbucks student votes latte prices: small - $2.95 medium - $3.65 large - $4.15
58
Dazbog student Votes
— 19
latte prices: small - $3.15 medium- $3.80 large - $4.15
“I like the sugary crap and all that at Starbucks but the regular coffee stuff at Dazbog.” — Becca Borowski, psychology major
#financialgenius
News Briefs >>Man stalks, attacks two women on Auraria campus near Arts building Auraria Campus Police are still investigating an incident that reportedly occurred in the Arts Building near the women’s restroom on the first floor. Two women were walking when they noticed someone stalking them. The suspect followed the two women from the Tivoli to the Arts Building. The women entered the women’s restroom on the first floor in hopes of losing the suspect. The suspect physically grabbed one of the women before she entered the restroom and attempted to kiss her. She broke away and entered the restroom. After waiting a while, the two women exited the restroom and saw that the suspect was gone. No more info has been released concerning the suspect’s description or possible whereabouts. Follow the developing coverage of the Auraria Campus Police investigation online at mymetmedia.com.
>>New Tivoli policy revision makes third floor off limits to general public
Want an A+ in financial education? You can borrow our notes. Visit the Student Union—a free online resource from U.S. Bank built to equip you with knowledge to help manage your money, now and in the future. Get a chance to win a $5,000 scholarship by completing our easy online 1 modules at usbank.com/studentunion
No purchase necessary. 1. Scholarship eligibility restrictions apply. Refer to usbank.com/studentunion for details. Credit products offered by U.S. Bank National Association. Deposit products offered by U.S. Bank National Association. Member FDIC. 150378 3/15
XX5
The Tivoli Student Union third floor access will be restricted to only students, faculty and university workers. The general public will not be allowed on the third floor. The second, which contains banks such as a branch of the Public Service Credit Union and the new Starbucks coffee house, and the first floor whose food court houses a McDonalds, Taco Bell and Subway will still be open to the general public. Auraria Campus Chief of Police Michael Phibbs said most students will not be asked to pull out their ID. If they appear to be students with book bags and laptops, they are likely to not be stopped. If someone were to come in with a sleeping bag or pillows, Phibbs said that type of activity would catch their attention.
>>MSU Denver fall semester student enrollment is down at least five percent
MSU Denver released a preliminary fall 2015 enrollment report, which said that this semester’s headcount of 20,112 is down 5.33 percent from the same time last year. Fall 2015 application reports from Aug. 15 said new applications are down four percent and accepted applications are down three percent. A total of 478 graduate students are attending MSU Denver this fall. The most represented program was the Masters of Professional Accountancy. with 132 students.
Met
Opinion
July 23,27,2015 August 2015 themetropolitan mymetmedia.com 6 @themetonline f:
Want to join the conversation? All opinion articles are online at mymetmedia.com. mymetmedia.com f: themetropolitan @themetonline
Flirt with failure: Cultivating tools for success ideas that society has conditioned in you since your birth. Along this journey you will face a mountain of challenges, fears, heartaches and failures. This all sounds scary and can convince you to remain as cautious and calculating as possible in the hope of avoiding such pains. If you take the route of cautiousness, you may come out unscathed, but you will lack something important to your being, your essence. You will lack life experience that is your own. Since the moment you were
By Aaron Atencio aatenc11@msudenver.edu This is not a promotion for lack of effort in your academic career. Instead, it is a gift from life that if you chose to accept it, you will transcend the person you are now and reinvent yourself. The path you are about to embark on is a journey, it is a moment in your existence that will set the tone for how you will come to navigate your way through life. You are entering a new world, a world where you carry a load of self accountability and selfguidance, along with the load of
You have welcomed a storm upon yourself, a storm essential to the creation of your essence. born, you have been the product of your environment and the ideas imposed upon you by society. These ideas tell you that there is a blueprint to achieving success. Society tells us that if you choose to follow this blueprint, you too can be successful. You can have the big house, the fast car and a “hot” significant other. You can live the American dream.
For some of you, this may be the dream in your heart. If so, pursue it with undying commitment. Though, for others, your gut and heart may be telling you otherwise. Your friends may urge you to do one thing and your family may be pushing you down another path, while society and its “norms” are pulling you in a different direction. For those of you struggling with this, turn off your brain, it is simply processing past information. Feel your gut and follow your heart, it is rooted in this moment. When you do this, you are creating something brand new. During this experience, you have removed yourself from the arena of comparison, this narcissistic, neurotic feedback loop by which society tells us to gauge our success with the success of others. You’re creating your own life experience, you are creating your own dream. You have welcomed a storm upon yourself, a storm essential to the creation of your essence. Within this storm you will face obstacles that will test your bravery and resolve. On this journey, you will fail over and over again. So
what do you do when faced with this storm? You stay resolute on your journey, you go deeper into your storm and fail over and over. In the face of this failure, you will grow. The growth you experience creates the foundation in which you earn the tools to cultivate success for yourself. It will give you something that can’t be measured by our social standards --the big house, the looks of your partner or the price of your car -- instead it gives you the two most important tools in conquering life. It gives you faith in yourself and courage. These obstacles, these fears that life will throw your way will have no choice but to move aside because you have stepped out into the world with faith in yourself and shown true courage. You have done the bravest thing a person can do, you have taken ownership of your heart and to paraphrase Ralph Waldo Emerson, you stayed true to yourself in a world that is trying to change you. So live dangerously. Create your own dream and experiences. Bask in your new found courage and enjoy the moment that is yours right now.
By Tony White rwhite67@msudenver.edu College students perpetually find themselves at the bottom of the college textbook industry mountain. Completely vulnerable to an avalanche of costs that comes tumbling down on them at the beginning of every semester, they are often left battered by the exorbitant costs of their required textbooks. The college textbook
Editor-in-Chief Mary-Kate Newton mnewton5@msudenver.edu Managing Editor Aaron R. Atencio • aatenc11@msudenver.edu
Assistant to the Editor Michel Hansen • mevans41@msudenver.edu
News Editor Justin David Tate • jtate15@msudenver.edu
MetSpective Editor Cassie Reid • creid13@msudenver.edu
Assistant MetSpective Editor Joella Bauman • jbauma17@msudenver.edu
Sports Editor Mike Tolbert • mtolber3@msudenver.edu
Assistant Sports Editor Robert Kemp • rkemp9@msudenver.edu Web Editor Melanie J. Rice • mrice20@msudenver.edu
Photo Editor Alyson McClaran • amcclara@msudenver.edu
Assistant Photo Editor Michael Ortiz • mortiz26@msudenver.edu
Copy Editor Kelsi Long • klong27@msudenver.edu
Director of Met Media Steve Haigh • shaigh@msudenver.edu
Assistant Director of Met Media Jennifer Thomé • jthome1@msudenver.edu
Administrative Assistant of Met Media Elizabeth Norberg • enorbert@msudenver.edu
Production Manager of Met Media Kathleen Jewby • kjewby@msudenver.edu
The ugly model: The crazy costs of college textbooks
MetStaff
industry doesn’t subscribe to the traditional mode of commerce. A widely customary format is the “manufacturer to consumer” model, which is the simple concept of one party provides a product, and a second party buys that product. There may be third parties involved which will transport the product from point A to point B, which drives up the price. However, this basic model of commerce, which applies to nearly every transaction you made today, does not apply to the college textbook industry. The publishers of college textbooks are the manufacturers, but we students are not technically the consumers, our teacher are. Accordingly, the faculty should take this responsibility seriously. In this deformed consumer model, the faculty is essentially the one “buying” the book with money from the student’s pocket. Students are basically forced to buy this book to fulfill the requirements of
the class, and the publishers know this. Thus they are able to slap that three-digit price tag on the textbook you — literally — need. The bookstores claim that their profit margins are very slim, and they do offer some helpful purchasing alternatives, like renting the book for the semester or buying the online version, but every college student knows that when it comes to buying textbooks, you will just have to pay the price you find.
Students are the most important piece in this predominantly capitalist chain of commerce. It’s not fair to the student and it’s not right for the industry to fleece college students who already pay escalating tuition costs and inflated interest rates on their student loans. Students are the most important piece in this predominantly capitalist chain
of commerce. We are the final destination, with the end game being to get our money. That is capitalism. That is commerce. I don’t take issue with that per say, but this also involves the college education of thousands of people — even just on Auraria campus. The prices being slumped upon the backs of college students for textbooks is unjust. Not every college text book is priced like it’s printed on medieval, gold leaf paper and hand scribed by monks. In fact, one text book for a Cultural Anthropology class was found online for only $6, but the other required textbook for that same class was being sold on campus for $180 (and that was the used price.) Is college an industry or an institution which strives to serve the public good? Is the goal to make money or to educate those who desire knowledge? The answer seems to lie somewhere in a gray area, but the dominant color lately seems to be green.
Sales Team sales@mymetmedia.com Jason Griffin• Sales Executive Nate Suchaiya • Sales Executive
Marketing & Distribution Manager marketing@mymetmedia.com Ben Tarver • Senior Marketing Executive Harriet Doyle • Marketing Executive Victoria Jessar • Marketing Executive
What we do The Metropolitan accepts submissions in the form of topic-driven columns and letters to the editor. Column article concepts must be submitted by 1 p.m. Thursdays and the deadline for columns is 9 p.m. Sundays. Columns range from 500 to 600 words. Letters to the editor must be submitted by 5 p.m. Mondays to be printed in that week’s edition. There is a 500-word limit for letters to the editor. The Metropolitan reserves the right to edit letters for formatting and style. All submissions should be sent by email to themetonline@gmail.com. The Metropolitan is produced by and for the students of Metropolitan State University of Denver and serves the Auraria Campus. The Metropolitan is supported by advertising revenue and student fees and is published every Thursday during the academic year and monthly during the summer semester. Opinions expressed within do not necessarily reflect those of MSU Denver or its advertisers.
@themetonline f: themetropolitan mymetmedia.com
August 27, 2015 Date xx, xxxx Met Break Sports Events Review Spective Insight
MSU Denver Counseling Center Fall 2015 Free resources for students
Tivoli 651
WORKSHOPS
303-556-3132 (V/TTY)
www.msudenver.edu/counsel/
To participate in a workshop, you may just show up.
Academic
Personal Effectiveness
Don’t Panic
Overcoming Test Anxiety
Feel Better Fast
Does life seem a little overwhelming at times and you find yourself struggling with panic attacks? The truth is, you are not alone. Come and learn about the nature of anxiety and panic and how you can gain control once again. Facilitator: Theresa Bazacos, Ph.D., Staff Psychologist
Thursday • Oct. 1 • 11–noon
This workshop is designed to assist students who are typically well prepared for tests, but who lose confidence and blank things out on the day of the exam. You will be exposed to specific strategies to reduce your test anxiety. Facilitator: Michael Malmon, Ph.D., Staff Psychologist
Academic Success With ADHD Thursday • Oct. 15 • 11–noon
Thursdays • Sept. 3, 10, 17 and 24 • 3–4 p.m. or Mondays • Oct. 12, 19, 26 and Nov. 2 • 3–4 p.m. or Tuesdays • Nov. 3, 10, 17 and 24 • 11–noon
Yes you can! Come to one or all 4 workshops. This series of workshops will assist you with learning what you can do to 1) improve thoughts and feelings, 2) reduce stress, 3) sleep better, and 4) have more time in your life. Facilitator: Theresa Bazacos, Ph.D., Staff Psychologist
Are you challenged with staying on task, focusing, or with organization? Any of these could be related to ADHD. The goal of this workshop is to provide some basic information about ADHD, such as, how ADHD is defined and identified (diagnosed). Resources that may be helpful will be reviewed. Facilitator: Ray Gornell, Psy.D., Staff Psychologist
Stress Less And Less Stress
Getting Things Done; Strategies For Procrastination Paralysis
Making Time For Time
Thursday • Oct. 29 • 11–noon
Every semester you put things off until the last minute and end up performing less than your potential. Nearly all of us procrastinate at different times for different reasons. Understand the causes of procrastination and learn strategies to better manage your time. Facilitator: Jodie Benabe, Psy.D., Staff Psychologist
Diversity Veterans In Pursuit of A Degree: Navigating The University Culture Mondays • 1–2 p.m. • Sept. 14, Oct. 12 and Nov. 16
Success in the classroom goes beyond the classroom. This workshop Help Veteran Students identify stressors that may be impacting their academic achievements and how to make meaning of the university culture. Facilitator: Steven C. Lee, Ph.D., Staff Psychologist
The Psychology Of Prejudice Monday • Sept. 21 • 11–noon
Prejudice can be hard to talk about openly and many of us hold biases and assumptions that subtly emerge in our daily lives. These assumptions can affect how we feel about ourselves and some of the choices we make, which can also impact our identity development. This workshop will engage participants in discussion of ways to reduce biases and assumptions which can influence prejudicial and discriminatory mindsets. Facilitator: Jodie Benabe, Psy.D., Staff Psychologist
GROUPS
Tuesday • Sept. 22 • 11–noon
Stress has a way of inserting itself into our lives uninvited. This workshop will provide opportunity to examine patterns that may be self-sabotaging and offer healthy coping options. Facilitator: Gail Bruce-Sanford, Ph.D., Staff Psychologist
Tuesday • Oct. 6 • 11–noon
In the real world, it seems there is never enough time. Learn to avoid stalling and manage responsibilities more effectively as you become more aware of your own habits and patterns. Facilitator: Theresa Bazacos, Ph.D., Staff Psychologist
Mindfulness Workshop
A Group of Men
Wednesdays • 3–4:30 p.m. • Sept. 23–Dec. 2
This group will be an opportunity for men to meet, explore and find support for life in today’s world. We will look at ways to manage stress, balance relationships and work towards the goals we have for life and careers. This will be an open ended group and will not have a particular set agenda or curriculum. Facilitator: Ray Gornell, Psy.D., Staff Psychologist
Healthy Relationships Thursday • Nov. 18 • 2–3 p.m.
How do you know if your relationships are healthy? Building healthy relationships takes work. Studies show that people with a strong social network get sick less often, live longer, and have more satisfying lives. This workshop will review the qualities of healthy relationships, as well as ways to effectively communicate and work through conflict. Facilitator: Jodie Benabe, Psy.D. Staff Psychologist
Drinking; When Is It A Problem? Tuesday • Dec. 1 • 11–noon
Dream Interpretation
Loneliness is about a perceived sense of isolation, and the feeling that you are unsatisfied with the relationships you do have. This presentation will review recent studies on the impact of loneliness and will explore ways to reduce loneliness, and increase connection with others. Facilitator: Amy Westergren-Amlicke, Ph.D., Staff Psychologist
People have been trying to make sense and meaning out of their dreams for a long time. Have you ever wondered what your dreams mean? What do they say about you and your conscious waking life? Participants will get to share dreams they have had and we will try to interpret them. We also talk about sleep physiology, sleep talking and sleep walking, common images and themes in dreams, etc. Facilitator: Michael Malmon, Ph.D., Staff Psychologist
Tuesday • Oct. 13 • 11–noon
The Joy And Disappointments Of Parenting
Wednesday • Dec. 2 • 2–3 p.m.
Tuesday • Oct. 20 • 11–noon
This workshop is designed to identify and normalize some of the exciting challenges of parenting as well as provide strategies for managing some of the unexpected struggles that could come along. Techniques for respectful communication will be highlighted. Facilitator: Gail Bruce-Sanford, Ph.D., Staff Psychologist
Department Name
To sign up for a group, call 303-556-3132. Groups require a brief meeting with the group facilitator(s) prior to their start.
This 8-session group explores unhealthy behavior patterns occurring in relationships, and how these patterns can be disruptive to a woman’s emotional and spiritual growth, safety and quality of life. It presents an opportunity to identify red flags to look for, signs of less optimal dating choices. and evaluate past relationships. The first 8 women to RSVP and complete the workshop will receive a copy of the book utilized in the workshop. Facilitator: Steven C. Lee, Ph.D., Staff Psychologist
Do you cringe at the thought of having to talk to strangers, give a speech, or make a phone call? Do you worry about how others might judge you or find your self ruminating about past social ‘mistakes?’ This 8 week program will help students identify and offer strategies to change fearful thoughts, learn communication and social skills, and practice ways to manage anxiety-provoking situations. Facilitator: Jodie Benabe, Psy.D., Staff Psychologist
This workshop provides information on some of the causes of Bipolar Disorder; how to recognize the signs and symptoms, and how to cope with some of the unpleasant aspects. Facilitator: Gail Bruce-Sanford, Ph.D., Staff Psychologist
Loneliness And Connection
This group will provide a safe, supportive environment for students who have experienced the death of a loved one such as a parent, family member, friend, or partner. Students will be provided the opportunity to express and process thoughts and feelings related to grief as well as learn ways to gain support and cope with loss. Facilitator: Theresa Bazacos, Ph.D. Staff Psychologist
Tuesdays • 1–2:30 p.m. • Sept. 22–Dec. 1
Thursday • Oct. 8 • 11–noon
Mindfulness practices have proven helpful for many individuals. This workshop will introduce, discuss the concept, and practice mindfulness exercises, demonstrating the ways it may be beneficial for you. Facilitator: Ray Gornell, Psy.D., Staff Psychologist
Women’s Relationships
Social Confidence
Understanding Bipolar Illness
This evidence-based workshop on substance will discuss drinking in moderation, strategies to reduce risk as well as information that challenges common beliefs and attitudes that directly contribute to high-risk alcohol and drug use. The phase model of alcohol abuse will be discussed and referral resources will be provided. Facilitator: Amy Westergren-Amlicke, Ph.D. Staff Psychologist
Thursday • Oct. 8 • 3–4 p.m.
Living With Loss
Mondays • 1– 2:30 • Dates: Sept. 21– Nov. 30
Thursday • Nov. 5 • 11–noon
Wednesdays • 1–2:30 p.m. • Sept. 23–Oct. 25
Daring Greatly: Interpersonal Processing Thursdays • 1–2:30 p.m. • Oct. 1–Dec. 3
Do you ever worry or feel that you just aren’t good enough– beautiful enough, successful enough, thin enough, popular enough, loved enough, worthy enough? Do you want to learn more about yourself and improve your ability to form and maintain relationships? Group counseling is a safe, supportive place where participants can share thoughts and feelings, give and receive support & feedback, connect with others, and practice new behaviors that can lead to more satisfying relationships. This group will discuss concepts from researcher/author Brene Brown’s book Daring Greatly to enhance participant learning and self-awareness. Facilitator: Amy Westergren-Amlicke, Ph.D., Staff Psychologist
Experiential Therapy: Interpersonal Processing Tuesdays • 3–4:30 p.m. • Sept. 29–Dec. 8
This therapy group is designed for individuals who desire growth, insight and awareness of both self and others by relating effectively with other group members in an environment that is non-threatening and safe. Typical presenting concerns of group members include relationships, self-esteem, assertiveness, and social anxiety. The overarching goal of this group is to facilitate self-growth and development and to enhance interpersonal relationships, as well as their view of themselves. Facilitator: Michael Malmon, Ph.D., Staff Psychologist
EVENTS National Depression Screening Day Monday • Oct. 5 • 11 a.m.–2 p.m. • Tivoli MultiCultural Lounge
The Counseling Center will be providing free screening as part of National Depression Screening Day, open to the community. Mental health professionals will be available to answer your questions and concerns. FREE refreshments.
XX7
mymetmedia.com f: themetropolitan @themetonline
rit o av f r
e K M ET
Ra d
io
sh ow?
INVITE YOU AND A GUEST TO A SPECIAL ADVANCE SCREENING OF
yo u
Mile Spective Break High Events August 2015 Met Date xx,27,xxxx Sports Review Insight
M i ss
8XX
WEDNESDAY, SEPTEMBER 2 @ 7:00 PM STOP BY THE METROPOLITAN TIVOLI STUDENT UNION, SUITE 313 STARTING TODAY AFTER 10AM TO RECEIVE YOUR COMPLIMENTARY PASSES! Must show a valid student ID RATED PG-13 Passes received through this promotion do not guarantee you a seat at the theatre. Seating is on a first come, first served basis, except for members of the reviewing press. Theatre is overbooked. Passes received through this promotion do not guarantee you a seat at the theatre. No admittance once screening has begun. All federal, state and local regulations apply. A recipient of tickets assumes any and all risks related to use of ticket, and accepts any restrictions required by ticket provider. EuropaCorp, The Denver Post, Ticktbox, and their affiliates accept no responsibility or liability in connection with any loss or accident incurred in connection with use of a prize. Tickets cannot be exchanged, transferred or redeemed for cash, in whole or in part. We are not responsible if, for any reason, recipient is unable to use his/her ticket in whole or in part. All federal and local taxes are the responsibility of the winner. Void where prohibited by law. No purchase necessary. Participating sponsors, their employees and family members and their agencies are not eligible. NO PHONE CALLS!
Don’t worry! We have you covered.
Every show is podcasted.
www.mymetmedia.com/kmetradio
IN THEATERS SEPTEMBER 4 TheTranspor terRefueled.com / TheTranspor terMovie |
/ TheTranspor ter |
/ TheTranspor ter | # TheTranspor ter
METROPOLITAN THURS 4/16/2015 B&W 5” X 7” SS ALL.LTB-P.0416.METRO
CALL CALLFOR FOR SUBMISSIONS SUBMISSIONS THIS THIS YEAR’S YEAR’S THEME: THEME:
PERFORMATIVITY PERFORMATIVITY
WORK WORK
GETGET
YOUR YOUR
PUBLISHED PUBLISHED ISSUE ISSUE ONEONE
DEADLINE DEADLINE
10.31.15 10.31.15
SUBMISSION SUBMISSION GUIDELINES GUIDELINES MYMETMEDIA.COM/METROSPHERE MYMETMEDIA.COM/METROSPHERE
Spective
Met
The Denver Voice publishes a new issue monthly and continues contributing to ending homeleness with your $2 donation. @themetonline f: themetropolitan mymetmedia.com
August 27, 2015 mymetmedia.com f:themetropolitan @themetonline August 21, 2014
9
A voice of Denver starts with the Denver Voice
<<PAGE 1
This story for television was not a story of defeat or sadness, but one of triumph. It was a story of a man who has become a fixture on the Auraria campus where it meets the Colfax light rail station. His story will be one of the 10 volumes in a series called “The African-American Voices of Denver.” Each will contain a story told by a notable African-American from Denver and is set to air next February on PBS. Alexander did not begin his journey in Denver. This was a home he found as he traveled across the country, following any scheme that could lead to a pay out. . Denver was also the birthplace of his addiction to cocaine. Talking with Alexander, it was apparent that he was not eager to recall his life of crime and addiction. “I went from being a married man with a house and kids to bouncing checks, losing the house, my wife, my children. Everyone has left you, and you kind of know that you’re lost and in another world,” Alexander said. Alexander became eager when he talked about the actualization of his potential and what he saw as the solutions to chronic homelessness. This involves educating the public on the causes of homelessness. Engaging with others will allow for the cultivation of understanding, and once people understand these experiences, the seed for change can be planted. “It is really interesting how open and honest he is,” said Laura Thompson, executive director of the Denver Voice, a newspaper sold by homeless vendors. “I have heard him tell his story about growing up and how he got to where he is in life, and it’s amazing that he can have the attitude that he does.” Thompson has only been with the Voice since July 2014, but she said that Alexander is very well-known and admired not only in the homeless community but beyond. For those who know Alexander it’s difficult to mention him without speaking highly of him and his accomplishments. “It is definitely notable that he has made so many relationships and has an impact on people,” Thompson said. “He was dubbed the honorary mayor of Stapleton about a year ago because he does a lot of work with people there as well as on Auraria Campus. We keep his plaque on the wall.” His position at the Voice was the catalyst that began the changes in his life. He’d heard about a program where homeless people could earn money. The program helps homeless people create income and self-sufficiency by allowing them to buy their newspapers at a fraction
John Alexander stands outside South Classroom selling newspapers to passing students Aug 25. Alexander has been selling newspapers on Auraria Campus for almost seven years and has a growing community of friends on campus. Photo by Michael Ortiz • mortiz26@msudenver.edu
“Everything in life is a chapter — no one chapter makes a book. No matter how long it is, the chapter will end, but that doesn’t mean the book ends.” John Alexander of the price of the suggested donation amount of $2. Alexander was told he could start by getting his first 10 papers for free and so started his journey with The Voice. This paper would eventually introduce him to people from all different walks of life and a love of writing. Not only could he distribute the paper and make money, but it funded his ability to create artwork that he could sell at the same time. The art cost a few dollars to make but sold for more, and initially helped to fuel his drug habit. This was all the Voice and his artwork were at first: a means to an end. But, while homelessness
was still his reality, things began to change as he stood on street corners in the metro Denver area selling his paper. He began to meet all those people from different walks of life that he never realized he would meet, and to his surprise they treated him much differently than he expected. “They treated me like the person I wanted to be, should be and could be,” Alexander said . For a while he lived a double life. He worked all day for the paper — then spent all night getting high, unable to shake a feeling of shame. Alexander finally decided that he was going to kick his drug habit
and become the person advocating for homeless rehabilitation. “I never cut my lifeline with God,” Alexander said. “He gave me an attitude that I wasn’t walking around for twentysomething years thinking, ‘Why me?’ And that’s how I was able to rehabilitate myself.” Alexander wrote a story published in the Voice called “All Roads Can Lead to Homelessness” that won a 2010 award from the North American Street Papers Association. He explained how homelessness is a condition, not a disease, and can be reached from any road in life. The problem, Alexander said, is that the world of the homeless is a mystery and misunderstood by society as a whole. That world is not a kind one, he conceded. It is one that most people do not escape from unscathed, if at all. His perseverance for a better life gave Alexander the courage to find his escape in selling papers at the light rail station at Auraria and Colfax. Though he’d gotten permission to make this a hub for selling his papers, Alexander received a lot of guff from the campus police when he first arrived. Students came to his aid, and they defended his presence on campus. That very spot is where he met Lupe Martinez, an associate professor of education at MSU Denver. “I enjoyed talking with Johnny,” Martinez said. “I thought his story of how he became homeless, what inspired him to get off of drugs, how he stabilized himself with a consistent job with the Denver Voice and selling his art was a human interest story.” David Jackson, associate professor of African studies and curator for “The African-American Voices of Denver” project, stopped to speak with Alexander just as Martinez had, and he realized that Alexander was a special man with a powerful story that needed to be told. Jackson aims to identify people from the African-American community who have stories that need to be heard. “John is an exceptional man with an exceptional story,” Jackson said. “We have a responsibility to preserve and protect the history of the African-American people here in Denver.” After airing on PBS, “The AfricanAmerican Voices of Denver” will be permanently housed in the Blair-Caldwell African American Research Library in Five Points. As for Alexander, you can find him in his usual spot on Auraria campus selling his papers, for now. “Everything in life is a chapter - no one chapter makes a book,” Alexander said. “No matter how long it is, the chapter will end, but that doesn’t mean the book ends.”
10
@themetonline f: themetropolitan mymetmedia.com
August 27, 2015
11
BOTTOMS UP
Beertender Rich Santello pours a Tivoli Brewery beer, Aug. 22 at the grand opening at Auraria Campus. Photo by Alyson McClaran • amcclara@msudenver.edu
Titillating Tivoli munchies prove worth the half-century wait By Justin Tate jtate15@msudenver.edu The Tivoli Brew Pub, which closed in 1969, reopened at the Tivoli Student Union in grand fashion Aug. 22. Hundreds of VIP guests gathered and a full restaurant serving delicious, salty food and smooth beers. For appetizers was a breaded baby portobello mushroom topped with Parmesan cheese and truffle oil. It was served hot and sinfully good. One bite into the fungus is enough to know that something special is on your plate. Next came the queso fundido, a gooey mixture of chorizo and asadero cheese covered in a burnt and bubbly cheese coating. It was served with crunchy corn chips to pierce the coating surface and plow into the cheesiness, forming a crunchy cheeseball that delivers greasy, stomach-filling goodness. Oh the gluttony! The What the Buck Bavarian pretzels were a traditional large salted pretzel, but with an amazing pub mustard that zinged and creamed just right. The sweet hot Brussel love was essentially Brussels sprouts mixed with a honey Sriracha dressing that provided just the
Jonas Kurronen, Sales Representative for Tivoli Distribution, leads a tour of the new Tivoli Brew Pub at Auraria Campus. Photo by Michael Ortiz • mortiz26@msudenver.edu
Suzie Foster applauds as Corey Marshall speaks in the Tivoli Turnhalle Aug. 22 about the history of the Tivoli Brewing Co. Photo by Alyson McClaran • amcclara@msudenver.edu
Seth Evans of Rossonian performs a solo show at the grand opening of the Tivoli Brew Pub, Aug. 22. Photo by Alyson McClaran • amcclara@msudenver.edu
Beertender Jasper Nila pours one of Tivoli Brewery’s own drafts during the grand opening of Tivoli Brew Pub at the Auraria Campus, Aug. 22. Photo by Michael Ortiz • mortiz26@msudenver.edu
right amount of kick to bring taste buds to a spicy tingle. It was a pleasantly palatable kale like chip, without the greasy residue. However, these were only the appetizers. The main course was their Southern Pub Burger. The succulent patty hits the palette with a spicy, salty mix of caramelized onions. It was truly a yummy indulgence.
The What the Buck Bavarian pretzels were a traditional large salted pretzel, but with an amazing pub mustard that zinged and creamed just right. The cheesecake and its caramel sauce may have been baked by Jehovah himself. Best not plan on sharing, lest you forfeit the delicious treat to your partner. The service was excellent, showing a lot of patience toward the indecisive menu-clingers.. The Tivoli brew pub experience is excellent. This restaurant is a good time and a great belly-filler.
For information about the beer program and more photos from the grand opening, visit mymetmedia.com
Met
Reviews
12
Check out the Met’s back to school playlist either on our Facebook page or at mymetmedia.com. mymetmedia.com f: themetropolitan @themetonline
August 27, 2015
“Changing My Major” — Cassie Reid, features editor
“I Can” — Erik Kemp, reporter
What is college without some form of sexual awakening? Yes, the song from the Best Musical Tony-winning “Fun Home” is not in fact about finding a new field to study. Rather, it encompasses the awkwardness, exhilaration and hilarity of your first time while reaching a deeper level of self discovery than most post-coital tunes. In any case, the many academic-themed euphemisms for sex are enough to bring a smile—and a little blush—to your face. Cover from consequenceofsound.net
“My Sweet Summer” — Melanie J. Rice, web editor
“My Sweet Summer” (is gone), by Dirty Heads, is the perfect backto-school song. I’ve appropriated the lyrics to mean the summer season, which swept me off my feet like a summer romance, only to disappear before I knew what hit me. It left me panting for more as I was launched back into life without summer, AKA, the fall semester. Cover from daily.plaympe.com
Tunes for school
Cover from fhittingroom.com.
The Met Staff compiled a playlist for the postsummer blues. Here are some highlights:
“Another Year” — Trevor L. Davis, managing editor
Cover from aloeblacc.com.
Cover from metalinjection.net.
By Dawit Wolday dwolday@msudenver.edu We all have that one album in our playlists that we’ve never listened to, and I’m here to tell you, that album you routinely skip, could be a great gem. For me, that album was Sean Leon’s 2013 debut project, “Ninelevenne, The Tragedy.” Sean Leon, a Toronto rapper who also goes by the moniker Maui Slim, has polished lyricism and a flow that is tailor-made to each beat he raps over. Maui Slim’s lyrics begin with themes of braggadocio and misogyny, but toward the latter parts of the album, expand to display the cracks
in Leon’s psyche and what success means to him. Leon speaks about women and love through “The Tragedy,” which might seem misogynistic at first listen. However, the female whose love he craves the most is actually a car, a Porsche 911, named Madonna. He explains that he craves Madonna so passionately because she represents his success and goals of perfection. The fancy objects are more symbols of his work ethic than just shallow flaunting. The continuity of the story sonically is the work of Jordan Evans, a Grammy-Award winning producer who has worked with Eminem and Drake. There is only one word to describe Jordan Evans’s production: cinematic. You are effortlessly being guided through the story and
“I Need A Dollar” — Deanna Hirsh, asst. news editor The first time I heard “I Need A Dollar” was during the opening of “How To Make It In America,” a show about a young guy in NYC trying to make it. As a New Yorker myself—and someone who knows the struggle of trying, to make their dreams come true, while also making the rent—I related to both the show and the song. The show is no longer running, but “I Need A Dollar” remains an anthem for those of us who still feel that the struggle is real.
For those who get bored with simple 4/4 time signatures while studying or writing a paper, the recently released the album “The Joy of Motion” by the group Animals as Leaders is a must have. The fourth track on the album, “Another Year,” will help you keep your energy up on those long study sessions.
‘Ninelevenne’
Featuring the hook from Ludwig van Beethoven’s “Für Elise” and the drumming bounce from The Honey Drippers’ “Impeach the President” Nas creates his own powerful message of staying in school, working hard, and being what you want to be. Simple, positive and motivating, Nas’ “I Can” is an ongoing reminder that your personal educational grind can turn your dreams into reality.
don’t even realize that the track has advanced. The instrumental progressions and silences cleanse your palette and prepare you for the next taste. For a debut project, Leon shines and has already carved his individual path creatively. This project is filled with diversity that allows you to listen to it at the club or the library. If you want to be the person that is on up-and-coming artists before they explode, Sean Leon, and his debut album “Ninelevenne, The Tragedy” is a great bet.
A Cover from audiomack.com
Sports
Met
Visit mymetmedia.com for the latest on soccer preseason games and photos of The Regency Athletic Complex. @themetonline f: themetropolitan mymetmedia.com
August 27, 2015
1213
Roadruckers make comeback after 5 year hiatus By Mike Tolbert mtolber3@msudenver.edu Men’s and women’s soccer aren’t the only European pastime generating talk on campus as the fall sports season kicks off. The Metro men’s Rugby club is having a breakout preseason in their first year back as an official club in years. “This isn’t the first time rugby has been on our campus,” club President Austin Cagaanan said. “They terminated the program about five years ago and we’re bringing it back.” The man who initiated the resurgence is affectionately known as Coach Taffy. He is the head coach for the Roadruckers and has over 40 years of experience as a player and coach. He, along with two of his assistants, made the decision to bring rugby back to Metro after seeing an increase in involvement all across the country and state. Metro eventually found themselves in the Frontier League of the National Small College Rugby Organization. The FL has a field of six other teams, some of which are familiar foes of the Rocky Mountain Athletic Conference. Schools like UC—Colorado Springs, Mesa State and Colorado State—Pueblo will see the Ruckers at some point
during their six games of league play. The Roadruckers recently had 36 students participate in one of their practices — the most since its return. Usually held Tuesdays and Thursdays throughout the summer, the team plans to add another practice day to its schedule now that the fall semester is underway and participation is up. Experience is no factor as they take all walk-ons. Phil Sevier, a Roadrucker member said, “We have guys who have never played rugby before and we have guys who have been playing since they were kids.” Not only is no experience required, but whether you attend UCD or CCD — as long as you’re a student on the Auraria campus, you can join. Although the league tournament is for men only teams, your gender doesn’t necessarily disqualify you from playing either. “We welcome everyone to come out and practice — male or female — and hopefully we’ll be able to field a women’s team soon,” Sevier said. Players who join will learn basic rugby techniques, one of which has helped keep injuries minimal in this high contact sport. “The tackle,” a technique that teaches players to take their head out of the play was created by
ATAVUS, a company dedicated to growing the game of rugby. The near-shoulder to near-hip tactic better known as “cheek to cheek” is a form of rugby tackling that allows the defender to safely tackle the opponent in a restricted area. Another reason why injuries are less likely to occur is due to the equipment each player has or lack thereof. The league law states that anything hard plastic or metal is prohibited on the field of play. “The closest we get to wearing plastic is our cleats,” Cagaanan said, who is also an ATAVUS intern. “And there’s still restrictions on those.” Sevier agreed when he said “As soon as you put on plastic, it’s a weapon. If you don’t have anything on your head, you won’t try to hit with it.” The Roadrucker’s next game is a friendly match against the Northside Mauradrers Aug. 29 in Thorton. Pending approval from the University, the Ruckers have high hopes that they’ll be able to call The Regency Athletic Complex home before their first scheduled home game against Mesa State on Oct. 3. For practice locations contact Austin Cagaanan at acagaana@msudenver.edu as they vary.
Metro senior rugby player Philip Sevier poses for a portrait before hitting the practice field Aug. 25. Photo by Alyson McClaran • amcclara@msudenver.edu
Men’s soccer ready to kick-off season By Nick Reilly nreilly19@msudenver.edu
Metro junior forward Josh Belfrage streaks down the sideline as he eyes the goal on Nov. 5 2014. Photo by Jason Colbourne • jcolbour@msudenver.edu
With Metro’s fall sports fast approaching, men’s soccer have been training hard for the start of their upcoming seasons. The Runners tied with Regis University at third place with 74 points, trailing behind Colorado School of Mines with 96 points and Fort Lewis with 79 points in the Rocky Mountain Athletic Conference preseason poll. The teams were voted on by head coaches from each team in the conference. Juniors Dustin Berg and Josh Belfrage, and senior Danny Arrubla were all named preseason all-RMAC. These awards have given the Roadrunners motivation to work hard every day in practice
and strive for greatness. Men’s head soccer coach Jeremy Tittle, who was appointed interim head coach in July said, “A big area we’re good at is team environment, and it’s the best I’ve seen in my six years of coaching, and it’s continuing to grow.” Watch for the Roadrunners’ teamwork skills this season as a game plan for success. Team environment has been emphasized in all practices and is one of the main focuses for the future. With the return of ten starters from last season’s team, the Runners have been able to mature together. “We are a veteran team with 13 juniors and only one senior, with six new players that will play an important role in the season,” Tittle said. The maturity level rose since
last year and will make an impact on the field during this season for the individual players and for the team. Countdown to men’s soccer has been going on for months now, and the wait is finally over. They will host their alumni game on Saturday, Aug. 29 at 7 p.m., as part of alumni day. The women’s soccer and volleyball teams will also play alumni games that day. We will see the first regular season home game at The Regency Athletic Complex on Friday, Sept. 11 at 4:30 p.m. when they play Newman University. With the improvements made in the offseason, the Roadrunners are eager to start their season off strong.
XX 14
mymetmedia.com
Date xx,27,xxxx Met High Events August 2015 Mile MetBreak Sports
f: themetropolitan
@themetonline
Looking ahead Women’s Soccer 9.03: vs. West Texas A&M Time: 5:30pm MDT Location: Canyon, Texas
Women’s Golf 9.07: vs. WolfPack Fall Invite Time: all-day event Location: Pueblo C.C.
Men’s Soccer 9.04: vs. Dixie State Time: 8pm Location: St. George, Utah
Tennis 9.11: vs. Nebraska-Kearney Time: 8am Location: St. George, Utah
Cross Country 9.05: vs. UCCS Time: all-day event Location: Colorado Springs
Women’s Soccer 9.11: vs. Cal Poly Pomona Time: 7pm Location: The Regency Athletic Complex
Graduating this semester?
Here’s what you need to know: The deAdline To submiT The ApplicATion for grAduATion is 5 p.m., sepTember 4 in The regisTrAr's office, ssb 160. if mAiled They musT be posTmArked on or before sepTember 4. 1. All students wishing to graduate must apply for graduation. Applications are available in SSB 160 or online at www.msudenver.edu/ registrar/student/forms. 2. You must meet the following requirements by the end of the semester you apply for graduation: Minimum of 120 semester hours All requirements for your major and minor All General Studies requirements Minimum of 40 Upper Division credit hours Multi-cultural requirement Cumulative GPA of 2.00 or higher
3. Walking in the commencement ceremony does not guarantee that you have graduated. 4. It is your responsibility to report any repeated courses to the Office of the Registrar. Failure to do so may negatively affect your ability to graduate as planned. 5. If you apply for graduation but end up not meeting all requirements, you must reapply for a subsequent graduation. 6. Diplomas are not provided at Commencement. You will be notified on how to obtain your diploma.
For additional information, visit:
www.msudenver.edu/registrar/student/ graduationevaluation and www.msudenver.edu/commencement.
Office of the Registrar
ARMY RESERVE
WHERE AN OFFICE BECOMES A COMMAND POST.
There’s a place where you can gain an education and life experience like no other. That place is the Army Reserve. As a Soldier in the Army Reserve, you can build the future you want while serving your country and community at the same time. There’s strong. Then there’s Army Strong. Learn more at goarmy.com/reserve.
For more info, visit your local Denver Recruiting Center at 900 Auraria Parkway or call (720) 904-2174.
©2015. Paid for by the United States Army. All rights reserved.
@themetonline @ heme on ne
heme opo an f: themetropolitan
mymetmedia.com myme med a com
Date xx,27xxxx Augus 20 5 Met MeBreak Events Spo s
XX 15
Volorist, Vo or s teniam en am esed qua quatur ur so solut u vero do dolo o qu qui nonesc nonesciaa porerch porerchillaa comn comniss quo do doluptia up a vo volorum orum qu quiberi ber au aut pra pratur ur max maximol mo orer oreribusti bus b blandel ande luptatur up a ur au aut qu quiassitas ass as resed resediss qu quidunt, dun id dm min n perum, corrum cu perum culliquamus quamus m min n ea eatem em au aut u utati a b blanihit an h max maximolupta mo up a pre so solorru orru p ptatium a um re reictae c ae litiorestia ores a ap apiss aperch aperchit eet es amus amus, ssitios os qu qui tee p placid ac d exp explabo. abo Labore Laboreius us esen esento ob blaborite abor e vo volororculparum aboreperchil estiaerae rum recea receat h hiciendictum c end c um eos audae eet do dolendipis end p s au aut ea eat as eet m mi, op optas as eetust us omn omnimin m n ccienihit en h porpor porporit do dolupta up a qu quibus bus que mos so solori or accum asped evero eet und undi cu cul dentusdam restrum rerchil mo molestem. es nem E Et exp explab ab inctori nc or dollit do offi offic cil magniss magn ss imustinvelia mus nve a nus.Icti nus Ic restion res on sen sentum um dun dunt ex end endit e et impos mpos arch archit e et do dolor or rec rectaectassi aec ass rem do dolo o exden usdam laborro aborro res rum re porem rerch u b g a vo earra cesequ cesequi rer rerio ob blaut au mo moluptas up as m mincil nc excea cor ratiis s er eribus bus e etus us a aliandia and voloreius ore us saessusc saessusciis s s si au aut qu quibus, bus s sim m do dolorem orem persperum accae accae. U Ut a atiamus, amus que s site e asp aspidel de ipis p s e ellaut au fugit ug ommo que y h a e d us s k a nones au aut lam am esequod esequoditam, am nos do dolorio or o que ad adion on ea d disinimaior ssnepma or mo molorum orum eos alitmve vel mo vo volupta up a ssimpor mpor accabor epudaesed que ve velitaa cus ssimusam musam quod quodiss eet, quam quam, omn omniaa cu cullese ese num nec nectur ur k u Cou ndo eas e Aorec ur? As u v p sequ sequiam am do dolorectur? ulpa sum inusda nusda qua quatas et excer excerit qe q qlkwdacm’lk;we,c kwdacm k we c lqw;casdl;c,lwc qw casd c wc ,lw;c,l;’ w c , wc wcl ;awl,fpoqwe aw poqwe a a,;s,dut s d u a asper os nu aborum omn m accaecerum sun e us Arc alitasperios nullaborum, omnim faccaecerum eos ma sunte ius.Arcilhopa ue N d b owno ber landic and c to omtende nvendus es erup eruptam am nus nust volorro orroBvo volo o impostio mpos beri con rem qu quiss oap apicid c d qu qui u ut liquam, quam u ut do doluptatecto up a ec o to o cum h hit lab ab inumquia numqu a ad aditae ae nes vo voluptatem up a em facessi acess mo molorehenis orehen s re reiumet ume k vo eady rch invendus aende us o ma c vo up a em quod os eet omn num ab ipiciis pu c s do upA a tionse onse des rehende raep a Un h esc psun m num qua as ren m nver erem voluptatem quodi cum maios omnimini dolupta raeptat.Unt hitiss mo consed mo molesci psunt, sum har hari u ut ac acimi, quatas rent qua quat iminverferem shore um n resseque g b ack u oa end e que omn c s s mus accup a qu n magn s a pra ur anduc e n mporporum con par es a ande vo orrun am nob s s commos p c en od o asperro d quo cum qua us omnitate odiciisitis imus accupta qui nimagnisita pratur anducie nimporporum parit, utatend elestia tiande volorrunt lam nobistiis ipicient odi totasperro id quatius k a e od k us d k a none reprate ssuntio quationsenet digento elenis ant ut que nem sim et omni disquam cus alia doloratem qui kd akew v akmsv dessequ iatibust, a bus as o of ;la’jert, a erk aalkopfe kop e as aslkdjfakewjv akmsvlcum, cum sit s quis qu s niet n e c ratque ra que repra e ssun o qua onsene d gen o e en s an u s m e omn d squam a a do ora em qu e r k o d mo cup a ur sec omn omniss ne exp explabo. abo P Piss ea eatur? ur? Ame Amet vo voluptatio up a o od odiss do dolupiti up qu quiatiunt.Vit a un V vo vollaci ac lluptin up n erch erchit quae ssitatet a e inum num essend essendit, offic officti nve nveliquis qu s de del illit, u ut qu qui vvid cuptatur sectotature, o a ure sed eaqua eaquatee eet c a x u ut ve vel iusae usae eeicc tem em am facerrumene acerrumene n niss m minverum, nverum so solorrovitia orrov a comn comnitA fuga. uga Ap Apiene ene comnis aceatquo quo omniam am laborro aborro commod commodisti s b blaborepe aborepe n nimpos mpos eet andae as asin nn nim m nob nobiss mo molo o offic officil laborunt aborun b comn us s acea h omn houg e eeto eum eetur, ur ve ec em eumquo eet qua ur resequ aut lam, sequi tota versperit explitati ulparum enihita volupit quunt velectem quatur resequi asper au am sequ o a versper a rem latquam, a quam u parum en h a temolo emo o vo up quun asperavro dolessint qui bereped quamend itaecest, ofA exp g b up a inci A c dusc d eum faccate u up a s ssitiorem fictiiss am illuptatis ent es p plit, u ulparuptibea parup bea do doluptia quibus autem adiciduscid ullore magnimp oritatquo veligenime voluptatum eatisit quiaa num fic orem en nc qu bus au em fugia ug a ad acca e mporundam u ore magn mp or a quo ve gen me re eet vo up a um ea s qu capa aur ssi od minveli ssequiaa qu quiss eum facipsam poriaa vo volut reperfee res restrum veliasp eribuscia doluptatur vel isciet apist omniae modit quo m nve ssequ ac psam audae ssit por u reper rum ve asp er busc a do up p end tinctotatam nc o a am que ve sc e ap s omn ae laciliqui ac qu ium um iur ur aaliquodis quod s mod m xodiss ipiendi ape apelit aatemqui emqu ssimporio mpor o in np plandae andae cctesequia esequ a quun quunt, sun suntorem orem quun quunt imusape musape lissuntis ssun s eos eostiassit ass ea duc duci vo volenem enem poren porenih h iciamv’ c amvee ak akfe;lawejrt e awe r asd asdlfk fkaal,veamw veamw m m,am;lve, am ve ’l;a,vd,vl a vd v l;a,vd,vlantiostem que num us Bet, invendeni so solupti up or oribus bus eeliss repe repelit ra rat.Itati I a bero id d qu qui rer rerions ons equa equaturerume urerume pe pel mod modipsum psum quo omn omni qu quissncarum nvenden n ni ommod ommodit que int n vo volorerspe orerspe iminvenim m nven m qu quid d mo molupti up aessequae ne net, tor or sus sus. ude e Bernatiant, abo. Ca Catatia ditatibus nieture repeligendam nihiciandae am, nullaa vo volorro event fuga. exerestiae vendicabo. Pudiss Berna an ssit que abo a a tquasi quas accusae pra d a bus n e ure liss repe gendam ssi dem n h c andae nosae am quae nu orro quod even uga Tem eum illam am exeres ae vend cabo Pud nacx tiafemakundiciis cum et estectat volorum ut esc esci desc descidi d vo voluptatur?Optas up a ur?Op as eelecus ecus eet d ditibus bus que vo volentibusam en busam es num lam, am occaborpos ssimusda musda nderc ndercim agnatquam, so solo o es est, u ut omn omnit u ut deb debitiaa tiafemak a emak mp quam u mc agna e up bus vo lant an am fugiaectius.Nam, ug aec us Nam so solorpor orpor ad eum ssint n quo do dolum um re sun sunt laborectur aborec ur au autas as au aut lam, am ssimusda musda ea eatibus bus ma do doluptibus voluptas up as ra rat ac acid d exp explam am eet verem vo volupta up a turitae ur ae porem vererae sum fugia antur rehendit liss cup cuptius maximin cusandi gen gentisque magnienti utemqui officip autufaccupt asimagnis nimusda dolupie ntincitaquo nihit, ug a inullore nu ore an ur rehend us max m n cusand sque magn en u emqu offic p icipsan c epsan imolor mo or au accup as magn s n musda sequo occae do up e n nc aquo eet lab ab idusdae dusdae n h eam g veribusam ver busam quam ne sundam har harit eum vo volorrum orrum qu quisquuntio squun o consequun consequunti de deliquiame qu ame coresequa coresequat u ut vene venetur?Dus ur?Dus deb debitius. us Hen Henihicieni h c en tetavetk’k e ave k k un untiatquos a quo eeliquo quo que eetur? u ? Qu Quis aasperior pe o am faces ace eet quo
Visit mymetmedia.com/jobs
Use your Words
d ommo tempore empo e rumquia umqu a tusandi u and offica officatur u siminct m nc ecabo ecaboree ea qu quiaa sequat equa reseditia e ed a cu custibus bu u utem em en enimus mu p prem em idest, de sim m ape apel inulparum nu pamum ant.Offi Offic ommosae ae roruntem o un em qu qui de des eet do doluptatur up a u aati cum quun quunt qu qui u utempor empo eeribusa bu a ndaec ndaectis au aut hxe cti mban eerum um fugiam ug am id d que qua o e non equa au em do up a tiatus au u a po o au a o e reicti e c bau abo Mo ape ipsume p ume ve men ihiliquas h qua eum inum num aaliquos quo vo up a ommo o um in n ped gn me suntis un au gen quati u ut dempo demporaa vo volore nonsequas autem dolupta ut u utas porror autatiore aut labo. Mosapel vel eet omn omnimen voluptat ommolorum pedignime aut aaligent uremposam ut rae Taquias optiaa nob nobitem moloritia prate perio magnisquam untiatquos Quiss asper asperior u empo am u ae is eetur? u ? Taqu a rehenihil ehen h eet op em is sus, u od mo o ap a e lantemp an emp eelignam gnam aaliaa pe o magn quam ipsam p am aasm.dfnlavkafem m un a quos eeliquo quo que eetur? ur? Qu or am faces aces eet quo tempore empore g d n avka emme
rumquia catur quun qui qu rumqu a tusandi usand offi offica ur siminct s m nc ecabore ea quia qu a sequat sequa reseditia resed a custibus cus bus utem u em enimus eng mus prem idest, des sim s m apel ape inulparum nu parum ant.Offi an Officcti ommosae roruntem rorun em qui qu des et e doluptatur do up a ur ati a cum quunt utempor u empor eribusa er busa ndaectis ndaec s aut au erum fugiam ug am id d que quati qua ut u dempora volore vo ore nonsequas autem au em dolupta do up a tiatus a us ut u utas u as xporror autatiore au a ore reicti re c aut au labo. abo Mosapel Mosape ipsume psume vel ve et e omnimen omn men ihiliquas h quas eum inum et num aliquos a quos voluptat vo up a ommolorum ommo orum in n pedignime ped gn me suntis sun s aut au aligent a gen uremposam ut u rae iss etur? e ur? Taquias Taqu as rehenihil rehen h e untiatquos un a quos eliquo e quo que etur? e ur? Quis Qu s asperior asper or am faces aces et e quo tempore empore rumquia rumqu a tuuh ee cti ommosae roruntem sandi catur sand offi offica ur siminct s m nc ecabore ea quia qu a sequat sequa reseditia resed a custibus cus bus utem u em enimus en mus prem idest, des sim s m apel ape inulparum nu parum gant.Offi an rorun em qui qu des et e doluptatur do up a ur ati a cum quunt quun qui qu utempor u empor erier h Offic busa ndaectis ndaec s aut au erum fugiam ug am id d que quati qua ut u dempora volore vo ore nonsequas autem au em dolupta do up a tiatus a us ut u utas u as porrorn autatiore au a ore reicti re c aut au labo. abo Mosapel Mosape ipsume psume vel ve et e omnimen omn men ihiliquas h quas eum inum num aliquos a quos voluptat vo up a ommolorum ommo orum in n pedignime ped gn me suntis sun s aut au aligent a gen uremposam ut u rae iss etur? e ur? Taquias Taqu as rehenihil rehenc h et e optia op a nobitem nobn eem sus od moloritia mo or a prate pra e lantemp an emp elignam e gnam alia a a perio per o magnisquam magn squam ipsam psam asm.df asm d enceiss sus, co nlavka,vle;,a;vle,a;l,;la,s;le,r;lakwtoavmd ,la;s,d,e,untiatquos rumquia catur ,la;s,d,e,un untiatquos a quos eliquo e quo que etur? e ur? Quis Qu s asperior asper or am faces aces et e quo tempore empore rumqu usand offi offica ur siminct s m nc ecabore ea quia qu a sequa sequat resed reseditiaa cus custibus bus u utem em en a tusandi s enimus ndaectis aut erum fugiam id que quati ut dempora volore nonsequas en mus prem idest, des sim s m apel ape inulpar nu par ant.Offi an Officcti ommosae roruntem rorun em qui qu des et e doluptatur do up a ur ati a cum quunt quun qui qu utempor ue empor eribusa er busa ndaec s au ug am d qua u vo ore autem u rae au em dolupta do up a tiatus a us ut u utas u as porror autatiore au a ore reicti re c aut au labo. abo Mosapel Mosape ipsume psume vel ve et e omnimen omn men ihiliquas h quas eum inum num aliquos a quos Avoluptat vo up a ommolorum ommo orum in n pedignime ped gn me suntis sun s aut au aligent a gen uremposam ut y asm.dfnlavktiatquos iss etur? e ur? Taquias Taqu as rehenihil rehen h et e optia op a nobitem nob em iss sus, sus od moloritia mo or a prate pra e lantemp an emp elignam e gnam alia a a perio per o magnisquam magn squam oipsam psam asm d n avktiatquos asm.dfnlavk a quos eliquo e quo que etur? e ur? Quis Qu s asperior asper or am faces aces et e quo tempore empore rumquia catur rumqu a tusandi usand offi offica ur siminct s m nc ecabore ea quia qu a sequat sequa reseditia resed a custibus cus bus utem u em enimus en mus prem idest, des sim s m apel ape inulparum nu parum ant.Offi an Officcti ommosae roruntem rorun em qui qu des et e doluptatur do up a ur ati a cum quunt quun qui qu utempor u empor eribusa er busa ndaectis ndaec s aut au erum fugiam ug am id d que quati qua ut u dempora volore vo ore nonsequas autem au em dolupta do up a tiatus a us ut u utas u as porror autatiore au a ore reicti re c aut psume vel ve et e omnimen omn men ihiliquas h quas eum au labo. abo Mosapel Mosape ipsume inum num aliquos a quos voluptat vo up a ommolorum ommo orum in n pedignime ped gn me suntis sun s aut au aligent a gen uremposam ut u rae iss etur? e ur? Taquias Taqu as rehenihil reheno che et e optia op a nobitem nob em iss sus, sus od moloritia mo or a prate pra e lantemp an emp elignam e gnam alia a a perio per o magnisquam magn squam b ipsam asm.dfnlavkuntiatquos catur asm.dfnlavkun untiatquos a quos eliquo e quo que etur? e ur? Quis Qu s asperior asper or am faces aces et e quo tempore empore rumquia rumqu a tusandi usand offi offica ur siminct s m nc ecabore ea quia qu a sequat sequa reseditia resed a custibus cus bus utem u em enimus en mus prem idest, des sim s m apel ape inulparum nu parum ant.Offi an Officcti ommosae roruntem rorun em qui qu des et e doluptatur do up a ur ati a cum quunt quunmkqui qu utempor u empor eribusa er busa ndaec s aut au erum fugiam ug am id d que quati qua ut u dempora volore vo ore nonsequas autem au em dolupta do up a tiatus a us ut u ke ndaectis utas u as porror autatiore au a ore reicti re c aut au labo. abo Mosapel Mosape ipsume psume vel ve et e omnimen omn men ihiliquas h quas eum inum num aliquos a quos voluptat vo up a ommolorum ommo orum in n pedignime ped gn me suntis sun s aut au aligent a gen uremposam ut u rae iss etur? e ur? Taquias Taqu as rehenihil rehen h et optia nobitem is sus, od moloritia prate lantemp elignam alia perio magnisquam ipsam asm.dfnlavkaercklsaw /clkm;aoklwcimoql,koqxfl wa,xpl;A kamf dals;,diatquos eliquo que etur? Quis aso magn squam psam asm d n avkaerck saw /c km aok wc moq koqxflwa xp A kam da s d eperior op a nob em s sus mo or a pra e an emp e gnam a a per dals;,d r a e y et tempore rumquia tusandi offi catur ecabore quia reseditia utem prem idest, apel inulparum ant.Offi qui et per or aam e quo empore rumqueribusa usand offica ur siminct serum m ncfugiam ququa a sequat sequa resed acvolore cus u em enimus enautem mus des susmut ape nu parum an Offic rorun emipsume qu desvel e ecustibus doluptatur ati quunt utempor ndaectis que dolupta tiatus utas porror autatiore reicti aut Mosapel do up urfaces aaces quun qu u empor era voluptat busa ndaec s aut au ug am d ea u aligent oreqbus emTaquias do upas arehenihil a sim uet auem a is ore rectiod c ommosae au labo. abo aroruntem Mosape s vo unonsequas cme et ihiliquas eumqui inum aliquos in suntis ut etur? optia moloritia prate elige omnimen omn men hocum quas num a quos vo up a ommolorum ommo orum n pedignime ped gnid sunquati s aut auut adempora gen uuremposam u rae iskamefkam s au e ur? Taqu rehen huf a,;le’ e as op aawnobitem nob s sus, sus mo or pra e lantemp anpsume emp e ve gnam alia perio magnisquam ipsam asm.dfnlavkaveavevaeawveasvadvasvdavawevasvadsvadvsvaveawfeva askdmlkamefk amt amsdklam , lf;,aw fa ,;la,wecl,awe;fl a,fl d;, ,a,sluntiatquos eliquo ,a,sl a a per magn squam psam asm d n avkaveavevaeawveasvadvasvdavawevasvadsvadvsvaveaw eva askdm amsdk am a e a a wec awe fl a fld a s noy reseditia que etur? Quis ama faces et tempore offi catur siminct quia custibus utem prem idest, apel ant.Offi e ur? Qu s asperior asper orup aces e quoquunt empore rumqu aeribusa usand offica ur sm nc ecabore qu quati a sequat sequa resed avolore cusorebus u em enimus enautem mus destiatus susmut ape nu parum an Offic roruntem qui ati utempor erum id ut nonsequas dolupta porror autatiore reicti aut labo. rorun emipsume qu des e doluptatur do ur a ihiliquas quun qu urumquia empor ertusandi busa ndaec s aut auorum ug am deaque qua u Au vo emTaquias do up a sim u optia asinulparum au recti c ommosae au or aboa Mosapel vel et eumqui inum aliquos voluptat in pedignime suntis aligent uremposam ut rae eetur? iss ur? etur? et sus, od moloritia Mosape psume veet e omnimen omn men hcum quas num aasm.dfnlavkjklce;kdmwckl’vwmaec’kl;mq,el;,a;lsc’la,sdcl;,untiatquos quos vo upkndaectis aceommolorum ommo n fugiam ped gnmq me sun s aut au adempora gen u que eauur? Taqu as arehenihil rehen hu eutas op a nobitem nob ema issore sus mo prate lantemp elignam alia perio magnisquam ipsam pra e an emp e gnam a a per o magn squam psam asm asm.dfnlavkjklce;kdmwckl’vwmaec’kl;mq,el;,a;lsc’la,sdcl;, d n avk kdmwck vwmaec k e a sc a sdc untiatquos un a quos eliquo e quo Quis Qu s asperior asper or am faces aces et e quo tempore empore rumquia rumqu a tusandi usand gu offi catur siminct ecabore ea quia sequat reseditia custibus utem enimus prem idest, sim apel inulparum ant.Offi cti ommosae roruntem qui des et doluptatur ati cum quunt qui utempor eribusa offica ur s m nc qu a sequa resed a cus bus u em en mus des s m ape nu parum an Offic rorun em qu e do up a ur a quun qu u empor er busa ndaectis volore autem tiatus autatiore aut labo. ipsume vel et inum aliquos vondaec s aut au erum ug am id d que qua uaut vo ore nonsequas au doTaquias up aas arehenihil us ut u hutas u as au aem oreissreicti re aumoloritia abo Mosape psume ve e omnimen omnalia ho magnisquam quas eum num a quos Adolupta o luptat in suntis aligent ut raeeetur? isur? etur? et sus, elignam perio ipsam asm.dfn up a ommolorum ommo orumfugiam n pedignime ped gn mequati sun sut audempora a gen uque s em e ur? Taqu rehen e porror op a nobitem nob susc od mo or Mosapel a prate pra e lantemp an emp eecabore gnam aeamen aquia peraihiliquas magn squam psam asmutem n e cempore kascdamkl’kamdslkmac;kmewf;lkmwlkamsckluntiatquos amati et quo rumquia tusandi offi siminct sequat reseditia custibus kascdamkl’kamdslkmac;kmewf;lkmwlkamsckl untiatquos un auremposam quos eeliquo quo Quis Qu asperior aces eoptia rumqu usand offica sm nc qu sequa resed cusnonsequas bus u dem o tempore Peum enimus prem idest, sim apel inulparum ant.Offi cti ommosae roruntem qui et doluptatur cumquas quunt qui utempor eribusa ndaectis aut erum fugiam id que quati ut volore en musdolupta des sm ape nu parum anore Offic rorun emipsume qu des es asper do upora men ur afaces quun qu u empor er abusa ndaec scatur auur ug amgn dme qua u dempora voa ore autem tiatus ut utas porror autatiore reicti aut labo. Mosapel vel et omnimen ihiliquas inum aliquos voluptat ommolorum in pedignime suntis aut aligent uremposam ut rae au em do up a a us u u as au a re c au abo Mosape psume ve e omn h num a quos vo up a ommo orum n ped sun s au a gen u is etur? Taquias rehenihil et optia nobitem is sus, od moloritia prate lantemp elignam alia perio magnisquam ipsam asm.dfnlavkut erum fugiam id que quati ut dempora volore nonsequas autem asm.dfnlavk ut u ug am d qua u vo ore au em s e ur? Taqu as rehen h e op a nob em s sus mo or a pra e an emp e gnam a a per o magn squam psam asm d n avk dolupta ut utas porror autatiore reicti aut labo. Mosapl ipsume vel un untiatquos a quoseeeliquo quo que ur? Quisset Qu asperior asper oraam faces eet quo tempore empore rumquia a tusandi usandndaectis officatur offica m nc fugiam ecabore eaque quiaaquati qu sequat sequa reseditia custibus utem enimus prem idest, sim inulparum ant.Offi cti qui doluptatur ati cum quunt qui utempor eribusa aut erum ut resed atiatus cus bus u em en mus desa tiatus sa m ape nu parum ana Offic rorun emeetur? qu doet urmen aaces quun qu inum u rumqu empor er busa sur aussiminct amgnid d qua u d evel ades semp dempora volore nonsequas autem dolupta ut utas porror autatiore reicti labo. Mosapel ipsume omnimen ihiliquas eum aliquos voluptat ommolorum in pedignime vo ore au em do up usapel u uet asoptia au ore re ommosae cod aut au abororuntem Mosape psume vegnam e up omn hmagnisquam quas num a asm.dfnlavkjklce;kdmwckl’vwmaec’kl;mq,el;,a;lsc’;, quos vo upndaec ak ce ommo orum nug ped me esuntis sun s aut au dprate aligent uremposam ut rae is etur? Taquias rehenihil nobitem is sus, moloritia lantemp elignam alia perio ipsam auntiatquos gen u s e ur? Taqu as rehen h e op a nob em s sus mo or a pra e an e a a per o magn squam psam asm d n avk kdmwck vwmaec k mq a sc h d eliquo que etur? Quis asperior am faces et quo tempore rumquia tusandi offi catur siminct ecabore ea quia sequat reseditia custibus utem enimus prem idest, sim apel inulparum ant.Ofun a quos e quo e ur? Qu s asper or aces e empore rumqu a usand offica ur s m nc qu a sequa resed a cus bus u em en mus des s m ape nu parum an O u o fi ctic ommosae roruntem qui et cumquas quunt qui utempor eribusa ndaectis erumin quesuntis quati ut volore dolupta porror autatiore fic rorun emipsume qu desvel e doluptatur do up a men ur ati a h quun quinum u empor er busa ndaec s waut auorum ug amgnid dme quas aut u dempora vo ore nonsequas au do up as a tiatus a us ut uhutas u et au aemore reicti labo. Mosapel et eum aliquos voluptat pedignime aligent uremposam ut rae isautem etur? Taquias rehenihil optia isas re aumoloritia abo Mosape psume e omnimen omn num a asm.dfnlavkascdamkl’kamdslkmac;kmewf;lkmwlkamstiatquos quos vo ommo nfugiam ped sun au a tiatquos gen u etur? sQuis e em ur? Taqu rehen eastempore op a nobitem nob xa ommolorum sus, odaut prate alia magnisquam ipsam eliquo que asperior aces et quo rumquia asm.dfnlavkascdamkl’kamdslkmac;kmewf;lkmwlkams a quos e quo e ur? Qu s asper or e empore rumqu sus mo or ur a siminct pra enclantemp an emp elignam eveea gnam a sequat a perio per ihiliquas oreseditia magnasquam psam asm dmus n up avkascdamk kamds kmac kmew kmw kams tusandi offi catur ecabore quia custibus utem enimus prem idest, sim apel inulparum ant.Offi cti ommosae roruntem qui des et doluptatur ati cum quunt qui utempor usand offica s m qu a sequa resed cus bus u em en des s m ape nu parum an Offic rorun em qu e do up a ur a quun qu u empor epa tiatus eribusa aut fugiam id volore dolupta porror autatiore reicti ipsume et eum inum aliquos auta er busaa ndaectis ndaec sorum au erum ug gn amme d que qua ualigent vo ore nonsequas auur? emTaquias do up a ushut u utas u au a is ore re cod aut au abo Mosape psume vegnam e omnimen omn quassquam num a quos voluptat ommolorum in suntis uremposam ut etur? rehenihil et optia moloritia prate lantemp alia perio magnisquam ipsam asm. vo ommo n pedignime ped sunsquati s aut au ut aordempora gen faces u rae issrumquia eautem Taqu as rehen e sas op a nobitem nob em seasus, sus molabo. orreseditia aMosapel praaecustibus an emputem evel a amen per ihiliquas ohidest, magn psam asm dfnlavkuntiatquos eliquo que Quis et tempore offi catur ecabore quia prem sim d nup avkun a quos e rorun quo e qu ur? des Qu asper aces e quo empore rumqu a tusandi usand offica m nc qu quati a sequat sequa resed cus bus uelignam em enimus en mus desa tiatus samusapel ape nu parum ant.Offi ctireicti aut erum fugiam id que ut dempora volore nonsequas autem dolupta ut porror an Offic ommosae roruntem emetur? qui eetasperior doluptatur do up aam ur aati cum quunt quun qui u qu utempor empor eribusa er busa ndaectis ndaec s ur ausiminct ug am dgn qua us aut vo ore auissem do Taquias up u utas uhinulparum aset autatiore aut labo. Mosapel ipsume vel et omnimen ihiliquas eum inum aliquos voluptat ommolorum in pedignime suntis aligent uremposam ut rae etur? rehenihil optia au a ore re c au abo Mosape psume ve e omn men h quas num a quos vo up a ommo orum n ped me sun au a gen u e ur? Taqu as rehen e opdesa nobitem is sus, od moloritia prate lantemp elignam alia perio magnisquam ipsam asm.dfnlavkseditia custibus utem enimus prem idest, sim apel inulparum ant.Offi cti ommosae roruntem qui nob em s sus mo or a pra e an emp e gnam a a per o magn squam psam asm d n avksed a cus bus u em en mus des s m ape nu parum an Offic rorun em qu et ati quunt qui utempor eribusa ndaectis erum quesun quati ut volore porror autatiore reicti labo. Mosapel ipsume e doluptatur do a ur a cum quun quinum u empor er busa ndaec s aut au orum ug amgnid dme qua u dempora vo ore nonsequas au em do up as a tiatus a us ut uh utas u eet asop au aemore re c odaut aumo abo Mosape psume o ces au vel et omnimen eum aliquos in pedignime suntis aut ut rae isautem Taquias rehenihil nobitem issea sus, moloritia prateae custibus lantemp ve e up omn quas num a asm.dfnlavkuntiatquos quos von up a ommolorum ommo nfugiam ped aaligent gen faces uremposam u srumquia eetur? ur? dolupta Taqu rehen a nob sus or reseditia a pra an emp elignam alia perio ipsam eliquo queem etur? Quis asperior et quo tempore tusandi offi catur siminct ecabore quia eu em gnam amus amen per ihiliquas oh magnisquam magn squam psam asm dvoluptat avkun quos e equo e ur? Qu asper or e quunt empore rumqu usand offica soptia m nc qu sequa resed cus bus utem enimus ant.Offi cticaommosae qui des set doluptatur ati cum qui utempor eribusa ndaectis erum fugiam id quati ut volore nonenautem des susmut ape nu parum an Offic rorun qu evel doet aam ur aaces quun qu inum u empor er abusa ndaec s aut auurorum ugpedignime amgn d que quaa ssequat uaut vo ore sequas dolupta tiatus utas porror autatiore reicti aut labo. Mosapel ipsume omnimen ihiliquas eum aliquos voluptat in suntis aligent uremposam au em prem do upidest, a rehenihil a sim uhapel uet asinulparum auem a ore re au abororuntem Mosape psume ve e up omn men h quas num aasm.dfnlavkseditia quos voavksed up a ommolorum ommo n ped meprem sun audempora a mgen ut rae is etur? Taquias optia nobitem is sus, od moloritia prate lantemp elignam alia perio magnisquam ipsam custibus utem enimus idest, sim apel inulparum u s e ur? Taqu as rehen e op a nob s sus mo or a pra e an emp e gnam a a per o magn squam psam asm d n a cus bus u em en mus des s ape nu parum ant.Offi roruntem qui des eet do doluptatur quunt qu qui u utempor eribusa ndaectiss aut an Officcti ommosae rorun em qu up a ur aati cum quun empor er busa ndaec au erum fugiam ug am id d que quati qua ut u dempora volore vo ore nonsequas autem au em dolupta do up a tiatus a us ut u utas u as porror
ARTIST RECEPTION
GONGBI DEMONSTRATION
AUGUST 27, 6-8 PM
AUGUST 27, 5-6 PM
with all artists in attendance INPUT : OUTPUT
artists show fine-line painting technique
Student curated exh b t on featur ng the work of three Denver art sts
AUGUST 7 SEPTEMBER 5, 2015
Center for V sua Art
965 Santa Fe Dr 303 294 5207 msudenver edu/cva Open 1st and 3rd Fr days unt 8pm
Hours Tue-Fr 11-6 Sat 12-5
XX 16
Date xx,27,xxxx Met High Events August 2015 Mile MetBreak Sports
mymetmedia.com f: themetropolitan @themetonline
Roadrunner volleyball prepared for play By Robert Kemp rkemp9@msudenver.edu
Photo by Abreham Gebreegziabher • agebreeg@msudenver.edu
The Roadrunners have been picked second in a Rocky Mountain Athletic Conference preseason coaches’ poll. Head coach Debbie Hendricks is entering her 16th season with the Roadrunners. “Preseason polls are always funny to me because nobody has played a point of volleyball and yet, we’re trying to predict who the best team is,” Hendricks said. “I think they’re probably basing that on our history and tradition. It’s a complement to our program,
and we certainly take it as such, but it’s just a piece of paper.” Under the leadership of Coach Hendricks, the Lady Runners have a record of 333-136 with 15 consecutive NCAA tournament appearances and six RMAC tournament titles. Among the returning starters are senior outside hitter Kylie Haun and junior middle blocker Vasati Fiatoa. “We try not to focus on rankings and try to just keep on progressing and get better every day throughout the season,” Haun said. “I think the poll was fair. It brings on a lot of pressure, but it’s also a new challenge for all of us to take on as a team,” Fiatoa said.
The Lady Runners lost five graduating seniors last year. “We lost a lot of leadership, and right now, we’re looking to see who is going to jump in there and assert themselves,” Hendricks said. “After seeing what this team is capable of and the new skills that we’ve acquired, I’m excited for this season,” Fiatoa said. The Roadrunners will see their first bit of action during the alumni scrimmage on Saturday, Aug. 29, at the Auraria Event Center. Their first match will be on Friday, Sept. 4, in Big Rapids, Michigan against WisconsinParkside.
Sports Shorts » Have you met Grant? A press conference and meet-andgreet was held Aug. 26 with newlyhired athletics director Dr. Anthony Grant in the athletes lounge at The Regency Athletic Complex. Dr. Grant is the seventh director of athletics in school history. He has over 10 years of experience in collegiate athletics, including the past seven at NCAA Division II Millersville University in Pennsylvania.
» Tennis acquires 8 Head tennis coach Daniel Hangstefer announced the additions of eight student-athletes for the 2015-16 school year. Six were added to the men’s team and two to the women’s roster. Both men’s and women’s tennis will have their first match against Nebraska-Kearney on Sept. 11 in Pueblo.
» Ice Hockey holds open tryouts The Metro club ice hockey team will be hosting tryouts on Saturday Aug. 29th and Thursday Sept. 3rd at the Edge Ice Arena in Littleton. Tryouts are open to all current Metro students and cost $20.00 per skate (payable at tryouts). Individuals with future plans to enroll may also tryout.
With you from your first day of class, to your first futon, to your first house. At U.S. Bank, we offer Student Banking that can grow with you. Our Student Checking account has no monthly maintenance fee or minimum balance,1 free access to more than 5,000 U.S. Bank ATMs, and convenient Online and Mobile Banking.2 And when your needs change, you’ll have the resources of U.S. Bank ready to help. Start the journey with us today. Denver Main Office 950 17th St. 303.585.7340 branch
usbank.com/student
800.771.BANK (2265)
1. All regular account-opening procedures apply. $25 minimum deposit to open an account. Fees for nonroutine transactions may apply. 2. The U.S. Bank Mobile App is free to download. Your mobile carrier may charge access fees depending upon your individual plan. Web access is needed to use the Mobile app. Check with your carrier for specific fees and charges. Some mobile features may require additional online setup. Any fees for optional transactions will be identified during registration for these services and during their use. For a comprehensive list of account pricing, terms and policies, see the Consumer Pricing Information brochure and the Your Deposit Account Agreement. Deposit Products offered by U.S. Bank National Association. Member FDIC. 150469 (8/15)
Mile High @themetonline
f: themetropolitan
Events
mymetmedia.com
Denver Concert Calendar
Auraria Events 8.27: Employer Visit Days: Panera, Tavern Hospitality Group & Landry’s Time: 10am Location: Tivoli Tavern 8.28: Employer Visit Days: Denver Public Schools, JET Program and Stapleton Goddard School Time: 10am Location: Tivoli Tavern 8.29: Kodaly Workshop Time: 8am Location: King Center Dance & Music Studio 8.29: Recreation Professions Silent Auction Time: 6pm Location: Tivoli Brew Pub
8.27: 1964 The Tribute
Location: Red Rocks Ampitheatre Price: $35 Time: 8pm 8.27: Ghost Light Location: Boettcher Concert Hall Price: TBA Time: All Day
8.28: Dave Matthews Band Location: Fiddlers Green Ampitheathre Price: $40.50-80 Time: 7pm
9.1: Paper Bird Location: Red Rocks Ampitheatre Price: $39.50-89.50 Time: 7:30pm
8.29: Trampled by Turtles Location:Red Rocks Ampitheatre Price: $40-45 Time: 7:30pm
9.1: Daryl Hall & John Oates Location: Red Rocks Ampitheatre Price: $39.50-89.50 Time: 7:30pm
8.29: Ice Cube Location: National Western Complex Price: $99-259.98 Time: 2pm
9.1: The Oh Sees
8.30: Major Lazer
8.28-30: Riot Fest Location: Gothic Theatre Price: $10-18 Time: 8pm
8.31: Mondays at MSU Denver: Faculty Recital Time: 2pm Location: King Center Concert Hall 9.24: 2015 Sankofa Lecture Series: Hip Hop: A Soundtrack for Social Change Time: 8am-3pm Location: St Cajetans
Location: National Western Complex Price: $35-45 Time: All Day
Location: Red Rocks Ampitheatre Price: $46.50 Time: 3pm
9.2: Social Distortion & Drag the River Location: Filmore Auditorium Price: $35-40 Time: 7pm
9.1: The Punch Brothers Location: Chautauqua Auditorium Price: $35-52.50 Time: 8pm
9.2 Hoodboi Location: The 1up Colfax Price: $5-10 Time: 9pm
Top Five Ways to Avoid Schoolwork Seven-Day Forecast 8.27: Cloudy
83º/56º
8.28: Cloudy
84º/59º
8.29: Sunny
91º/56º
8.30: Sunny
90º/60º
8.31: Sunny
86º/58º
9.01: Sunny
87º/57º
9.02: Sunny
88º/56º
The Metropolitan online /TheMetropolitan @themetonline mymetmedia.com
1217
August 27, 2015
1. Googling yourself 2. Reddit 3. Binge watching “The Walking Dead” 4. Working out 5. Watching “Duck Tales The Movie”
Trending News “Humans of New York raises $2 million to end Pakistan forced labor” (NBC News) “China stocks plunge to eight-month lows before paring losses” (Reuters) “Cecil the Lion’s family of seven cubs still alive and well” (Wild Cru) “Louisiana State Trooper Is Killed in Shooting at a Traffic Stop” (New York Times) “High-energy LHC plans held up by UFOs and electron clouds” (New Scientist) “’Trains could see ‘airport level’ security ” (CBS) “Stephen Amell and Jon Stewart are a smash at WWE’s SummerSlam” (Wall Street Journal) “Ant knows how to self-medicate to fight off fungal infection” (New Scientist)
Met Sports Men’s Soccer 9.4: vs. Dixie State Time: 8pm Location: St. George, Utah Women’s Tennis 9.11: Nebraska-Kearney Time: 8am Location: Pueblo, Colo Women’s Soccer 8.28: Alumni Game Time: 4:30pm Location: Regency Athletic Complex
Pro Sports Denver Broncos 8.29: vs SF 49ERS 9.3: vs Cardinals 9.13 vs Ravens Colorado Rockies 8.28: @ Pirates 8.29: @ Pirates 8.30: @ Pirates 9.1: vs D-backs 9.2: vs D-backs
7:00 7:00 2:25 5:05 5:05 11:35 1:10 & 6:40 6:40
Met
Break mymetmedia.com
August 27, 2015
Horoscopes
Overheard this week
Capricorn
“A woman who carries a few extra pounds will live longer than the man who mentions it.”
You’ll get a nine-to-five, then promptly quit and return to your gypsy ways.
Met Picks: Cancer
June 21 -July 22 You’ll be asked to bsd with bp and have no idea what’s going on.
Leo
Aquarius
July 23 -August 22
January 20 -February 18 A face tattoo is in your future.
“Stealing someone’s coffee is called mugging.”
That soul patch you’ve been sporting is not okay.
Pisces
“No matter how much you push the envelope, it will still be stationery.”
Virgo
February 19 -March 20
August 23 -September 22
Aries
Libra
March 21 -April 19 You’ll have to take your roommate to the hospital for a broken coccyx.
“Yesterday I held a door for a clown. I thought it was a nice jester.”
September 23 -October 22 Keep telling yourself that hard lemonade is a man’s drink, you’re not fooling anyone.
Scorpio
Taurus
October 23 -November 21
April 20 -May 20
“Pasteurize is too far to see?”
You’ll free yourself from that burden you’ve been carrying.
“1,100 years in prison... I’ve done that.”
Bacon.
64. Bug-eyed 65. Narrow escape 68. Bit of chicanery 69. West Pointer 70. Vitamin pill addition 71. Monopoly card 72. Helps in the worst way 73. Tolstoy’s ‘’--- Karenina’’ Down 1. French clergyman
“Reinacting The Purge, or a bad parking job.” — Cassie Reid “Yeah. I know, I’m guilty. I knew it was wrong, did it anyway.” — Trevor Davis “For threatening a referee for a B.S. call.” —Mike Tolbert “Smuggling Bibles.”
—Michel Hansen
“Flashing the Queen of England.” —Justin Tate “For shaving against the grain.” —Aaron Atencio
Sagittarius
Gemini
November 22 -December 21
May 21 -June 20 Igh!!!
“For lying to the customs agents at Lutton International Airport.” — Mary-Kate Newton
None of the plans you have made for the week will work out.
Congrats! It’s a boy.
“The Energizer Bunny was arrested on a battery charge.”
Across 1. Circus lineup 5. Classic TV’s 86, for one 10. Subtle ‘’Over here!’’ 14. Start up a computer 15. Louisiana waterway 16. Lung opening? 17. Narrowly avoid overtime, in a way 19. Drainage pump 20. Splits to unite 21. Party leader? 23. Old hat 26. Chophouse request 27. Handled clumsily 30. Exterminator’s target, perhaps 32. Nissan rival 35. Japanese Prime Minister Hirobumi 36. Office chair feature 39. Track encounter 40. Searches for gold, in a way 42. Flared dress 43. --- fixe (obsession) 44. Isle of exile 45. Thingamajig 47. Sports-car protector 48. With cunning 50. Dead-end job 51. So far 53. Gung-ho 55. --- voce (softly) 57. Loco 60. Undo, as an amendment
@themetonline
If you were on Interpol’s most wanted list, what would it be for? December 22 -January 19
Hear or see something that makes you laugh? Shake your head? Roll your eyes or say WTF? Tweet it to @themetonline with the hashtag #overheardoncampus
f: themetropolitan
Your spunk and fiery spirit will keep you ahead of the pack.
2. Santa’s revenge 3. Matador’s victim 4. Treeless plain 5. Bottomless gulf 6. Yakker’s gift 7. Suggested object for a tit for tat 8. Life preserver? 9. Teach one-on-one 10. Deli offering 11. Made it out of a packed
aisle 12. Some bottom lines, in math 13. Good night for soldiers 18. Data for detectives 22. 2001 title role for Sean Penn 24. Hand on deck 25. Jealous 27. Vocal cords, in slang 28. In the least bit 29. Eked out the victory 31. Take care of, as a nurse 33. Plow innovator John 34. Bothered incessantly 37. High roller’s roll 38. Place for a shepherd 41. Saved, as a shipwreck 46. Historical info 49. Yang’s counterpart 52. First name among Italian leading ladies 54. Bangladesh’s capital 56. Waste allowances 57. Shakespeare, for one 58. Chills and fever 59. Hunk of marble 61. Entitle oneself to 62. River to the Severn 63. Melodious Horne 66. Keats specialty 67. Place for an acting president?
Sudoku
Difficulty: Easy
Difficulty: Medium
Source: OnlineCrosswords.net
Answers:
18
Date xx, xxxx MetAugust Break Sports Events27, 75004 Review Spective Insight 2015 XX 19
@themetonline f: themetropolitan mymetmedia.com
OUR FUNDS HAVE A RECORD LIKE A BROKEN RECORD.
TIAA-CREF: Lipper’s Best Overall Large Fund Company three years in a row. For the first time ever. How? Our disciplined investment strategy aims to produce competitive risk-adjusted returns that create long-term value for you. Just what you’d expect from a company that’s created to serve and built to perform. 1
Learn more about our unprecedented, award-winning performance at TIAA.org/Perform BUILT TO PERFORM. CREATED TO SERVE.
5021A0058 C24849B Fall B2C Print BROKEN RECORD_10x6_nwsprnt_2.indd Cyan Magenta Yellow Black
1
The Lipper Awards are based on a review of 36 companies’ 2012 and 48 companies’ 2013 and 2014 risk-adjusted performance.
The Lipper Award is given to the group with the lowest average decile ranking of three years’ Consistent Return for eligible funds over the three-year period ended 11/30/12, 11/30/13, and 11/30/14 respectively. TIAA-CREF was ranked among 36 fund companies in 2012 and 48 fund companies in 2013 and 2014 with at least five equity, five bond, or three mixed-asset portfolios. Past performance does not guarantee future results. For current performance and rankings, please visit the Research and Performance section on tiaa-cref.org. TIAA-CREF Individual & Institutional Services, LLC, Teachers Personal Investors Services, Inc., and Nuveen Securities, LLC, members FINRA and SIPC, distribute securities products. ©2015 Teachers Insurance and Annuity Association of America–College Retirement Equities Fund (TIAA-CREF), 730 Third Avenue, New York, NY 10017. C24849B 1
Consider investment objectives, risks, charges and expenses carefully before investing. Go to tiaa-cref.org for product and fund prospectuses that contain this and other information. Read carefully before investing. TIAA-CREF funds are subject to market and other risk factors.
www.msudenver.edu/campusrec
303-556-3210
Train to run a 5K race
PaceSetter
Schedule September 8 â&#x20AC;&#x201C; October 15
$30
for current students and faculty/ staff with valid CRA membership.
Register: Room 108 PE Building Running workouts with resistance and stretching exercises led by a certified personal trainer in a group format. Mileage will gradually increase throughout the 6 weeks. All running abilities welcome.
Tuesdays and Thursdays Noonâ&#x20AC;&#x201C;1 p.m.